F397828

General Info

Members Datasets Scaffolds Average Seq Length
304 223 608 114

Family's Representative Sequence

Representative Sequence 3300059640|Ga0587067_125586|Ga0587067_125586_89_505
Length 138
Sequence VAGVSNPVVETYFYDWEGVNMLSLQIEFEQSRRALIVRLKGELDHHTADVVKARMEEAIAKEQTHHLILSLKDLSFMDSSGLGVILGRYKQITSKGGKMVVCDVSPAVYRLFELSGMFKIVSIQDNERNAMSSLEVAL

Samples

Sample ID Description Type Environment
1 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
32 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
33 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
41 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
50 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
51 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
52 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
53 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
54 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
55 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
56 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
57 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
58 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
59 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
60 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
61 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
62 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
65 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
66 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
67 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
68 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
69 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
70 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
71 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
72 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
85 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
86 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
87 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
88 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
89 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
92 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
93 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
97 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
98 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
99 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
100 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
101 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
102 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
103 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
104 2554235283 Bacillus safensis VK Isolate Rhizosphere
105 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
106 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
107 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
108 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
109 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
110 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
111 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
112 2643221729 Bacillus sp. Root11 Isolate Unclassified
113 2643221730 Bacillus sp. Root131 Isolate Unclassified
114 2643221735 Bacillus sp. Root920 Isolate Unclassified
115 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
116 2671180694 Paenibacillus sp. A3 Isolate Unclassified
117 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
118 2684622632 Bacillus cereus 905 Isolate Unclassified
119 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
120 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
121 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
122 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
123 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
124 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
125 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
126 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
127 2738541295 Bacillus sp. OK085 Isolate Unclassified
128 2738541358 Bacillus sp. OV752 Isolate Unclassified
129 2738543006 Bacillus sp. OK077 Isolate Unclassified
130 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
131 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
132 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
133 2811994870 Bacillus sp. JB4 Isolate Unclassified
134 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
135 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
136 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
137 2818991441 Niallia circulans 3243 Isolate Rhizosphere
138 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
139 2818991459 Paenibacillus sp. 597 Isolate Unclassified
140 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
141 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
142 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
143 2842682962 Bacillus sp. R-72492 Isolate Unclassified
144 2849139964 Bacillus sp. R-71875 Isolate Unclassified
145 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
146 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
147 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
148 2857581216 Bacillus sp. R-71922 Isolate Unclassified
149 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
150 2860837431 Bacillus sp. WR11 Isolate Unclassified
151 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
152 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
153 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
154 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
155 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
156 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
157 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
158 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
159 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
160 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
161 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
162 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
163 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
164 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
165 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
166 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
167 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
168 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
169 2919726948 Bacillus pumilus 4489 Isolate Unclassified
170 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
171 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
172 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
173 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
174 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
175 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
176 2938917290 Bacillus sp. CR71 Isolate Unclassified
177 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
178 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
179 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
180 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
181 2965761152 Bacillus sp. COPE52 Isolate Unclassified
182 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
183 2969141011 Bacillus velezensis MH25 Isolate Unclassified
184 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
185 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
186 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
187 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
188 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
189 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
190 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
191 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
192 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
193 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
194 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
195 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
196 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
197 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
198 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
199 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
200 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
201 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
202 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
203 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
204 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
205 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
206 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
207 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
208 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
209 8022653035 Bacillus sp. Rc4 Isolate Unclassified
210 8022792930 Bacillus sp. Xin Isolate Rhizosphere
211 8023438354 Bacillus sp. BH2 Isolate Unclassified
212 8023444577 Bacillus sp. BH32 Isolate Unclassified
213 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
214 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
215 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
216 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
217 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
218 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
219 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
220 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
221 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
222 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
223 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 47.04
Metatranscriptomes 10.86
Isolates 42.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.49
Nodule 0.66
Rhizoplane 2.63
Rhizosphere 53.62
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587067_125586 3300059640 Bacteria 621
2 JGI25159J45721_1002617 3300002987 Bacteria 6734
3 JGI25159J45721_1005967 3300002987 Bacteria 3733
4 JGI25151J46595_10000006 3300003187 Bacteria 419711
5 JGI25151J46595_10004117 3300003187 Bacteria 7778
6 JGI25151J46595_10008753 3300003187 Bacteria 4837
7 JGI25151J46595_10011944 3300003187 Bacteria 3968
8 JGI25151J46595_10033862 3300003187 Bacteria 1960
9 JGI25151J46595_10055985 3300003187 Bacteria 1296
10 JGI25151J46595_10057583 3300003187 Bacteria 1266
11 rootH1_10113990 3300003316 Bacteria 1356
12 Ga0006562J51391_1000791 3300003578 Bacteria 16865
13 Ga0055538_1000103 3300003751 Bacteria 67925
14 Ga0055532_1000853 3300003758 Bacteria 10334
15 Ga0055532_1006991 3300003758 Bacteria 1477
16 Ga0055535_1003428 3300003761 Bacteria 4512
17 Ga0055541_1001063 3300003841 Bacteria 6340
18 Ga0055541_1003151 3300003841 Bacteria 3153
19 Ga0070710_10468447 3300005437 Bacteria 857
20 Ga0075364_10508669 3300006051 Bacteria 823
21 Ga0105251_10062489 3300009011 Bacteria 1749
22 Ga0105244_10028068 3300009036 Bacteria 3024
23 Ga0105244_10048472 3300009036 Bacteria 2174
24 Ga0105244_10049385 3300009036 Bacteria 2150
25 Ga0105244_10259736 3300009036 Bacteria 808
26 Ga0105250_10019951 3300009092 Bacteria 2710
27 Ga0105250_10038069 3300009092 Bacteria 1929
28 Ga0105250_10038361 3300009092 Bacteria 1921
29 Ga0105250_10250306 3300009092 Bacteria 757
30 Ga0114129_11972447 3300009147 Bacteria 706
31 Ga0105249_11300683 3300009553 Bacteria 799
32 Ga0105246_10061147 3300011119 Bacteria 2619
33 Ga0105246_10067422 3300011119 Bacteria 2507
34 Ga0209784_100046 3300025224 Bacteria 200009
35 Ga0209566_100015 3300025225 Bacteria 457963
36 Ga0209566_100644 3300025225 Bacteria 21095
37 Ga0209147_100042 3300025229 Bacteria 301263
38 Ga0209147_102495 3300025229 Bacteria 4520
39 Ga0209258_101093 3300025242 Bacteria 11558
40 Ga0209130_1000765 3300025284 Bacteria 27838
41 Ga0209130_1001368 3300025284 Bacteria 16441
42 Ga0209130_1003823 3300025284 Bacteria 6099
43 Ga0209130_1009455 3300025284 Bacteria 2777
44 Ga0209675_1040435 3300025291 Bacteria 1025
45 Ga0209676_1025108 3300025292 Bacteria 1917
46 Ga0209025_1000001 3300025294 Bacteria 1888151
47 Ga0209025_1000158 3300025294 Bacteria 168481
48 Ga0209025_1000877 3300025294 Bacteria 47181
49 Ga0209025_1001168 3300025294 Bacteria 37169
50 Ga0209025_1006280 3300025294 Bacteria 9295
51 Ga0209025_1007252 3300025294 Bacteria 8334
52 Ga0209025_1013878 3300025294 Bacteria 5019
53 Ga0209025_1014609 3300025294 Bacteria 4809
54 Ga0209025_1014750 3300025294 Bacteria 4775
55 Ga0209025_1076425 3300025294 Bacteria 1160
56 Ga0209025_1078310 3300025294 Bacteria 1135
57 Ga0209025_1099301 3300025294 Bacteria 926
58 Ga0209025_1138966 3300025294 Bacteria 691
59 Ga0207696_1000826 3300025711 Bacteria 19836
60 Ga0207696_1017926 3300025711 Bacteria 2335
61 Ga0207655_1001474 3300025728 Bacteria 21724
62 Ga0207713_1019372 3300025735 Bacteria 3330
63 Ga0207685_10214329 3300025905 Bacteria 912
64 Ga0207681_10827967 3300025923 Bacteria 774
65 Ga0209371_1009215 3300027312 Bacteria 3158
66 Ga0237817_10049 3300030083 Bacteria 41028
67 Ga0237817_10102 3300030083 Bacteria 26789
68 Ga0268256_1008227 3300030500 Bacteria 3603
69 Ga0307408_100013111 3300031548 Bacteria 5502
70 Ga0307409_100001731 3300031995 Bacteria 11008
71 Ga0307409_100900650 3300031995 Bacteria 898
72 Ga0307416_100018359 3300032002 Bacteria 4925
73 Ga0307416_100933485 3300032002 Bacteria 969
74 Ga0307416_101208980 3300032002 Bacteria 861
75 Ga0395899_0016066 3300037312 Bacteria 5707
76 Ga0395899_0841770 3300037312 Unclassified 564
77 Ga0237819_00135 3300038705 Bacteria 27651
78 Ga0237819_00182 3300038705 Bacteria 23064
79 Ga0439449_0079560 3300042007 Bacteria 1208
80 Ga0439449_0358813 3300042007 Bacteria 552
81 Ga0439462_0049301 3300042015 Bacteria 1130
82 Ga0466969_0002261 3300044656 Bacteria 10289
83 Ga0466965_0344565 3300044683 Bacteria 815
84 Ga0466965_0437292 3300044683 Bacteria 727
85 Ga0466961_0607632 3300044693 Bacteria 657
86 Ga0466971_0495128 3300044719 Bacteria 603
87 Ga0466968_0009030 3300044735 Bacteria 3833
88 Ga0466957_0519465 3300044842 Bacteria 827
89 Ga0466959_0027132 3300045049 Bacteria 4248
90 Ga0466967_0004179 3300045976 Bacteria 9665
91 Ga0495603_0257044 3300046455 Bacteria 1005
92 Ga0495607_0173082 3300046501 Bacteria 1089
93 Ga0495637_0303523 3300046520 Bacteria 566
94 Ga0495597_0080976 3300046542 Bacteria 1389
95 Ga0495597_0237985 3300046542 Bacteria 719
96 Ga0495622_0026540 3300046557 Bacteria 2704
97 Ga0495622_0146546 3300046557 Bacteria 1070
98 Ga0495656_0786916 3300046615 Bacteria 514
99 Ga0495661_0231934 3300046665 Bacteria 951
100 Ga0495661_0356074 3300046665 Bacteria 720
101 Ga0495660_0157983 3300046810 Bacteria 1114
102 Ga0495681_0248593 3300047470 Bacteria 703
103 Ga0495626_0055728 3300048091 Bacteria 1811
104 Ga0496101_0508540 3300048904 Bacteria 952
105 Ga0496101_0535754 3300048904 Bacteria 926
106 Ga0496102_0302698 3300048905 Bacteria 1507
107 Ga0496106_0269309 3300048909 Bacteria 1364
108 Ga0496110_0408420 3300048913 Bacteria 1238
109 Ga0496110_0864039 3300048913 Bacteria 810
110 Ga0496112_0072211 3300048915 Bacteria 3411
111 Ga0496116_0010632 3300048919 Bacteria 7694
112 Ga0496116_0068185 3300048919 Bacteria 2267
113 Ga0496116_0069745 3300048919 Bacteria 2234
114 Ga0496116_0322020 3300048919 Bacteria 723
115 Ga0496116_0411499 3300048919 Bacteria 594
116 Ga0496118_0266887 3300048921 Bacteria 962
117 Ga0496119_0000122 3300048922 Bacteria 109048
118 Ga0496119_0154666 3300048922 Unclassified 1225
119 Ga0496119_0341943 3300048922 Bacteria 727
120 Ga0496120_0000045 3300048923 Bacteria 191663
121 Ga0496120_0216728 3300048923 Bacteria 917
122 Ga0496121_0302041 3300048924 Bacteria 1086
123 Ga0496121_0850827 3300048924 Bacteria 530
124 Ga0496122_0012160 3300048925 Bacteria 8607
125 Ga0496122_0017218 3300048925 Bacteria 6774
126 Ga0496122_0020740 3300048925 Bacteria 5917
127 Ga0496122_0035636 3300048925 Bacteria 4042
128 Ga0496123_0008494 3300048926 Bacteria 9419
129 Ga0496123_0039200 3300048926 Bacteria 3317
130 Ga0496124_0000805 3300048927 Bacteria 50918
131 Ga0496124_0002697 3300048927 Bacteria 22700
132 Ga0496125_0001374 3300048928 Bacteria 35737
133 Ga0496125_0519508 3300048928 Bacteria 666
134 Ga0496126_0015456 3300048929 Bacteria 7676
135 Ga0496126_0622722 3300048929 Bacteria 848
136 Ga0501343_003930 3300049132 Bacteria 1107
137 Ga0501305_005125 3300049161 Bacteria 1572
138 Ga0501305_005234 3300049161 Bacteria 1562
139 Ga0501305_024881 3300049161 Bacteria 905
140 Ga0501305_027987 3300049161 Bacteria 866
141 Ga0501311_007014 3300049527 Bacteria 1287
142 Ga0501312_005075 3300049528 Bacteria 1583
143 Ga0501312_005358 3300049528 Bacteria 1554
144 Ga0501312_013308 3300049528 Bacteria 1142
145 Ga0501312_015867 3300049528 Bacteria 1072
146 Ga0501312_027399 3300049528 Bacteria 878
147 Ga0501312_033154 3300049528 Bacteria 818
148 Ga0501312_044005 3300049528 Bacteria 737
149 Ga0501314_004477 3300049530 Bacteria 1160
150 Ga0501315_010326 3300049531 Bacteria 1120
151 Ga0501315_022243 3300049531 Bacteria 863
152 Ga0501316_003342 3300049532 Bacteria 1550
153 Ga0501316_008248 3300049532 Bacteria 1147
154 Ga0501323_009068 3300049539 Bacteria 1166
155 Ga0501323_018813 3300049539 Bacteria 896
156 Ga0501335_002115 3300049551 Bacteria 1588
157 Ga0501335_021704 3300049551 Bacteria 689
158 Ga0501335_024721 3300049551 Bacteria 656
159 Ga0501336_002865 3300049552 Bacteria 1135
160 Ga0501336_006563 3300049552 Bacteria 866
161 Ga0501198_011697 3300049649 Bacteria 1312
162 Ga0501216_103337 3300049660 Bacteria 631
163 Ga0501217_015553 3300049661 Bacteria 1734
164 Ga0501217_189819 3300049661 Bacteria 635
165 Ga0501227_013754 3300049665 Bacteria 1787
166 Ga0501234_033268 3300049707 Bacteria 836
167 Ga0501245_019082 3300049708 Bacteria 1059
168 Ga0501081_0541064 3300049743 Bacteria 870
169 Ga0501232_054526 3300049757 Bacteria 625
170 Ga0501279_004065 3300049775 Bacteria 1916
171 Ga0587083_0180210 3300059505 Bacteria 591
172 Ga0587067_004853 3300059640 Bacteria 1782
173 Ga0587067_052530 3300059640 Bacteria 829
174 Ga0587067_079720 3300059640 Bacteria 723
175 Ga0587068_011773 3300059641 Bacteria 1326
176 Ga0587072_013593 3300059643 Bacteria 1361
177 2511180014 2510917027 Bacteria 5287437
178 2511700115 2511231119 Bacteria 4019861
179 2512638964 2512564013 Bacteria 6286191
180 2512732464 2512564039 Bacteria 8739048
181 2540607280 2540341094 Bacteria 4061186
182 2545556800 2545555800 Bacteria 4222588
183 2550904438 2548877040 Bacteria 7507281
184 2553393587 2551306519 Bacteria 5465154
185 2555467520 2554235283 Bacteria 3683090
186 2571528180 2571042143 Bacteria 6986194
187 2578337807 2576861424 Bacteria 5270569
188 2578931050 2576861599 Bacteria 4217202
189 2587738647 2585428059 Bacteria 8696589
190 2595315620 2593339198 Bacteria 7267884
191 2601638864 2600255286 Bacteria 5390125
192 2644426840 2643221676 Bacteria 8119172
193 2644705025 2643221729 Bacteria 6621700
194 2644709718 2643221730 Bacteria 6523787
195 2644740693 2643221735 Bacteria 3676263
196 2651532007 2648501850 Bacteria 3975476
197 2673822210 2671180694 Bacteria 7506943
198 2674419219 2671180844 Bacteria 4164150
199 2685152047 2684622632 Bacteria 5380049
200 2686997345 2684623153 Bacteria 3878815
201 2687498652 2687453109 Bacteria 3860091
202 2695628093 2695420354 Bacteria 3922431
203 2698321117 2695420987 Bacteria 6152737
204 2705995992 2703719227 Bacteria 5631989
205 2717916197 2716884898 Bacteria 3928789
206 2721507210 2718218445 Bacteria 5113413
207 2728530951 2728368933 Bacteria 7044283
208 2738814339 2738541295 Bacteria 5730091
209 2739154750 2738541358 Bacteria 5932299
210 2739207878 2738543006 Bacteria 5904091
211 2745166949 2744054657 Bacteria 5016802
212 2793186287 2791355222 Bacteria 5898266
213 2809056040 2808606399 Bacteria 4021018
214 2812316538 2811994870 Bacteria 3776934
215 2816862723 2816332186 Bacteria 5331395
216 2817480591 2816332295 Bacteria 4352468
217 2817618151 2816332336 Bacteria 5207640
218 2819569644 2818991441 Bacteria 5062707
219 2819581268 2818991443 Bacteria 6598732
220 2819669295 2818991459 Bacteria 8736032
221 2819723606 2818991468 Bacteria 3723169
222 2823528520 2823526263 Bacteria 3765752
223 2831905742 2831905167 Bacteria 3319172
224 2842684355 2842682962 Bacteria 5589973
225 2849144322 2849139964 Bacteria 5613304
226 2857453734 2857453340 Bacteria 8090534
227 2857461242 2857460504 Bacteria 5194327
228 2857469971 2857465823 Bacteria 6772595
229 2857582457 2857581216 Bacteria 5522813
230 2857591689 2857591370 Bacteria 6569758
231 2860839967 2860837431 Bacteria 4202080
232 2864997880 2864997549 Bacteria 5139696
233 2865003626 2865002811 Bacteria 6333767
234 2877770998 2877768649 Bacteria 3957164
235 2880171863 2880169592 Bacteria 3900066
236 2881639076 2881636855 Bacteria 5205297
237 2888581106 2888578766 Bacteria 6743310
238 2889050217 2889049205 Bacteria 7524325
239 2889297252 2889295896 Bacteria 4704906
240 2897112088 2897109615 Bacteria 4009619
241 2898909891 2898907183 Bacteria 4067722
242 2904561953 2904560550 Bacteria 4029838
243 2904762006 2904755435 Bacteria 7986759
244 2908668275 2908665501 Bacteria 3678115
245 2915601024 2915597211 Bacteria 6475886
246 2915607274 2915606848 Bacteria 6032732
247 2919096044 2919093281 Bacteria 3660974
248 2919415303 2919414237 Bacteria 5429133
249 2919429859 2919425241 Bacteria 8055701
250 2919728238 2919726948 Bacteria 3696050
251 2925331655 2925326138 Bacteria 9652120
252 2929186167 2929183550 Bacteria 6377511
253 2929208644 2929206907 Bacteria 5918291
254 2929237744 2929233124 Bacteria 5948380
255 2936367250 2936361878 Bacteria 5632809
256 2938651711 2938649242 Bacteria 7118381
257 2938921936 2938917290 Bacteria 5914775
258 2947430830 2947426588 Bacteria 5357194
259 2954773963 2954773129 Bacteria 3741715
260 2956901869 2956897341 Bacteria 5447711
261 2964377067 2964375228 Bacteria 4909004
262 2965764984 2965761152 Bacteria 5806513
263 2968562623 2968558590 Bacteria 6956864
264 2969143445 2969141011 Bacteria 4118468
265 2969767216 2969765954 Bacteria 4216713
266 2971407928 2971403814 Bacteria 7370929
267 2971411030 2971410472 Bacteria 8311090
268 2971512408 2971511577 Bacteria 5404012
269 2971895644 2971893375 Bacteria 3929648
270 2979087729 2979083700 Bacteria 5894929
271 2980130439 2980125574 Bacteria 5567337
272 2980178058 2980176882 Bacteria 5397533
273 2980189792 2980182181 Bacteria 9454109
274 2981285731 2981284811 Bacteria 4641497
275 2981290678 2981289755 Bacteria 4641509
276 2981980700 2981980479 Bacteria 4641628
277 2981985578 2981985349 Bacteria 4641497
278 2988230521 2988225383 Bacteria 7221625
279 2990277616 2990275345 Bacteria 4887158
280 2996638064 2996632988 Bacteria 6921523
281 3001268248 3001267043 Bacteria 4823521
282 3001897931 3001892409 Bacteria 6328293
283 3006826837 3006826541 Bacteria 4678913
284 3006860942 3006858327 Bacteria 4317835
285 3006881474 3006879489 Bacteria 4064221
286 3006981626 3006978542 Bacteria 5328100
287 3006989084 3006988479 Bacteria 4767936
288 8022623963 8022621104 Bacteria 5241040
289 8022633698 8022630665 Bacteria 3886130
290 8022654132 8022653035 Bacteria 4035078
291 8022796666 8022792930 Bacteria 5693794
292 8023442899 8023438354 Bacteria 5779374
293 8023444936 8023444577 Bacteria 5661597
294 8051955415 8051952484 Bacteria 3926774
295 8052176871 8052174270 Bacteria 3881265
296 8054281391 8054280661 Bacteria 4232245
297 8054469692 8054465665 Bacteria 7323556
298 8054798284 8054795415 Bacteria 9785225
299 8055635687 8055632911 Bacteria 5283357
300 8056536428 8056533031 Bacteria 8964429
301 8057586514 8057582654 Bacteria 5218944
302 8057635251 8057632132 Bacteria 4726859
303 8057733508 8057733483 Bacteria 6578323
304 8057978961 8057977335 Bacteria 5694872
305 Ga0587067_125586
306 JGI25159J45721_1002617
307 JGI25159J45721_1005967
308 JGI25151J46595_10000006
309 JGI25151J46595_10004117
310 JGI25151J46595_10008753
311 JGI25151J46595_10011944
312 JGI25151J46595_10033862
313 JGI25151J46595_10055985
314 JGI25151J46595_10057583
315 rootH1_10113990
316 Ga0006562J51391_1000791
317 Ga0055538_1000103
318 Ga0055532_1000853
319 Ga0055532_1006991
320 Ga0055535_1003428
321 Ga0055541_1001063
322 Ga0055541_1003151
323 Ga0070710_10468447
324 Ga0075364_10508669
325 Ga0105251_10062489
326 Ga0105244_10028068
327 Ga0105244_10048472
328 Ga0105244_10049385
329 Ga0105244_10259736
330 Ga0105250_10019951
331 Ga0105250_10038069
332 Ga0105250_10038361
333 Ga0105250_10250306
334 Ga0114129_11972447
335 Ga0105249_11300683
336 Ga0105246_10061147
337 Ga0105246_10067422
338 Ga0209784_100046
339 Ga0209566_100015
340 Ga0209566_100644
341 Ga0209147_100042
342 Ga0209147_102495
343 Ga0209258_101093
344 Ga0209130_1000765
345 Ga0209130_1001368
346 Ga0209130_1003823
347 Ga0209130_1009455
348 Ga0209675_1040435
349 Ga0209676_1025108
350 Ga0209025_1000001
351 Ga0209025_1000158
352 Ga0209025_1000877
353 Ga0209025_1001168
354 Ga0209025_1006280
355 Ga0209025_1007252
356 Ga0209025_1013878
357 Ga0209025_1014609
358 Ga0209025_1014750
359 Ga0209025_1076425
360 Ga0209025_1078310
361 Ga0209025_1099301
362 Ga0209025_1138966
363 Ga0207696_1000826
364 Ga0207696_1017926
365 Ga0207655_1001474
366 Ga0207713_1019372
367 Ga0207685_10214329
368 Ga0207681_10827967
369 Ga0209371_1009215
370 Ga0237817_10049
371 Ga0237817_10102
372 Ga0268256_1008227
373 Ga0307408_100013111
374 Ga0307409_100001731
375 Ga0307409_100900650
376 Ga0307416_100018359
377 Ga0307416_100933485
378 Ga0307416_101208980
379 Ga0395899_0016066
380 Ga0395899_0841770
381 Ga0237819_00135
382 Ga0237819_00182
383 Ga0439449_0079560
384 Ga0439449_0358813
385 Ga0439462_0049301
386 Ga0466969_0002261
387 Ga0466965_0344565
388 Ga0466965_0437292
389 Ga0466961_0607632
390 Ga0466971_0495128
391 Ga0466968_0009030
392 Ga0466957_0519465
393 Ga0466959_0027132
394 Ga0466967_0004179
395 Ga0495603_0257044
396 Ga0495607_0173082
397 Ga0495637_0303523
398 Ga0495597_0080976
399 Ga0495597_0237985
400 Ga0495622_0026540
401 Ga0495622_0146546
402 Ga0495656_0786916
403 Ga0495661_0231934
404 Ga0495661_0356074
405 Ga0495660_0157983
406 Ga0495681_0248593
407 Ga0495626_0055728
408 Ga0496101_0508540
409 Ga0496101_0535754
410 Ga0496102_0302698
411 Ga0496106_0269309
412 Ga0496110_0408420
413 Ga0496110_0864039
414 Ga0496112_0072211
415 Ga0496116_0010632
416 Ga0496116_0068185
417 Ga0496116_0069745
418 Ga0496116_0322020
419 Ga0496116_0411499
420 Ga0496118_0266887
421 Ga0496119_0000122
422 Ga0496119_0154666
423 Ga0496119_0341943
424 Ga0496120_0000045
425 Ga0496120_0216728
426 Ga0496121_0302041
427 Ga0496121_0850827
428 Ga0496122_0012160
429 Ga0496122_0017218
430 Ga0496122_0020740
431 Ga0496122_0035636
432 Ga0496123_0008494
433 Ga0496123_0039200
434 Ga0496124_0000805
435 Ga0496124_0002697
436 Ga0496125_0001374
437 Ga0496125_0519508
438 Ga0496126_0015456
439 Ga0496126_0622722
440 Ga0501343_003930
441 Ga0501305_005125
442 Ga0501305_005234
443 Ga0501305_024881
444 Ga0501305_027987
445 Ga0501311_007014
446 Ga0501312_005075
447 Ga0501312_005358
448 Ga0501312_013308
449 Ga0501312_015867
450 Ga0501312_027399
451 Ga0501312_033154
452 Ga0501312_044005
453 Ga0501314_004477
454 Ga0501315_010326
455 Ga0501315_022243
456 Ga0501316_003342
457 Ga0501316_008248
458 Ga0501323_009068
459 Ga0501323_018813
460 Ga0501335_002115
461 Ga0501335_021704
462 Ga0501335_024721
463 Ga0501336_002865
464 Ga0501336_006563
465 Ga0501198_011697
466 Ga0501216_103337
467 Ga0501217_015553
468 Ga0501217_189819
469 Ga0501227_013754
470 Ga0501234_033268
471 Ga0501245_019082
472 Ga0501081_0541064
473 Ga0501232_054526
474 Ga0501279_004065
475 Ga0587083_0180210
476 Ga0587067_004853
477 Ga0587067_052530
478 Ga0587067_079720
479 Ga0587068_011773
480 Ga0587072_013593
481 2511180014
482 2511700115
483 2512638964
484 2512732464
485 2540607280
486 2545556800
487 2550904438
488 2553393587
489 2555467520
490 2571528180
491 2578337807
492 2578931050
493 2587738647
494 2595315620
495 2601638864
496 2644426840
497 2644705025
498 2644709718
499 2644740693
500 2651532007
501 2673822210
502 2674419219
503 2685152047
504 2686997345
505 2687498652
506 2695628093
507 2698321117
508 2705995992
509 2717916197
510 2721507210
511 2728530951
512 2738814339
513 2739154750
514 2739207878
515 2745166949
516 2793186287
517 2809056040
518 2812316538
519 2816862723
520 2817480591
521 2817618151
522 2819569644
523 2819581268
524 2819669295
525 2819723606
526 2823528520
527 2831905742
528 2842684355
529 2849144322
530 2857453734
531 2857461242
532 2857469971
533 2857582457
534 2857591689
535 2860839967
536 2864997880
537 2865003626
538 2877770998
539 2880171863
540 2881639076
541 2888581106
542 2889050217
543 2889297252
544 2897112088
545 2898909891
546 2904561953
547 2904762006
548 2908668275
549 2915601024
550 2915607274
551 2919096044
552 2919415303
553 2919429859
554 2919728238
555 2925331655
556 2929186167
557 2929208644
558 2929237744
559 2936367250
560 2938651711
561 2938921936
562 2947430830
563 2954773963
564 2956901869
565 2964377067
566 2965764984
567 2968562623
568 2969143445
569 2969767216
570 2971407928
571 2971411030
572 2971512408
573 2971895644
574 2979087729
575 2980130439
576 2980178058
577 2980189792
578 2981285731
579 2981290678
580 2981980700
581 2981985578
582 2988230521
583 2990277616
584 2996638064
585 3001268248
586 3001897931
587 3006826837
588 3006860942
589 3006881474
590 3006981626
591 3006989084
592 8022623963
593 8022633698
594 8022654132
595 8022796666
596 8023442899
597 8023444936
598 8051955415
599 8052176871
600 8054281391
601 8054469692
602 8054798284
603 8055635687
604 8056536428
605 8057586514
606 8057635251
607 8057733508
608 8057978961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

25

130

0.97

PF13466

STAS_2

STAS domain

37

117

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.9776 2 116
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9696 2 116
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9614 2 116
1til-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii 0.9612 2 116
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9406 5 114
ID Description Score Start End Superfamily
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9758 3 116 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9426 3 116 3.30.750.24
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9405 10 116 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9299 8 114 3.30.750.24
af_Q94LW6_488_626_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9134 8 116 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A6L5AUL5-F1-model_v4 deleted 0.9966 1 116
AF-A0A2N5M1P2-F1-model_v4 Anti-sigma F factor antagonist (Stage II sporulation protein) 0.9949 1 116 GO:0030435
GO:0043856
GO:0045152
AF-A0A1Q5P743-F1-model_v4 Anti-sigma F factor antagonist (Stage II sporulation protein) 0.9944 2 114 GO:0030435
GO:0043856
GO:0045152
AF-A0A133KJ02-F1-model_v4 Anti-sigma F factor antagonist (Stage II sporulation protein) 0.9917 1 116 GO:0030435
GO:0043856
GO:0045152
AF-A0A3D9I1Z8-F1-model_v4 Anti-sigma F factor antagonist (Stage II sporulation protein) 0.9891 2 115 GO:0030435
GO:0043856
GO:0045152

Map