F397888
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 232 | 610 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300002244|JGI24742J22300_10004342|JGI24742J22300_100043422 |
| Length | 384 |
| Sequence | MSGKFSSGLLAGLDGLAEVAIAVVAAAEHRATRAGEHQILMSLATISFRRQTAHLRPXVVRASGHDGRMRVTVLGAGVAGLTTASRLLAAGCQVRVVAAAPIEQSTSYLAAAVWFPTHVGPADRVADWGRQTYDVLAEQAARGIPGVVMRESLALYREPPREPEWADAVRGVRAATAAELPPGYGYGLRYAVPLVEMPRYLPWLAEQVGTNGAEVYTRRVHSLLELAEDGVDVIVNCSGLAARELVGDQSVYPVRGQIARVSNPGLSMSVRDEQHPEGRAYVHPRQNDCILGGTLDEHSWDTRVDLDTAASILRRCRDIAPALDEATVIDHVVGLRPGRPTVRLEEDARDETGPRILHNYGHGGAGITISWGCAEELTALVLRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 105 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 111 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 117 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 118 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 123 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 126 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 127 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 128 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 197 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 198 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 199 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 200 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 201 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 202 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 203 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 204 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 205 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 206 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 207 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 208 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 209 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 210 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 211 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 212 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 213 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 214 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 215 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 216 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 217 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 218 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 219 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 220 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 221 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 222 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 223 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 224 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 225 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 226 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 227 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 228 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 229 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 230 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 231 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 232 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.54 |
| Metatranscriptomes | 0.98 |
| Isolates | 11.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.31 |
| Nodule | 0.66 |
| Rhizoplane | 5.57 |
| Rhizosphere | 81.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10004342 | 3300002244 | Bacteria | 2318 |
| 2 | JGI24739J22299_10037026 | 3300001989 | Bacteria | 1645 |
| 3 | JGI24735J21928_10031183 | 3300002067 | Bacteria | 1581 |
| 4 | JGI24744J21845_10005077 | 3300002077 | Bacteria | 2722 |
| 5 | JGI24744J21845_10011225 | 3300002077 | Bacteria | 1834 |
| 6 | Ga0006562J51391_1091758 | 3300003578 | Bacteria | 3986 |
| 7 | Ga0070683_100087907 | 3300005329 | Bacteria | 2915 |
| 8 | Ga0070682_100001230 | 3300005337 | Bacteria | 14583 |
| 9 | Ga0068868_100028018 | 3300005338 | Bacteria | 4302 |
| 10 | Ga0070689_100056990 | 3300005340 | Bacteria | 3031 |
| 11 | Ga0070668_100071303 | 3300005347 | Bacteria | 2706 |
| 12 | Ga0070668_100322464 | 3300005347 | Unclassified | 1301 |
| 13 | Ga0070669_100027302 | 3300005353 | Bacteria | 4107 |
| 14 | Ga0070659_100041497 | 3300005366 | Bacteria | 3597 |
| 15 | Ga0070711_100003024 | 3300005439 | Bacteria | 9722 |
| 16 | Ga0070705_100142220 | 3300005440 | Unclassified | 1580 |
| 17 | Ga0070700_100256330 | 3300005441 | Unclassified | 1257 |
| 18 | Ga0070708_100044801 | 3300005445 | Bacteria | 3893 |
| 19 | Ga0070663_100153103 | 3300005455 | Bacteria | 1769 |
| 20 | Ga0070678_100020689 | 3300005456 | Bacteria | 4322 |
| 21 | Ga0070662_100053711 | 3300005457 | Bacteria | 2917 |
| 22 | Ga0068867_100013940 | 3300005459 | Bacteria | 5690 |
| 23 | Ga0068853_100189800 | 3300005539 | Bacteria | 1866 |
| 24 | Ga0070686_100413568 | 3300005544 | Unclassified | 1029 |
| 25 | Ga0070695_100075245 | 3300005545 | Bacteria | 2221 |
| 26 | Ga0070696_100018519 | 3300005546 | Bacteria | 4707 |
| 27 | Ga0070693_100085161 | 3300005547 | Bacteria | 1893 |
| 28 | Ga0070665_100159627 | 3300005548 | Bacteria | 2256 |
| 29 | Ga0070665_100228746 | 3300005548 | Bacteria | 1859 |
| 30 | Ga0070704_100008221 | 3300005549 | Bacteria | 6242 |
| 31 | Ga0068854_100105488 | 3300005578 | Bacteria | 2118 |
| 32 | Ga0068856_100419123 | 3300005614 | Bacteria | 1359 |
| 33 | Ga0070702_100008053 | 3300005615 | Bacteria | 5086 |
| 34 | Ga0068859_100167357 | 3300005617 | Bacteria | 2278 |
| 35 | Ga0068866_10057654 | 3300005718 | Bacteria | 2002 |
| 36 | Ga0068866_10096498 | 3300005718 | Bacteria | 1621 |
| 37 | Ga0068861_100118749 | 3300005719 | Unclassified | 2130 |
| 38 | Ga0068870_10088603 | 3300005840 | Bacteria | 1725 |
| 39 | Ga0068858_100042583 | 3300005842 | Bacteria | 4209 |
| 40 | Ga0068860_100006158 | 3300005843 | Bacteria | 12065 |
| 41 | Ga0068860_100061435 | 3300005843 | Bacteria | 3570 |
| 42 | Ga0068862_100035120 | 3300005844 | Unclassified | 4243 |
| 43 | Ga0068862_100227239 | 3300005844 | Bacteria | 1692 |
| 44 | Ga0068862_100242102 | 3300005844 | Unclassified | 1640 |
| 45 | Ga0070712_100276390 | 3300006175 | Bacteria | 1351 |
| 46 | Ga0097621_100157969 | 3300006237 | Bacteria | 1947 |
| 47 | Ga0075433_10004583 | 3300006852 | Bacteria | 10782 |
| 48 | Ga0075429_100003872 | 3300006880 | Bacteria | 12784 |
| 49 | Ga0075429_100134440 | 3300006880 | Bacteria | 2164 |
| 50 | Ga0068865_100027279 | 3300006881 | Bacteria | 3771 |
| 51 | Ga0097620_100167356 | 3300006931 | Bacteria | 2278 |
| 52 | Ga0111539_10116351 | 3300009094 | Bacteria | 3135 |
| 53 | Ga0105245_10071118 | 3300009098 | Bacteria | 3159 |
| 54 | Ga0105245_10123404 | 3300009098 | Bacteria | 2422 |
| 55 | Ga0105247_10047697 | 3300009101 | Bacteria | 2631 |
| 56 | Ga0114129_10005532 | 3300009147 | Bacteria | 17872 |
| 57 | Ga0105243_10033181 | 3300009148 | Bacteria | 3991 |
| 58 | Ga0105243_10281832 | 3300009148 | Bacteria | 1497 |
| 59 | Ga0105241_10039580 | 3300009174 | Bacteria | 3557 |
| 60 | Ga0105241_10059639 | 3300009174 | Bacteria | 2934 |
| 61 | Ga0105242_10031474 | 3300009176 | Unclassified | 4238 |
| 62 | Ga0105248_10173671 | 3300009177 | Bacteria | 2429 |
| 63 | Ga0105238_10132717 | 3300009551 | Bacteria | 2469 |
| 64 | Ga0105249_10089690 | 3300009553 | Unclassified | 2874 |
| 65 | Ga0105249_10096239 | 3300009553 | Bacteria | 2777 |
| 66 | Ga0105246_10010904 | 3300011119 | Bacteria | 5634 |
| 67 | Ga0157369_10416527 | 3300013105 | Bacteria | 1393 |
| 68 | Ga0157378_10106491 | 3300013297 | Bacteria | 2565 |
| 69 | Ga0157372_10064307 | 3300013307 | Bacteria | 4116 |
| 70 | Ga0157372_10092574 | 3300013307 | Bacteria | 3439 |
| 71 | Ga0157375_10078904 | 3300013308 | Bacteria | 3327 |
| 72 | Ga0163163_10295820 | 3300014325 | Bacteria | 1671 |
| 73 | Ga0157380_10025386 | 3300014326 | Bacteria | 4494 |
| 74 | Ga0157377_10029369 | 3300014745 | Bacteria | 2967 |
| 75 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 76 | Ga0163161_10230312 | 3300017792 | Bacteria | 1438 |
| 77 | Ga0206351_10969111 | 3300020077 | Eukaryota | 1242 |
| 78 | Ga0213875_10007964 | 3300021388 | Bacteria | 5449 |
| 79 | Ga0213875_10008286 | 3300021388 | Bacteria | 5330 |
| 80 | Ga0224712_10093427 | 3300022467 | Eukaryota | 1264 |
| 81 | Ga0209758_1003466 | 3300025297 | Bacteria | 14304 |
| 82 | Ga0207426_1025069 | 3300025302 | Bacteria | 2013 |
| 83 | Ga0207642_10005893 | 3300025899 | Bacteria | 4035 |
| 84 | Ga0207688_10003413 | 3300025901 | Bacteria | 8666 |
| 85 | Ga0207680_10221576 | 3300025903 | Unclassified | 1297 |
| 86 | Ga0207647_10022985 | 3300025904 | Bacteria | 4134 |
| 87 | Ga0207643_10129102 | 3300025908 | Bacteria | 1502 |
| 88 | Ga0207654_10095413 | 3300025911 | Bacteria | 1822 |
| 89 | Ga0207693_10002832 | 3300025915 | Bacteria | 15022 |
| 90 | Ga0207693_10022482 | 3300025915 | Bacteria | 5011 |
| 91 | Ga0207663_10169566 | 3300025916 | Bacteria | 1549 |
| 92 | Ga0207662_10154218 | 3300025918 | Bacteria | 1463 |
| 93 | Ga0207687_10020552 | 3300025927 | Bacteria | 4381 |
| 94 | Ga0207687_10024407 | 3300025927 | Bacteria | 4040 |
| 95 | Ga0207690_10028811 | 3300025932 | Bacteria | 3523 |
| 96 | Ga0207690_10089383 | 3300025932 | Bacteria | 2172 |
| 97 | Ga0207706_10130281 | 3300025933 | Unclassified | 2212 |
| 98 | Ga0207706_10198030 | 3300025933 | Bacteria | 1762 |
| 99 | Ga0207686_10096382 | 3300025934 | Bacteria | 1965 |
| 100 | Ga0207669_10028913 | 3300025937 | Bacteria | 3056 |
| 101 | Ga0207669_10056681 | 3300025937 | Bacteria | 2381 |
| 102 | Ga0207704_10112467 | 3300025938 | Bacteria | 1844 |
| 103 | Ga0207689_10015194 | 3300025942 | Bacteria | 6520 |
| 104 | Ga0207661_10046899 | 3300025944 | Bacteria | 3428 |
| 105 | Ga0207668_10220865 | 3300025972 | Bacteria | 1521 |
| 106 | Ga0207640_10407063 | 3300025981 | Unclassified | 1109 |
| 107 | Ga0207708_10026381 | 3300026075 | Bacteria | 4396 |
| 108 | Ga0207702_10092384 | 3300026078 | Bacteria | 2652 |
| 109 | Ga0207641_10154538 | 3300026088 | Bacteria | 2081 |
| 110 | Ga0207648_10027739 | 3300026089 | Bacteria | 5025 |
| 111 | Ga0207676_10028523 | 3300026095 | Bacteria | 4171 |
| 112 | Ga0207675_100024948 | 3300026118 | Bacteria | 5563 |
| 113 | Ga0207683_10052346 | 3300026121 | Bacteria | 3577 |
| 114 | Ga0268266_10210633 | 3300028379 | Bacteria | 1782 |
| 115 | Ga0268265_10077001 | 3300028380 | Unclassified | 2618 |
| 116 | Ga0268265_10519368 | 3300028380 | Bacteria | 1125 |
| 117 | Ga0268264_10356316 | 3300028381 | Bacteria | 1394 |
| 118 | Ga0307515_10196094 | 3300028794 | Bacteria | 1911 |
| 119 | Ga0307511_10043966 | 3300030521 | Bacteria | 3720 |
| 120 | Ga0307512_10003527 | 3300030522 | Bacteria | 18086 |
| 121 | Ga0265340_10000392 | 3300031247 | Bacteria | 23411 |
| 122 | Ga0307513_10020921 | 3300031456 | Bacteria | 7740 |
| 123 | Ga0307408_100236620 | 3300031548 | Bacteria | 1499 |
| 124 | Ga0307508_10003603 | 3300031616 | Bacteria | 15559 |
| 125 | Ga0307508_10017684 | 3300031616 | Bacteria | 6482 |
| 126 | Ga0307514_10229549 | 3300031649 | Bacteria | 1127 |
| 127 | Ga0265314_10047005 | 3300031711 | Bacteria | 3041 |
| 128 | Ga0307405_10042726 | 3300031731 | Unclassified | 2761 |
| 129 | Ga0307405_10291150 | 3300031731 | Bacteria | 1234 |
| 130 | Ga0307413_10179750 | 3300031824 | Bacteria | 1507 |
| 131 | Ga0307413_10190453 | 3300031824 | Bacteria | 1472 |
| 132 | Ga0307410_10081357 | 3300031852 | Bacteria | 2275 |
| 133 | Ga0307406_10172664 | 3300031901 | Bacteria | 1566 |
| 134 | Ga0307407_10112865 | 3300031903 | Bacteria | 1709 |
| 135 | Ga0307407_10268139 | 3300031903 | Unclassified | 1177 |
| 136 | Ga0307407_10286894 | 3300031903 | Bacteria | 1142 |
| 137 | Ga0307412_10153009 | 3300031911 | Bacteria | 1705 |
| 138 | Ga0307409_100006073 | 3300031995 | Bacteria | 7054 |
| 139 | Ga0307409_100069937 | 3300031995 | Bacteria | 2784 |
| 140 | Ga0307416_100091122 | 3300032002 | Bacteria | 2617 |
| 141 | Ga0307415_100207077 | 3300032126 | Bacteria | 1561 |
| 142 | Ga0373952_0035341 | 3300035092 | Bacteria | 1131 |
| 143 | Ga0373939_0062056 | 3300035114 | Unclassified | 1193 |
| 144 | Ga0373931_0168932 | 3300035691 | Bacteria | 1287 |
| 145 | Ga0395900_0126729 | 3300037418 | Bacteria | 2619 |
| 146 | Ga0395898_0018983 | 3300037466 | Bacteria | 7003 |
| 147 | Ga0395898_0082887 | 3300037466 | Bacteria | 3091 |
| 148 | Ga0436364_0667270 | 3300037853 | Bacteria | 158868 |
| 149 | Ga0436364_0925981 | 3300037853 | Bacteria | 14259 |
| 150 | Ga0439436_0000589 | 3300041404 | Bacteria | 9621 |
| 151 | Ga0439436_0015598 | 3300041404 | Bacteria | 2284 |
| 152 | Ga0451841_1361042 | 3300041498 | Bacteria | 1225 |
| 153 | Ga0451853_0485433 | 3300041512 | Bacteria | 2638 |
| 154 | Ga0439462_0031826 | 3300042015 | Bacteria | 1398 |
| 155 | Ga0450899_000294 | 3300042135 | Bacteria | 5430 |
| 156 | Ga0450900_001285 | 3300042136 | Bacteria | 2410 |
| 157 | Ga0450906_001033 | 3300042145 | Bacteria | 6126 |
| 158 | Ga0466965_0150342 | 3300044683 | Unclassified | 1217 |
| 159 | Ga0466957_0113086 | 3300044842 | Bacteria | 1724 |
| 160 | Ga0466959_0157622 | 3300045049 | Bacteria | 1597 |
| 161 | Ga0466967_0050781 | 3300045976 | Bacteria | 3632 |
| 162 | Ga0466967_0091368 | 3300045976 | Bacteria | 2767 |
| 163 | Ga0495592_0070217 | 3300046454 | Bacteria | 2552 |
| 164 | Ga0495603_0000817 | 3300046455 | Bacteria | 17867 |
| 165 | Ga0495603_0001832 | 3300046455 | Bacteria | 12533 |
| 166 | Ga0495603_0005116 | 3300046455 | Bacteria | 7834 |
| 167 | Ga0495603_0005205 | 3300046455 | Bacteria | 7763 |
| 168 | Ga0495603_0054203 | 3300046455 | Bacteria | 2377 |
| 169 | Ga0495590_0029032 | 3300046457 | Bacteria | 1940 |
| 170 | Ga0495629_0000446 | 3300046459 | Bacteria | 34452 |
| 171 | Ga0495629_0001434 | 3300046459 | Bacteria | 18787 |
| 172 | Ga0495629_0043356 | 3300046459 | Bacteria | 3159 |
| 173 | Ga0495629_0089330 | 3300046459 | Bacteria | 2149 |
| 174 | Ga0495629_0218946 | 3300046459 | Bacteria | 1313 |
| 175 | Ga0495638_0005271 | 3300046460 | Bacteria | 9660 |
| 176 | Ga0495638_0071568 | 3300046460 | Bacteria | 2121 |
| 177 | Ga0495580_0088812 | 3300046472 | Bacteria | 2152 |
| 178 | Ga0495582_0086387 | 3300046473 | Bacteria | 1746 |
| 179 | Ga0495605_0026758 | 3300046474 | Bacteria | 2995 |
| 180 | Ga0495662_0007199 | 3300046476 | Bacteria | 5511 |
| 181 | Ga0495662_0033616 | 3300046476 | Bacteria | 2477 |
| 182 | Ga0495662_0230332 | 3300046476 | Bacteria | 913 |
| 183 | Ga0495594_0001306 | 3300046499 | Bacteria | 12982 |
| 184 | Ga0495594_0005526 | 3300046499 | Bacteria | 6492 |
| 185 | Ga0495583_0062406 | 3300046506 | Bacteria | 1659 |
| 186 | Ga0495583_0091640 | 3300046506 | Bacteria | 1307 |
| 187 | Ga0495606_0224871 | 3300046507 | Bacteria | 1055 |
| 188 | Ga0495610_0036862 | 3300046512 | Bacteria | 2495 |
| 189 | Ga0495616_0076104 | 3300046513 | Bacteria | 1613 |
| 190 | Ga0495618_0203879 | 3300046514 | Bacteria | 1251 |
| 191 | Ga0495620_0030820 | 3300046515 | Bacteria | 2464 |
| 192 | Ga0495620_0059318 | 3300046515 | Bacteria | 1599 |
| 193 | Ga0495643_0006594 | 3300046522 | Bacteria | 7629 |
| 194 | Ga0495666_0010768 | 3300046526 | Bacteria | 4562 |
| 195 | Ga0495640_0005132 | 3300046533 | Bacteria | 10410 |
| 196 | Ga0495640_0097883 | 3300046533 | Bacteria | 1929 |
| 197 | Ga0495640_0137419 | 3300046533 | Bacteria | 1577 |
| 198 | Ga0495622_0001613 | 3300046557 | Bacteria | 11133 |
| 199 | Ga0495622_0029734 | 3300046557 | Bacteria | 2552 |
| 200 | Ga0495668_0007182 | 3300046616 | Bacteria | 7160 |
| 201 | Ga0495668_0098886 | 3300046616 | Bacteria | 1596 |
| 202 | Ga0495634_0111287 | 3300046642 | Bacteria | 1760 |
| 203 | Ga0495611_0051060 | 3300046648 | Bacteria | 1863 |
| 204 | Ga0495588_0010941 | 3300046674 | Bacteria | 4244 |
| 205 | Ga0495588_0052762 | 3300046674 | Bacteria | 2096 |
| 206 | Ga0495588_0062394 | 3300046674 | Bacteria | 1932 |
| 207 | Ga0495657_0007641 | 3300046675 | Bacteria | 8326 |
| 208 | Ga0495657_0028858 | 3300046675 | Bacteria | 3896 |
| 209 | Ga0495657_0078151 | 3300046675 | Bacteria | 2145 |
| 210 | Ga0495613_0010836 | 3300046689 | Bacteria | 6764 |
| 211 | Ga0495613_0026462 | 3300046689 | Bacteria | 4320 |
| 212 | Ga0495613_0079547 | 3300046689 | Bacteria | 2383 |
| 213 | Ga0495624_0057321 | 3300046690 | Bacteria | 2449 |
| 214 | Ga0495649_0066727 | 3300046694 | Bacteria | 1931 |
| 215 | Ga0495589_0047493 | 3300046794 | Bacteria | 2127 |
| 216 | Ga0495589_0051349 | 3300046794 | Bacteria | 2039 |
| 217 | Ga0495581_0022975 | 3300047315 | Bacteria | 3612 |
| 218 | Ga0495604_0009476 | 3300047317 | Bacteria | 7695 |
| 219 | Ga0495636_0005624 | 3300047318 | Bacteria | 4916 |
| 220 | Ga0495636_0081814 | 3300047318 | Bacteria | 1391 |
| 221 | Ga0495676_0030585 | 3300047321 | Bacteria | 4565 |
| 222 | Ga0495676_0043320 | 3300047321 | Bacteria | 3685 |
| 223 | Ga0495676_0089210 | 3300047321 | Bacteria | 2310 |
| 224 | Ga0495676_0099096 | 3300047321 | Bacteria | 2160 |
| 225 | Ga0495680_0015374 | 3300047322 | Bacteria | 6604 |
| 226 | Ga0495687_002292 | 3300047443 | Bacteria | 15648 |
| 227 | Ga0495687_066152 | 3300047443 | Bacteria | 1468 |
| 228 | Ga0495687_068683 | 3300047443 | Bacteria | 1429 |
| 229 | Ga0495677_0101013 | 3300047445 | Bacteria | 1092 |
| 230 | Ga0495685_084569 | 3300047447 | Bacteria | 1055 |
| 231 | Ga0495681_0029728 | 3300047470 | Bacteria | 2793 |
| 232 | Ga0495686_0075699 | 3300047472 | Bacteria | 2063 |
| 233 | Ga0495593_0076940 | 3300047673 | Bacteria | 1729 |
| 234 | Ga0495593_0173528 | 3300047673 | Bacteria | 1086 |
| 235 | Ga0495614_0000816 | 3300048089 | Bacteria | 13163 |
| 236 | Ga0495614_0111525 | 3300048089 | Bacteria | 1201 |
| 237 | Ga0496100_0193079 | 3300048903 | Bacteria | 1479 |
| 238 | Ga0496101_0242616 | 3300048904 | Bacteria | 1402 |
| 239 | Ga0496102_0021427 | 3300048905 | Bacteria | 5716 |
| 240 | Ga0496103_0021082 | 3300048906 | Bacteria | 3920 |
| 241 | Ga0496106_0026984 | 3300048909 | Bacteria | 4276 |
| 242 | Ga0496106_0114116 | 3300048909 | Bacteria | 2106 |
| 243 | Ga0496106_0121826 | 3300048909 | Unclassified | 2039 |
| 244 | Ga0496107_0093893 | 3300048910 | Bacteria | 2194 |
| 245 | Ga0496108_0000399 | 3300048911 | Bacteria | 35847 |
| 246 | Ga0496108_0001073 | 3300048911 | Bacteria | 21338 |
| 247 | Ga0496109_0001427 | 3300048912 | Bacteria | 19839 |
| 248 | Ga0496109_0064801 | 3300048912 | Bacteria | 3344 |
| 249 | Ga0496110_0083074 | 3300048913 | Bacteria | 2857 |
| 250 | Ga0496110_0166019 | 3300048913 | Bacteria | 2002 |
| 251 | Ga0496114_0079839 | 3300048917 | Unclassified | 2762 |
| 252 | Ga0496114_0088069 | 3300048917 | Bacteria | 2633 |
| 253 | Ga0496115_0158302 | 3300048918 | Bacteria | 1871 |
| 254 | Ga0495678_045179 | 3300049459 | Bacteria | 1739 |
| 255 | Ga0501033_0013157 | 3300049570 | Bacteria | 6303 |
| 256 | Ga0501036_0000951 | 3300049572 | Bacteria | 21789 |
| 257 | Ga0501038_0054774 | 3300049574 | Bacteria | 3429 |
| 258 | Ga0501070_0349566 | 3300049586 | Bacteria | 1200 |
| 259 | Ga0501044_0008984 | 3300049823 | Bacteria | 10927 |
| 260 | nmdc:mga05p37_153194_c1 | 3300050507 | Unclassified | 2818 |
| 261 | nmdc:mga05p37_23222_c1 | 3300050507 | Bacteria | 7523 |
| 262 | nmdc:mga05p37_485545_c1 | 3300050507 | Bacteria | 1422 |
| 263 | nmdc:mga09592_100106_c1 | 3300050508 | Bacteria | 2482 |
| 264 | nmdc:mga09592_213606_c1 | 3300050508 | Bacteria | 1671 |
| 265 | nmdc:mga09592_25459_c1 | 3300050508 | Bacteria | 4898 |
| 266 | nmdc:mga06r32_23949_c1 | 3300050510 | Bacteria | 5658 |
| 267 | nmdc:mga08y16_311230_c1 | 3300050511 | Bacteria | 1622 |
| 268 | nmdc:mga0a205_8490_c1 | 3300050515 | Bacteria | 9343 |
| 269 | Ga0500578_0262852 | 3300053086 | Bacteria | 1036 |
| 270 | Ga0500556_0080404 | 3300053104 | Bacteria | 1231 |
| 271 | 2585301960 | 2582581312 | Bacteria | 7308206 |
| 272 | 2616698992 | 2616644814 | Bacteria | 11555299 |
| 273 | 2643901725 | 2643221578 | Bacteria | 9213798 |
| 274 | 2644387890 | 2643221670 | Bacteria | 6497041 |
| 275 | 2644407871 | 2643221673 | Bacteria | 9196637 |
| 276 | 2644438145 | 2643221678 | Bacteria | 9540101 |
| 277 | 2644631863 | 2643221714 | Bacteria | 9015452 |
| 278 | 2784591910 | 2784132148 | Bacteria | 8627943 |
| 279 | 2785339807 | 2784746763 | Bacteria | 9783172 |
| 280 | 2808845278 | 2808606359 | Bacteria | 9866990 |
| 281 | 2808914976 | 2808606375 | Bacteria | 9466072 |
| 282 | 2809235521 | 2808606448 | Bacteria | 8656184 |
| 283 | 2811843255 | 2808606982 | Bacteria | 7791042 |
| 284 | 2812354433 | 2811994879 | Bacteria | 9313447 |
| 285 | 2812477410 | 2811994917 | Bacteria | 7761064 |
| 286 | 2852636056 | 2852635781 | Bacteria | 8251373 |
| 287 | 2862283097 | 2862281513 | Bacteria | 9621493 |
| 288 | 2862384378 | 2862382967 | Bacteria | 10317375 |
| 289 | 2863410213 | 2863404153 | Bacteria | 9672205 |
| 290 | 2870789155 | 2870782633 | Bacteria | 9624083 |
| 291 | 2875397879 | 2875391855 | Bacteria | 7600475 |
| 292 | 2912716053 | 2912715099 | Bacteria | 9460473 |
| 293 | 2912729003 | 2912723979 | Bacteria | 8557534 |
| 294 | 2918507652 | 2918501144 | Bacteria | 8668083 |
| 295 | 2919470931 | 2919468124 | Bacteria | 9133025 |
| 296 | 2946046612 | 2946045630 | Bacteria | 8527308 |
| 297 | 2946071270 | 2946064051 | Bacteria | 8957905 |
| 298 | 2947225475 | 2947224130 | Bacteria | 9938529 |
| 299 | 2954009689 | 2954002825 | Bacteria | 9173742 |
| 300 | 2990063427 | 2990059506 | Bacteria | 9321252 |
| 301 | 3006494768 | 3006493962 | Bacteria | 8825450 |
| 302 | 8008564208 | 8008558824 | Bacteria | 10610750 |
| 303 | 8023631437 | 8023623736 | Bacteria | 8593882 |
| 304 | 8048409665 | 8048406513 | Bacteria | 8936924 |
| 305 | 8056452821 | 8056447290 | Bacteria | 7680491 |
| 306 | JGI24742J22300_10004342 | |||
| 307 | JGI24739J22299_10037026 | |||
| 308 | JGI24735J21928_10031183 | |||
| 309 | JGI24744J21845_10005077 | |||
| 310 | JGI24744J21845_10011225 | |||
| 311 | Ga0006562J51391_1091758 | |||
| 312 | Ga0070683_100087907 | |||
| 313 | Ga0070682_100001230 | |||
| 314 | Ga0068868_100028018 | |||
| 315 | Ga0070689_100056990 | |||
| 316 | Ga0070668_100071303 | |||
| 317 | Ga0070668_100322464 | |||
| 318 | Ga0070669_100027302 | |||
| 319 | Ga0070659_100041497 | |||
| 320 | Ga0070711_100003024 | |||
| 321 | Ga0070705_100142220 | |||
| 322 | Ga0070700_100256330 | |||
| 323 | Ga0070708_100044801 | |||
| 324 | Ga0070663_100153103 | |||
| 325 | Ga0070678_100020689 | |||
| 326 | Ga0070662_100053711 | |||
| 327 | Ga0068867_100013940 | |||
| 328 | Ga0068853_100189800 | |||
| 329 | Ga0070686_100413568 | |||
| 330 | Ga0070695_100075245 | |||
| 331 | Ga0070696_100018519 | |||
| 332 | Ga0070693_100085161 | |||
| 333 | Ga0070665_100159627 | |||
| 334 | Ga0070665_100228746 | |||
| 335 | Ga0070704_100008221 | |||
| 336 | Ga0068854_100105488 | |||
| 337 | Ga0068856_100419123 | |||
| 338 | Ga0070702_100008053 | |||
| 339 | Ga0068859_100167357 | |||
| 340 | Ga0068866_10057654 | |||
| 341 | Ga0068866_10096498 | |||
| 342 | Ga0068861_100118749 | |||
| 343 | Ga0068870_10088603 | |||
| 344 | Ga0068858_100042583 | |||
| 345 | Ga0068860_100006158 | |||
| 346 | Ga0068860_100061435 | |||
| 347 | Ga0068862_100035120 | |||
| 348 | Ga0068862_100227239 | |||
| 349 | Ga0068862_100242102 | |||
| 350 | Ga0070712_100276390 | |||
| 351 | Ga0097621_100157969 | |||
| 352 | Ga0075433_10004583 | |||
| 353 | Ga0075429_100003872 | |||
| 354 | Ga0075429_100134440 | |||
| 355 | Ga0068865_100027279 | |||
| 356 | Ga0097620_100167356 | |||
| 357 | Ga0111539_10116351 | |||
| 358 | Ga0105245_10071118 | |||
| 359 | Ga0105245_10123404 | |||
| 360 | Ga0105247_10047697 | |||
| 361 | Ga0114129_10005532 | |||
| 362 | Ga0105243_10033181 | |||
| 363 | Ga0105243_10281832 | |||
| 364 | Ga0105241_10039580 | |||
| 365 | Ga0105241_10059639 | |||
| 366 | Ga0105242_10031474 | |||
| 367 | Ga0105248_10173671 | |||
| 368 | Ga0105238_10132717 | |||
| 369 | Ga0105249_10089690 | |||
| 370 | Ga0105249_10096239 | |||
| 371 | Ga0105246_10010904 | |||
| 372 | Ga0157369_10416527 | |||
| 373 | Ga0157378_10106491 | |||
| 374 | Ga0157372_10064307 | |||
| 375 | Ga0157372_10092574 | |||
| 376 | Ga0157375_10078904 | |||
| 377 | Ga0163163_10295820 | |||
| 378 | Ga0157380_10025386 | |||
| 379 | Ga0157377_10029369 | |||
| 380 | Ga0183367_1001 | |||
| 381 | Ga0163161_10230312 | |||
| 382 | Ga0206351_10969111 | |||
| 383 | Ga0213875_10007964 | |||
| 384 | Ga0213875_10008286 | |||
| 385 | Ga0224712_10093427 | |||
| 386 | Ga0209758_1003466 | |||
| 387 | Ga0207426_1025069 | |||
| 388 | Ga0207642_10005893 | |||
| 389 | Ga0207688_10003413 | |||
| 390 | Ga0207680_10221576 | |||
| 391 | Ga0207647_10022985 | |||
| 392 | Ga0207643_10129102 | |||
| 393 | Ga0207654_10095413 | |||
| 394 | Ga0207693_10002832 | |||
| 395 | Ga0207693_10022482 | |||
| 396 | Ga0207663_10169566 | |||
| 397 | Ga0207662_10154218 | |||
| 398 | Ga0207687_10020552 | |||
| 399 | Ga0207687_10024407 | |||
| 400 | Ga0207690_10028811 | |||
| 401 | Ga0207690_10089383 | |||
| 402 | Ga0207706_10130281 | |||
| 403 | Ga0207706_10198030 | |||
| 404 | Ga0207686_10096382 | |||
| 405 | Ga0207669_10028913 | |||
| 406 | Ga0207669_10056681 | |||
| 407 | Ga0207704_10112467 | |||
| 408 | Ga0207689_10015194 | |||
| 409 | Ga0207661_10046899 | |||
| 410 | Ga0207668_10220865 | |||
| 411 | Ga0207640_10407063 | |||
| 412 | Ga0207708_10026381 | |||
| 413 | Ga0207702_10092384 | |||
| 414 | Ga0207641_10154538 | |||
| 415 | Ga0207648_10027739 | |||
| 416 | Ga0207676_10028523 | |||
| 417 | Ga0207675_100024948 | |||
| 418 | Ga0207683_10052346 | |||
| 419 | Ga0268266_10210633 | |||
| 420 | Ga0268265_10077001 | |||
| 421 | Ga0268265_10519368 | |||
| 422 | Ga0268264_10356316 | |||
| 423 | Ga0307515_10196094 | |||
| 424 | Ga0307511_10043966 | |||
| 425 | Ga0307512_10003527 | |||
| 426 | Ga0265340_10000392 | |||
| 427 | Ga0307513_10020921 | |||
| 428 | Ga0307408_100236620 | |||
| 429 | Ga0307508_10003603 | |||
| 430 | Ga0307508_10017684 | |||
| 431 | Ga0307514_10229549 | |||
| 432 | Ga0265314_10047005 | |||
| 433 | Ga0307405_10042726 | |||
| 434 | Ga0307405_10291150 | |||
| 435 | Ga0307413_10179750 | |||
| 436 | Ga0307413_10190453 | |||
| 437 | Ga0307410_10081357 | |||
| 438 | Ga0307406_10172664 | |||
| 439 | Ga0307407_10112865 | |||
| 440 | Ga0307407_10268139 | |||
| 441 | Ga0307407_10286894 | |||
| 442 | Ga0307412_10153009 | |||
| 443 | Ga0307409_100006073 | |||
| 444 | Ga0307409_100069937 | |||
| 445 | Ga0307416_100091122 | |||
| 446 | Ga0307415_100207077 | |||
| 447 | Ga0373952_0035341 | |||
| 448 | Ga0373939_0062056 | |||
| 449 | Ga0373931_0168932 | |||
| 450 | Ga0395900_0126729 | |||
| 451 | Ga0395898_0018983 | |||
| 452 | Ga0395898_0082887 | |||
| 453 | Ga0436364_0667270 | |||
| 454 | Ga0436364_0925981 | |||
| 455 | Ga0439436_0000589 | |||
| 456 | Ga0439436_0015598 | |||
| 457 | Ga0451841_1361042 | |||
| 458 | Ga0451853_0485433 | |||
| 459 | Ga0439462_0031826 | |||
| 460 | Ga0450899_000294 | |||
| 461 | Ga0450900_001285 | |||
| 462 | Ga0450906_001033 | |||
| 463 | Ga0466965_0150342 | |||
| 464 | Ga0466957_0113086 | |||
| 465 | Ga0466959_0157622 | |||
| 466 | Ga0466967_0050781 | |||
| 467 | Ga0466967_0091368 | |||
| 468 | Ga0495592_0070217 | |||
| 469 | Ga0495603_0000817 | |||
| 470 | Ga0495603_0001832 | |||
| 471 | Ga0495603_0005116 | |||
| 472 | Ga0495603_0005205 | |||
| 473 | Ga0495603_0054203 | |||
| 474 | Ga0495590_0029032 | |||
| 475 | Ga0495629_0000446 | |||
| 476 | Ga0495629_0001434 | |||
| 477 | Ga0495629_0043356 | |||
| 478 | Ga0495629_0089330 | |||
| 479 | Ga0495629_0218946 | |||
| 480 | Ga0495638_0005271 | |||
| 481 | Ga0495638_0071568 | |||
| 482 | Ga0495580_0088812 | |||
| 483 | Ga0495582_0086387 | |||
| 484 | Ga0495605_0026758 | |||
| 485 | Ga0495662_0007199 | |||
| 486 | Ga0495662_0033616 | |||
| 487 | Ga0495662_0230332 | |||
| 488 | Ga0495594_0001306 | |||
| 489 | Ga0495594_0005526 | |||
| 490 | Ga0495583_0062406 | |||
| 491 | Ga0495583_0091640 | |||
| 492 | Ga0495606_0224871 | |||
| 493 | Ga0495610_0036862 | |||
| 494 | Ga0495616_0076104 | |||
| 495 | Ga0495618_0203879 | |||
| 496 | Ga0495620_0030820 | |||
| 497 | Ga0495620_0059318 | |||
| 498 | Ga0495643_0006594 | |||
| 499 | Ga0495666_0010768 | |||
| 500 | Ga0495640_0005132 | |||
| 501 | Ga0495640_0097883 | |||
| 502 | Ga0495640_0137419 | |||
| 503 | Ga0495622_0001613 | |||
| 504 | Ga0495622_0029734 | |||
| 505 | Ga0495668_0007182 | |||
| 506 | Ga0495668_0098886 | |||
| 507 | Ga0495634_0111287 | |||
| 508 | Ga0495611_0051060 | |||
| 509 | Ga0495588_0010941 | |||
| 510 | Ga0495588_0052762 | |||
| 511 | Ga0495588_0062394 | |||
| 512 | Ga0495657_0007641 | |||
| 513 | Ga0495657_0028858 | |||
| 514 | Ga0495657_0078151 | |||
| 515 | Ga0495613_0010836 | |||
| 516 | Ga0495613_0026462 | |||
| 517 | Ga0495613_0079547 | |||
| 518 | Ga0495624_0057321 | |||
| 519 | Ga0495649_0066727 | |||
| 520 | Ga0495589_0047493 | |||
| 521 | Ga0495589_0051349 | |||
| 522 | Ga0495581_0022975 | |||
| 523 | Ga0495604_0009476 | |||
| 524 | Ga0495636_0005624 | |||
| 525 | Ga0495636_0081814 | |||
| 526 | Ga0495676_0030585 | |||
| 527 | Ga0495676_0043320 | |||
| 528 | Ga0495676_0089210 | |||
| 529 | Ga0495676_0099096 | |||
| 530 | Ga0495680_0015374 | |||
| 531 | Ga0495687_002292 | |||
| 532 | Ga0495687_066152 | |||
| 533 | Ga0495687_068683 | |||
| 534 | Ga0495677_0101013 | |||
| 535 | Ga0495685_084569 | |||
| 536 | Ga0495681_0029728 | |||
| 537 | Ga0495686_0075699 | |||
| 538 | Ga0495593_0076940 | |||
| 539 | Ga0495593_0173528 | |||
| 540 | Ga0495614_0000816 | |||
| 541 | Ga0495614_0111525 | |||
| 542 | Ga0496100_0193079 | |||
| 543 | Ga0496101_0242616 | |||
| 544 | Ga0496102_0021427 | |||
| 545 | Ga0496103_0021082 | |||
| 546 | Ga0496106_0026984 | |||
| 547 | Ga0496106_0114116 | |||
| 548 | Ga0496106_0121826 | |||
| 549 | Ga0496107_0093893 | |||
| 550 | Ga0496108_0000399 | |||
| 551 | Ga0496108_0001073 | |||
| 552 | Ga0496109_0001427 | |||
| 553 | Ga0496109_0064801 | |||
| 554 | Ga0496110_0083074 | |||
| 555 | Ga0496110_0166019 | |||
| 556 | Ga0496114_0079839 | |||
| 557 | Ga0496114_0088069 | |||
| 558 | Ga0496115_0158302 | |||
| 559 | Ga0495678_045179 | |||
| 560 | Ga0501033_0013157 | |||
| 561 | Ga0501036_0000951 | |||
| 562 | Ga0501038_0054774 | |||
| 563 | Ga0501070_0349566 | |||
| 564 | Ga0501044_0008984 | |||
| 565 | nmdc:mga05p37_153194_c1 | |||
| 566 | nmdc:mga05p37_23222_c1 | |||
| 567 | nmdc:mga05p37_485545_c1 | |||
| 568 | nmdc:mga09592_100106_c1 | |||
| 569 | nmdc:mga09592_213606_c1 | |||
| 570 | nmdc:mga09592_25459_c1 | |||
| 571 | nmdc:mga06r32_23949_c1 | |||
| 572 | nmdc:mga08y16_311230_c1 | |||
| 573 | nmdc:mga0a205_8490_c1 | |||
| 574 | Ga0500578_0262852 | |||
| 575 | Ga0500556_0080404 | |||
| 576 | 2585301960 | |||
| 577 | 2616698992 | |||
| 578 | 2643901725 | |||
| 579 | 2644387890 | |||
| 580 | 2644407871 | |||
| 581 | 2644438145 | |||
| 582 | 2644631863 | |||
| 583 | 2784591910 | |||
| 584 | 2785339807 | |||
| 585 | 2808845278 | |||
| 586 | 2808914976 | |||
| 587 | 2809235521 | |||
| 588 | 2811843255 | |||
| 589 | 2812354433 | |||
| 590 | 2812477410 | |||
| 591 | 2852636056 | |||
| 592 | 2862283097 | |||
| 593 | 2862384378 | |||
| 594 | 2863410213 | |||
| 595 | 2870789155 | |||
| 596 | 2875397879 | |||
| 597 | 2912716053 | |||
| 598 | 2912729003 | |||
| 599 | 2918507652 | |||
| 600 | 2919470931 | |||
| 601 | 2946046612 | |||
| 602 | 2946071270 | |||
| 603 | 2947225475 | |||
| 604 | 2954009689 | |||
| 605 | 2990063427 | |||
| 606 | 3006494768 | |||
| 607 | 8008564208 | |||
| 608 | 8023631437 | |||
| 609 | 8048409665 | |||
| 610 | 8056452821 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a3x-assembly1.cif.gz_B | imine reductase from ensifer adhaerens in complex with nadp+ | 0.9691 | 8 | 37 |
| 2y0d-assembly1.cif.gz_D | bcec mutation y10k | 0.9593 | 8 | 38 |
| 4e21-assembly1.cif.gz_A-2 | the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens | 0.9578 | 8 | 38 |
| 8bj5-assembly2.cif.gz_C | imine reductase ir007 from amycolatopsis azurea | 0.9522 | 8 | 37 |
| 6fqz-assembly1.cif.gz_B | plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate | 0.9521 | 8 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sezB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9845 | 7 | 38 | 3.50.50.60 |
| af_I6XF25_1_136_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9772 | 8 | 38 | 3.40.50.720 |
| 2ivdA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9768 | 8 | 38 | 3.50.50.60 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9661 | 8 | 37 | 3.40.50.720 |
| 3rp8A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9656 | 8 | 36 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2B226-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9843 | 1 | 301 |
GO:0003884
GO:0005737 GO:0016020 GO:0019478 GO:0071949 |
| AF-A0A7K2PCF3-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9799 | 5 | 238 |
GO:0003884
GO:0005737 GO:0016020 GO:0019478 GO:0071949 |
| AF-A0A1C4IP05-F1-model_v4 | deleted | 0.9722 | 48 | 313 |
|
| AF-A0A7W7PFM5-F1-model_v4 | D-amino-acid oxidase (EC 1.4.3.3) | 0.9676 | 5 | 314 |
GO:0003884
GO:0005737 GO:0019478 GO:0071949 |
| AF-A0A2C9LWM2-F1-model_v4 | FAD dependent oxidoreductase domain-containing protein | 0.9674 | 132 | 313 |
GO:0003884
GO:0005782 GO:0019478 GO:0071949 |