F397888

General Info

Members Datasets Scaffolds Average Seq Length
305 232 610 317

Family's Representative Sequence

Representative Sequence 3300002244|JGI24742J22300_10004342|JGI24742J22300_100043422
Length 384
Sequence MSGKFSSGLLAGLDGLAEVAIAVVAAAEHRATRAGEHQILMSLATISFRRQTAHLRPXVVRASGHDGRMRVTVLGAGVAGLTTASRLLAAGCQVRVVAAAPIEQSTSYLAAAVWFPTHVGPADRVADWGRQTYDVLAEQAARGIPGVVMRESLALYREPPREPEWADAVRGVRAATAAELPPGYGYGLRYAVPLVEMPRYLPWLAEQVGTNGAEVYTRRVHSLLELAEDGVDVIVNCSGLAARELVGDQSVYPVRGQIARVSNPGLSMSVRDEQHPEGRAYVHPRQNDCILGGTLDEHSWDTRVDLDTAASILRRCRDIAPALDEATVIDHVVGLRPGRPTVRLEEDARDETGPRILHNYGHGGAGITISWGCAEELTALVLRS

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
127 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
128 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
199 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
200 2643221578 Streptomyces sp. Root63 Isolate Unclassified
201 2643221670 Streptomyces sp. Root431 Isolate Unclassified
202 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
203 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
204 2643221714 Streptomyces sp. Root264 Isolate Unclassified
205 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
206 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
207 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
208 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
209 2808606448 Streptomyces sp. 193411 Isolate Unclassified
210 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
211 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
212 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
213 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
214 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
215 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
216 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
217 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
218 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
219 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
220 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
221 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
222 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
223 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
224 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
225 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
226 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
227 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
228 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
229 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
230 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
231 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
232 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.54
Metatranscriptomes 0.98
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0.66
Rhizoplane 5.57
Rhizosphere 81.97
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10004342 3300002244 Bacteria 2318
2 JGI24739J22299_10037026 3300001989 Bacteria 1645
3 JGI24735J21928_10031183 3300002067 Bacteria 1581
4 JGI24744J21845_10005077 3300002077 Bacteria 2722
5 JGI24744J21845_10011225 3300002077 Bacteria 1834
6 Ga0006562J51391_1091758 3300003578 Bacteria 3986
7 Ga0070683_100087907 3300005329 Bacteria 2915
8 Ga0070682_100001230 3300005337 Bacteria 14583
9 Ga0068868_100028018 3300005338 Bacteria 4302
10 Ga0070689_100056990 3300005340 Bacteria 3031
11 Ga0070668_100071303 3300005347 Bacteria 2706
12 Ga0070668_100322464 3300005347 Unclassified 1301
13 Ga0070669_100027302 3300005353 Bacteria 4107
14 Ga0070659_100041497 3300005366 Bacteria 3597
15 Ga0070711_100003024 3300005439 Bacteria 9722
16 Ga0070705_100142220 3300005440 Unclassified 1580
17 Ga0070700_100256330 3300005441 Unclassified 1257
18 Ga0070708_100044801 3300005445 Bacteria 3893
19 Ga0070663_100153103 3300005455 Bacteria 1769
20 Ga0070678_100020689 3300005456 Bacteria 4322
21 Ga0070662_100053711 3300005457 Bacteria 2917
22 Ga0068867_100013940 3300005459 Bacteria 5690
23 Ga0068853_100189800 3300005539 Bacteria 1866
24 Ga0070686_100413568 3300005544 Unclassified 1029
25 Ga0070695_100075245 3300005545 Bacteria 2221
26 Ga0070696_100018519 3300005546 Bacteria 4707
27 Ga0070693_100085161 3300005547 Bacteria 1893
28 Ga0070665_100159627 3300005548 Bacteria 2256
29 Ga0070665_100228746 3300005548 Bacteria 1859
30 Ga0070704_100008221 3300005549 Bacteria 6242
31 Ga0068854_100105488 3300005578 Bacteria 2118
32 Ga0068856_100419123 3300005614 Bacteria 1359
33 Ga0070702_100008053 3300005615 Bacteria 5086
34 Ga0068859_100167357 3300005617 Bacteria 2278
35 Ga0068866_10057654 3300005718 Bacteria 2002
36 Ga0068866_10096498 3300005718 Bacteria 1621
37 Ga0068861_100118749 3300005719 Unclassified 2130
38 Ga0068870_10088603 3300005840 Bacteria 1725
39 Ga0068858_100042583 3300005842 Bacteria 4209
40 Ga0068860_100006158 3300005843 Bacteria 12065
41 Ga0068860_100061435 3300005843 Bacteria 3570
42 Ga0068862_100035120 3300005844 Unclassified 4243
43 Ga0068862_100227239 3300005844 Bacteria 1692
44 Ga0068862_100242102 3300005844 Unclassified 1640
45 Ga0070712_100276390 3300006175 Bacteria 1351
46 Ga0097621_100157969 3300006237 Bacteria 1947
47 Ga0075433_10004583 3300006852 Bacteria 10782
48 Ga0075429_100003872 3300006880 Bacteria 12784
49 Ga0075429_100134440 3300006880 Bacteria 2164
50 Ga0068865_100027279 3300006881 Bacteria 3771
51 Ga0097620_100167356 3300006931 Bacteria 2278
52 Ga0111539_10116351 3300009094 Bacteria 3135
53 Ga0105245_10071118 3300009098 Bacteria 3159
54 Ga0105245_10123404 3300009098 Bacteria 2422
55 Ga0105247_10047697 3300009101 Bacteria 2631
56 Ga0114129_10005532 3300009147 Bacteria 17872
57 Ga0105243_10033181 3300009148 Bacteria 3991
58 Ga0105243_10281832 3300009148 Bacteria 1497
59 Ga0105241_10039580 3300009174 Bacteria 3557
60 Ga0105241_10059639 3300009174 Bacteria 2934
61 Ga0105242_10031474 3300009176 Unclassified 4238
62 Ga0105248_10173671 3300009177 Bacteria 2429
63 Ga0105238_10132717 3300009551 Bacteria 2469
64 Ga0105249_10089690 3300009553 Unclassified 2874
65 Ga0105249_10096239 3300009553 Bacteria 2777
66 Ga0105246_10010904 3300011119 Bacteria 5634
67 Ga0157369_10416527 3300013105 Bacteria 1393
68 Ga0157378_10106491 3300013297 Bacteria 2565
69 Ga0157372_10064307 3300013307 Bacteria 4116
70 Ga0157372_10092574 3300013307 Bacteria 3439
71 Ga0157375_10078904 3300013308 Bacteria 3327
72 Ga0163163_10295820 3300014325 Bacteria 1671
73 Ga0157380_10025386 3300014326 Bacteria 4494
74 Ga0157377_10029369 3300014745 Bacteria 2967
75 Ga0183367_1001 3300015688 Bacteria 1225545
76 Ga0163161_10230312 3300017792 Bacteria 1438
77 Ga0206351_10969111 3300020077 Eukaryota 1242
78 Ga0213875_10007964 3300021388 Bacteria 5449
79 Ga0213875_10008286 3300021388 Bacteria 5330
80 Ga0224712_10093427 3300022467 Eukaryota 1264
81 Ga0209758_1003466 3300025297 Bacteria 14304
82 Ga0207426_1025069 3300025302 Bacteria 2013
83 Ga0207642_10005893 3300025899 Bacteria 4035
84 Ga0207688_10003413 3300025901 Bacteria 8666
85 Ga0207680_10221576 3300025903 Unclassified 1297
86 Ga0207647_10022985 3300025904 Bacteria 4134
87 Ga0207643_10129102 3300025908 Bacteria 1502
88 Ga0207654_10095413 3300025911 Bacteria 1822
89 Ga0207693_10002832 3300025915 Bacteria 15022
90 Ga0207693_10022482 3300025915 Bacteria 5011
91 Ga0207663_10169566 3300025916 Bacteria 1549
92 Ga0207662_10154218 3300025918 Bacteria 1463
93 Ga0207687_10020552 3300025927 Bacteria 4381
94 Ga0207687_10024407 3300025927 Bacteria 4040
95 Ga0207690_10028811 3300025932 Bacteria 3523
96 Ga0207690_10089383 3300025932 Bacteria 2172
97 Ga0207706_10130281 3300025933 Unclassified 2212
98 Ga0207706_10198030 3300025933 Bacteria 1762
99 Ga0207686_10096382 3300025934 Bacteria 1965
100 Ga0207669_10028913 3300025937 Bacteria 3056
101 Ga0207669_10056681 3300025937 Bacteria 2381
102 Ga0207704_10112467 3300025938 Bacteria 1844
103 Ga0207689_10015194 3300025942 Bacteria 6520
104 Ga0207661_10046899 3300025944 Bacteria 3428
105 Ga0207668_10220865 3300025972 Bacteria 1521
106 Ga0207640_10407063 3300025981 Unclassified 1109
107 Ga0207708_10026381 3300026075 Bacteria 4396
108 Ga0207702_10092384 3300026078 Bacteria 2652
109 Ga0207641_10154538 3300026088 Bacteria 2081
110 Ga0207648_10027739 3300026089 Bacteria 5025
111 Ga0207676_10028523 3300026095 Bacteria 4171
112 Ga0207675_100024948 3300026118 Bacteria 5563
113 Ga0207683_10052346 3300026121 Bacteria 3577
114 Ga0268266_10210633 3300028379 Bacteria 1782
115 Ga0268265_10077001 3300028380 Unclassified 2618
116 Ga0268265_10519368 3300028380 Bacteria 1125
117 Ga0268264_10356316 3300028381 Bacteria 1394
118 Ga0307515_10196094 3300028794 Bacteria 1911
119 Ga0307511_10043966 3300030521 Bacteria 3720
120 Ga0307512_10003527 3300030522 Bacteria 18086
121 Ga0265340_10000392 3300031247 Bacteria 23411
122 Ga0307513_10020921 3300031456 Bacteria 7740
123 Ga0307408_100236620 3300031548 Bacteria 1499
124 Ga0307508_10003603 3300031616 Bacteria 15559
125 Ga0307508_10017684 3300031616 Bacteria 6482
126 Ga0307514_10229549 3300031649 Bacteria 1127
127 Ga0265314_10047005 3300031711 Bacteria 3041
128 Ga0307405_10042726 3300031731 Unclassified 2761
129 Ga0307405_10291150 3300031731 Bacteria 1234
130 Ga0307413_10179750 3300031824 Bacteria 1507
131 Ga0307413_10190453 3300031824 Bacteria 1472
132 Ga0307410_10081357 3300031852 Bacteria 2275
133 Ga0307406_10172664 3300031901 Bacteria 1566
134 Ga0307407_10112865 3300031903 Bacteria 1709
135 Ga0307407_10268139 3300031903 Unclassified 1177
136 Ga0307407_10286894 3300031903 Bacteria 1142
137 Ga0307412_10153009 3300031911 Bacteria 1705
138 Ga0307409_100006073 3300031995 Bacteria 7054
139 Ga0307409_100069937 3300031995 Bacteria 2784
140 Ga0307416_100091122 3300032002 Bacteria 2617
141 Ga0307415_100207077 3300032126 Bacteria 1561
142 Ga0373952_0035341 3300035092 Bacteria 1131
143 Ga0373939_0062056 3300035114 Unclassified 1193
144 Ga0373931_0168932 3300035691 Bacteria 1287
145 Ga0395900_0126729 3300037418 Bacteria 2619
146 Ga0395898_0018983 3300037466 Bacteria 7003
147 Ga0395898_0082887 3300037466 Bacteria 3091
148 Ga0436364_0667270 3300037853 Bacteria 158868
149 Ga0436364_0925981 3300037853 Bacteria 14259
150 Ga0439436_0000589 3300041404 Bacteria 9621
151 Ga0439436_0015598 3300041404 Bacteria 2284
152 Ga0451841_1361042 3300041498 Bacteria 1225
153 Ga0451853_0485433 3300041512 Bacteria 2638
154 Ga0439462_0031826 3300042015 Bacteria 1398
155 Ga0450899_000294 3300042135 Bacteria 5430
156 Ga0450900_001285 3300042136 Bacteria 2410
157 Ga0450906_001033 3300042145 Bacteria 6126
158 Ga0466965_0150342 3300044683 Unclassified 1217
159 Ga0466957_0113086 3300044842 Bacteria 1724
160 Ga0466959_0157622 3300045049 Bacteria 1597
161 Ga0466967_0050781 3300045976 Bacteria 3632
162 Ga0466967_0091368 3300045976 Bacteria 2767
163 Ga0495592_0070217 3300046454 Bacteria 2552
164 Ga0495603_0000817 3300046455 Bacteria 17867
165 Ga0495603_0001832 3300046455 Bacteria 12533
166 Ga0495603_0005116 3300046455 Bacteria 7834
167 Ga0495603_0005205 3300046455 Bacteria 7763
168 Ga0495603_0054203 3300046455 Bacteria 2377
169 Ga0495590_0029032 3300046457 Bacteria 1940
170 Ga0495629_0000446 3300046459 Bacteria 34452
171 Ga0495629_0001434 3300046459 Bacteria 18787
172 Ga0495629_0043356 3300046459 Bacteria 3159
173 Ga0495629_0089330 3300046459 Bacteria 2149
174 Ga0495629_0218946 3300046459 Bacteria 1313
175 Ga0495638_0005271 3300046460 Bacteria 9660
176 Ga0495638_0071568 3300046460 Bacteria 2121
177 Ga0495580_0088812 3300046472 Bacteria 2152
178 Ga0495582_0086387 3300046473 Bacteria 1746
179 Ga0495605_0026758 3300046474 Bacteria 2995
180 Ga0495662_0007199 3300046476 Bacteria 5511
181 Ga0495662_0033616 3300046476 Bacteria 2477
182 Ga0495662_0230332 3300046476 Bacteria 913
183 Ga0495594_0001306 3300046499 Bacteria 12982
184 Ga0495594_0005526 3300046499 Bacteria 6492
185 Ga0495583_0062406 3300046506 Bacteria 1659
186 Ga0495583_0091640 3300046506 Bacteria 1307
187 Ga0495606_0224871 3300046507 Bacteria 1055
188 Ga0495610_0036862 3300046512 Bacteria 2495
189 Ga0495616_0076104 3300046513 Bacteria 1613
190 Ga0495618_0203879 3300046514 Bacteria 1251
191 Ga0495620_0030820 3300046515 Bacteria 2464
192 Ga0495620_0059318 3300046515 Bacteria 1599
193 Ga0495643_0006594 3300046522 Bacteria 7629
194 Ga0495666_0010768 3300046526 Bacteria 4562
195 Ga0495640_0005132 3300046533 Bacteria 10410
196 Ga0495640_0097883 3300046533 Bacteria 1929
197 Ga0495640_0137419 3300046533 Bacteria 1577
198 Ga0495622_0001613 3300046557 Bacteria 11133
199 Ga0495622_0029734 3300046557 Bacteria 2552
200 Ga0495668_0007182 3300046616 Bacteria 7160
201 Ga0495668_0098886 3300046616 Bacteria 1596
202 Ga0495634_0111287 3300046642 Bacteria 1760
203 Ga0495611_0051060 3300046648 Bacteria 1863
204 Ga0495588_0010941 3300046674 Bacteria 4244
205 Ga0495588_0052762 3300046674 Bacteria 2096
206 Ga0495588_0062394 3300046674 Bacteria 1932
207 Ga0495657_0007641 3300046675 Bacteria 8326
208 Ga0495657_0028858 3300046675 Bacteria 3896
209 Ga0495657_0078151 3300046675 Bacteria 2145
210 Ga0495613_0010836 3300046689 Bacteria 6764
211 Ga0495613_0026462 3300046689 Bacteria 4320
212 Ga0495613_0079547 3300046689 Bacteria 2383
213 Ga0495624_0057321 3300046690 Bacteria 2449
214 Ga0495649_0066727 3300046694 Bacteria 1931
215 Ga0495589_0047493 3300046794 Bacteria 2127
216 Ga0495589_0051349 3300046794 Bacteria 2039
217 Ga0495581_0022975 3300047315 Bacteria 3612
218 Ga0495604_0009476 3300047317 Bacteria 7695
219 Ga0495636_0005624 3300047318 Bacteria 4916
220 Ga0495636_0081814 3300047318 Bacteria 1391
221 Ga0495676_0030585 3300047321 Bacteria 4565
222 Ga0495676_0043320 3300047321 Bacteria 3685
223 Ga0495676_0089210 3300047321 Bacteria 2310
224 Ga0495676_0099096 3300047321 Bacteria 2160
225 Ga0495680_0015374 3300047322 Bacteria 6604
226 Ga0495687_002292 3300047443 Bacteria 15648
227 Ga0495687_066152 3300047443 Bacteria 1468
228 Ga0495687_068683 3300047443 Bacteria 1429
229 Ga0495677_0101013 3300047445 Bacteria 1092
230 Ga0495685_084569 3300047447 Bacteria 1055
231 Ga0495681_0029728 3300047470 Bacteria 2793
232 Ga0495686_0075699 3300047472 Bacteria 2063
233 Ga0495593_0076940 3300047673 Bacteria 1729
234 Ga0495593_0173528 3300047673 Bacteria 1086
235 Ga0495614_0000816 3300048089 Bacteria 13163
236 Ga0495614_0111525 3300048089 Bacteria 1201
237 Ga0496100_0193079 3300048903 Bacteria 1479
238 Ga0496101_0242616 3300048904 Bacteria 1402
239 Ga0496102_0021427 3300048905 Bacteria 5716
240 Ga0496103_0021082 3300048906 Bacteria 3920
241 Ga0496106_0026984 3300048909 Bacteria 4276
242 Ga0496106_0114116 3300048909 Bacteria 2106
243 Ga0496106_0121826 3300048909 Unclassified 2039
244 Ga0496107_0093893 3300048910 Bacteria 2194
245 Ga0496108_0000399 3300048911 Bacteria 35847
246 Ga0496108_0001073 3300048911 Bacteria 21338
247 Ga0496109_0001427 3300048912 Bacteria 19839
248 Ga0496109_0064801 3300048912 Bacteria 3344
249 Ga0496110_0083074 3300048913 Bacteria 2857
250 Ga0496110_0166019 3300048913 Bacteria 2002
251 Ga0496114_0079839 3300048917 Unclassified 2762
252 Ga0496114_0088069 3300048917 Bacteria 2633
253 Ga0496115_0158302 3300048918 Bacteria 1871
254 Ga0495678_045179 3300049459 Bacteria 1739
255 Ga0501033_0013157 3300049570 Bacteria 6303
256 Ga0501036_0000951 3300049572 Bacteria 21789
257 Ga0501038_0054774 3300049574 Bacteria 3429
258 Ga0501070_0349566 3300049586 Bacteria 1200
259 Ga0501044_0008984 3300049823 Bacteria 10927
260 nmdc:mga05p37_153194_c1 3300050507 Unclassified 2818
261 nmdc:mga05p37_23222_c1 3300050507 Bacteria 7523
262 nmdc:mga05p37_485545_c1 3300050507 Bacteria 1422
263 nmdc:mga09592_100106_c1 3300050508 Bacteria 2482
264 nmdc:mga09592_213606_c1 3300050508 Bacteria 1671
265 nmdc:mga09592_25459_c1 3300050508 Bacteria 4898
266 nmdc:mga06r32_23949_c1 3300050510 Bacteria 5658
267 nmdc:mga08y16_311230_c1 3300050511 Bacteria 1622
268 nmdc:mga0a205_8490_c1 3300050515 Bacteria 9343
269 Ga0500578_0262852 3300053086 Bacteria 1036
270 Ga0500556_0080404 3300053104 Bacteria 1231
271 2585301960 2582581312 Bacteria 7308206
272 2616698992 2616644814 Bacteria 11555299
273 2643901725 2643221578 Bacteria 9213798
274 2644387890 2643221670 Bacteria 6497041
275 2644407871 2643221673 Bacteria 9196637
276 2644438145 2643221678 Bacteria 9540101
277 2644631863 2643221714 Bacteria 9015452
278 2784591910 2784132148 Bacteria 8627943
279 2785339807 2784746763 Bacteria 9783172
280 2808845278 2808606359 Bacteria 9866990
281 2808914976 2808606375 Bacteria 9466072
282 2809235521 2808606448 Bacteria 8656184
283 2811843255 2808606982 Bacteria 7791042
284 2812354433 2811994879 Bacteria 9313447
285 2812477410 2811994917 Bacteria 7761064
286 2852636056 2852635781 Bacteria 8251373
287 2862283097 2862281513 Bacteria 9621493
288 2862384378 2862382967 Bacteria 10317375
289 2863410213 2863404153 Bacteria 9672205
290 2870789155 2870782633 Bacteria 9624083
291 2875397879 2875391855 Bacteria 7600475
292 2912716053 2912715099 Bacteria 9460473
293 2912729003 2912723979 Bacteria 8557534
294 2918507652 2918501144 Bacteria 8668083
295 2919470931 2919468124 Bacteria 9133025
296 2946046612 2946045630 Bacteria 8527308
297 2946071270 2946064051 Bacteria 8957905
298 2947225475 2947224130 Bacteria 9938529
299 2954009689 2954002825 Bacteria 9173742
300 2990063427 2990059506 Bacteria 9321252
301 3006494768 3006493962 Bacteria 8825450
302 8008564208 8008558824 Bacteria 10610750
303 8023631437 8023623736 Bacteria 8593882
304 8048409665 8048406513 Bacteria 8936924
305 8056452821 8056447290 Bacteria 7680491
306 JGI24742J22300_10004342
307 JGI24739J22299_10037026
308 JGI24735J21928_10031183
309 JGI24744J21845_10005077
310 JGI24744J21845_10011225
311 Ga0006562J51391_1091758
312 Ga0070683_100087907
313 Ga0070682_100001230
314 Ga0068868_100028018
315 Ga0070689_100056990
316 Ga0070668_100071303
317 Ga0070668_100322464
318 Ga0070669_100027302
319 Ga0070659_100041497
320 Ga0070711_100003024
321 Ga0070705_100142220
322 Ga0070700_100256330
323 Ga0070708_100044801
324 Ga0070663_100153103
325 Ga0070678_100020689
326 Ga0070662_100053711
327 Ga0068867_100013940
328 Ga0068853_100189800
329 Ga0070686_100413568
330 Ga0070695_100075245
331 Ga0070696_100018519
332 Ga0070693_100085161
333 Ga0070665_100159627
334 Ga0070665_100228746
335 Ga0070704_100008221
336 Ga0068854_100105488
337 Ga0068856_100419123
338 Ga0070702_100008053
339 Ga0068859_100167357
340 Ga0068866_10057654
341 Ga0068866_10096498
342 Ga0068861_100118749
343 Ga0068870_10088603
344 Ga0068858_100042583
345 Ga0068860_100006158
346 Ga0068860_100061435
347 Ga0068862_100035120
348 Ga0068862_100227239
349 Ga0068862_100242102
350 Ga0070712_100276390
351 Ga0097621_100157969
352 Ga0075433_10004583
353 Ga0075429_100003872
354 Ga0075429_100134440
355 Ga0068865_100027279
356 Ga0097620_100167356
357 Ga0111539_10116351
358 Ga0105245_10071118
359 Ga0105245_10123404
360 Ga0105247_10047697
361 Ga0114129_10005532
362 Ga0105243_10033181
363 Ga0105243_10281832
364 Ga0105241_10039580
365 Ga0105241_10059639
366 Ga0105242_10031474
367 Ga0105248_10173671
368 Ga0105238_10132717
369 Ga0105249_10089690
370 Ga0105249_10096239
371 Ga0105246_10010904
372 Ga0157369_10416527
373 Ga0157378_10106491
374 Ga0157372_10064307
375 Ga0157372_10092574
376 Ga0157375_10078904
377 Ga0163163_10295820
378 Ga0157380_10025386
379 Ga0157377_10029369
380 Ga0183367_1001
381 Ga0163161_10230312
382 Ga0206351_10969111
383 Ga0213875_10007964
384 Ga0213875_10008286
385 Ga0224712_10093427
386 Ga0209758_1003466
387 Ga0207426_1025069
388 Ga0207642_10005893
389 Ga0207688_10003413
390 Ga0207680_10221576
391 Ga0207647_10022985
392 Ga0207643_10129102
393 Ga0207654_10095413
394 Ga0207693_10002832
395 Ga0207693_10022482
396 Ga0207663_10169566
397 Ga0207662_10154218
398 Ga0207687_10020552
399 Ga0207687_10024407
400 Ga0207690_10028811
401 Ga0207690_10089383
402 Ga0207706_10130281
403 Ga0207706_10198030
404 Ga0207686_10096382
405 Ga0207669_10028913
406 Ga0207669_10056681
407 Ga0207704_10112467
408 Ga0207689_10015194
409 Ga0207661_10046899
410 Ga0207668_10220865
411 Ga0207640_10407063
412 Ga0207708_10026381
413 Ga0207702_10092384
414 Ga0207641_10154538
415 Ga0207648_10027739
416 Ga0207676_10028523
417 Ga0207675_100024948
418 Ga0207683_10052346
419 Ga0268266_10210633
420 Ga0268265_10077001
421 Ga0268265_10519368
422 Ga0268264_10356316
423 Ga0307515_10196094
424 Ga0307511_10043966
425 Ga0307512_10003527
426 Ga0265340_10000392
427 Ga0307513_10020921
428 Ga0307408_100236620
429 Ga0307508_10003603
430 Ga0307508_10017684
431 Ga0307514_10229549
432 Ga0265314_10047005
433 Ga0307405_10042726
434 Ga0307405_10291150
435 Ga0307413_10179750
436 Ga0307413_10190453
437 Ga0307410_10081357
438 Ga0307406_10172664
439 Ga0307407_10112865
440 Ga0307407_10268139
441 Ga0307407_10286894
442 Ga0307412_10153009
443 Ga0307409_100006073
444 Ga0307409_100069937
445 Ga0307416_100091122
446 Ga0307415_100207077
447 Ga0373952_0035341
448 Ga0373939_0062056
449 Ga0373931_0168932
450 Ga0395900_0126729
451 Ga0395898_0018983
452 Ga0395898_0082887
453 Ga0436364_0667270
454 Ga0436364_0925981
455 Ga0439436_0000589
456 Ga0439436_0015598
457 Ga0451841_1361042
458 Ga0451853_0485433
459 Ga0439462_0031826
460 Ga0450899_000294
461 Ga0450900_001285
462 Ga0450906_001033
463 Ga0466965_0150342
464 Ga0466957_0113086
465 Ga0466959_0157622
466 Ga0466967_0050781
467 Ga0466967_0091368
468 Ga0495592_0070217
469 Ga0495603_0000817
470 Ga0495603_0001832
471 Ga0495603_0005116
472 Ga0495603_0005205
473 Ga0495603_0054203
474 Ga0495590_0029032
475 Ga0495629_0000446
476 Ga0495629_0001434
477 Ga0495629_0043356
478 Ga0495629_0089330
479 Ga0495629_0218946
480 Ga0495638_0005271
481 Ga0495638_0071568
482 Ga0495580_0088812
483 Ga0495582_0086387
484 Ga0495605_0026758
485 Ga0495662_0007199
486 Ga0495662_0033616
487 Ga0495662_0230332
488 Ga0495594_0001306
489 Ga0495594_0005526
490 Ga0495583_0062406
491 Ga0495583_0091640
492 Ga0495606_0224871
493 Ga0495610_0036862
494 Ga0495616_0076104
495 Ga0495618_0203879
496 Ga0495620_0030820
497 Ga0495620_0059318
498 Ga0495643_0006594
499 Ga0495666_0010768
500 Ga0495640_0005132
501 Ga0495640_0097883
502 Ga0495640_0137419
503 Ga0495622_0001613
504 Ga0495622_0029734
505 Ga0495668_0007182
506 Ga0495668_0098886
507 Ga0495634_0111287
508 Ga0495611_0051060
509 Ga0495588_0010941
510 Ga0495588_0052762
511 Ga0495588_0062394
512 Ga0495657_0007641
513 Ga0495657_0028858
514 Ga0495657_0078151
515 Ga0495613_0010836
516 Ga0495613_0026462
517 Ga0495613_0079547
518 Ga0495624_0057321
519 Ga0495649_0066727
520 Ga0495589_0047493
521 Ga0495589_0051349
522 Ga0495581_0022975
523 Ga0495604_0009476
524 Ga0495636_0005624
525 Ga0495636_0081814
526 Ga0495676_0030585
527 Ga0495676_0043320
528 Ga0495676_0089210
529 Ga0495676_0099096
530 Ga0495680_0015374
531 Ga0495687_002292
532 Ga0495687_066152
533 Ga0495687_068683
534 Ga0495677_0101013
535 Ga0495685_084569
536 Ga0495681_0029728
537 Ga0495686_0075699
538 Ga0495593_0076940
539 Ga0495593_0173528
540 Ga0495614_0000816
541 Ga0495614_0111525
542 Ga0496100_0193079
543 Ga0496101_0242616
544 Ga0496102_0021427
545 Ga0496103_0021082
546 Ga0496106_0026984
547 Ga0496106_0114116
548 Ga0496106_0121826
549 Ga0496107_0093893
550 Ga0496108_0000399
551 Ga0496108_0001073
552 Ga0496109_0001427
553 Ga0496109_0064801
554 Ga0496110_0083074
555 Ga0496110_0166019
556 Ga0496114_0079839
557 Ga0496114_0088069
558 Ga0496115_0158302
559 Ga0495678_045179
560 Ga0501033_0013157
561 Ga0501036_0000951
562 Ga0501038_0054774
563 Ga0501070_0349566
564 Ga0501044_0008984
565 nmdc:mga05p37_153194_c1
566 nmdc:mga05p37_23222_c1
567 nmdc:mga05p37_485545_c1
568 nmdc:mga09592_100106_c1
569 nmdc:mga09592_213606_c1
570 nmdc:mga09592_25459_c1
571 nmdc:mga06r32_23949_c1
572 nmdc:mga08y16_311230_c1
573 nmdc:mga0a205_8490_c1
574 Ga0500578_0262852
575 Ga0500556_0080404
576 2585301960
577 2616698992
578 2643901725
579 2644387890
580 2644407871
581 2644438145
582 2644631863
583 2784591910
584 2785339807
585 2808845278
586 2808914976
587 2809235521
588 2811843255
589 2812354433
590 2812477410
591 2852636056
592 2862283097
593 2862384378
594 2863410213
595 2870789155
596 2875397879
597 2912716053
598 2912729003
599 2918507652
600 2919470931
601 2946046612
602 2946071270
603 2947225475
604 2954009689
605 2990063427
606 3006494768
607 8008564208
608 8023631437
609 8048409665
610 8056452821

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

70

380

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.9691 8 37
2y0d-assembly1.cif.gz_D bcec mutation y10k 0.9593 8 38
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9578 8 38
8bj5-assembly2.cif.gz_C imine reductase ir007 from amycolatopsis azurea 0.9522 8 37
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9521 8 37
ID Description Score Start End Superfamily
1sezB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9845 7 38 3.50.50.60
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9772 8 38 3.40.50.720
2ivdA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9768 8 38 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 8 37 3.40.50.720
3rp8A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9656 8 36 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0K2B226-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9843 1 301 GO:0003884
GO:0005737
GO:0016020
GO:0019478
GO:0071949
AF-A0A7K2PCF3-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9799 5 238 GO:0003884
GO:0005737
GO:0016020
GO:0019478
GO:0071949
AF-A0A1C4IP05-F1-model_v4 deleted 0.9722 48 313
AF-A0A7W7PFM5-F1-model_v4 D-amino-acid oxidase (EC 1.4.3.3) 0.9676 5 314 GO:0003884
GO:0005737
GO:0019478
GO:0071949
AF-A0A2C9LWM2-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9674 132 313 GO:0003884
GO:0005782
GO:0019478
GO:0071949

Map