F397802

General Info

Members Datasets Scaffolds Average Seq Length
304 212 304 512

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0009479|Ga0501076_0009479_2373_3890
Length 505
Sequence MTNSLLWTPLAFGLVGLFLPKRASGWWATLGALVTLALAXXXVFDFDSGSSGLQHTVDVTWIAGLGVDYSLGIDGLNVFLVLLTAVLWVGGVAFAAFRQQERPQLFFFLMLVAETATIGAFLAQDLLLFVLFFDFMLVPFYFLFGIWGSDRSGEGGLTAPAATLKMIVYTLIGSLLMLVAAIATAIIAADGGHLTFSIAELQRQGIGIDSQRWIFWFFAAAFLVKMPAFMLHGWMPDAYRAAPLPALIVFSGVLAKVGAYGFLRVVLPLFPDATVEFQEVILVIALASVLYGSVMAFTQTNVRLIAGYSSVAQLGFITLGIFALRADGSDGAVLQMVNHGLVVAPIFVIVALLLERTGTEDIREMGGLATRAPVLAALFLVVAMGTLAIPGSANFIGEFYILNGLFQAKIVYACIAISGVAMSAYYALRMYQATMHNRLPAQQRAGYASREIGLRDGIVLAPLVLCIVALAFYPQLILKRTNPTVQQTVAKVTRGDAPNARLAER

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 12.83
Rhizosphere 82.57
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000115 3300001977 Bacteria 9443
2 JGI24740J21852_10000401 3300001979 Bacteria 18644
3 JGI24748J21848_1000702 3300002074 Bacteria 3607
4 JGI24034J26672_10000088 3300002239 Bacteria 17296
5 JGI24742J22300_10001625 3300002244 Bacteria 3573
6 JGI25404J52841_10000194 3300003659 Bacteria 7181
7 Ga0070683_100034604 3300005329 Bacteria 4616
8 Ga0070690_100091322 3300005330 Bacteria 2006
9 Ga0070670_100106872 3300005331 Bacteria 2412
10 Ga0070677_10000107 3300005333 Bacteria 27160
11 Ga0070666_10002746 3300005335 Bacteria 10630
12 Ga0070666_10124985 3300005335 Bacteria 1785
13 Ga0070680_100026504 3300005336 Bacteria 4637
14 Ga0070682_100000103 3300005337 Bacteria 76169
15 Ga0068868_100000299 3300005338 Bacteria 33344
16 Ga0068868_100019223 3300005338 Bacteria 5118
17 Ga0070691_10000319 3300005341 Bacteria 17019
18 Ga0070691_10000675 3300005341 Bacteria 13287
19 Ga0070661_100000045 3300005344 Bacteria 94702
20 Ga0070668_100001863 3300005347 Bacteria 15406
21 Ga0070675_100000209 3300005354 Bacteria 37434
22 Ga0070674_100000011 3300005356 Bacteria 134886
23 Ga0070674_100000810 3300005356 Bacteria 16128
24 Ga0070673_100002476 3300005364 Bacteria 11272
25 Ga0070688_100000076 3300005365 Bacteria 49151
26 Ga0070659_100027318 3300005366 Bacteria 4397
27 Ga0070667_100001291 3300005367 Bacteria 22638
28 Ga0070667_100006640 3300005367 Bacteria 9617
29 Ga0070713_100000628 3300005436 Bacteria 22525
30 Ga0070711_100005854 3300005439 Bacteria 7378
31 Ga0070663_100001137 3300005455 Bacteria 14651
32 Ga0070662_100000109 3300005457 Bacteria 45782
33 Ga0070681_10044802 3300005458 Bacteria 4429
34 Ga0070685_10000062 3300005466 Bacteria 62782
35 Ga0070685_10000592 3300005466 Bacteria 20114
36 Ga0070679_100002387 3300005530 Bacteria 17026
37 Ga0070684_100014823 3300005535 Bacteria 6325
38 Ga0070684_100064355 3300005535 Bacteria 3217
39 Ga0070672_100000003 3300005543 Bacteria 159532
40 Ga0068854_100008518 3300005578 Bacteria 6599
41 Ga0068856_100065253 3300005614 Bacteria 3597
42 Ga0068856_100091481 3300005614 Bacteria 3026
43 Ga0068852_100000035 3300005616 Bacteria 99721
44 Ga0068864_100000159 3300005618 Bacteria 62636
45 Ga0068866_10000040 3300005718 Bacteria 49399
46 Ga0068866_10000475 3300005718 Bacteria 18415
47 Ga0068863_100000042 3300005841 Bacteria 154459
48 Ga0068863_100005232 3300005841 Bacteria 12801
49 Ga0068863_100069584 3300005841 Bacteria 3327
50 Ga0068858_100000244 3300005842 Bacteria 58744
51 Ga0068858_100000965 3300005842 Bacteria 29800
52 Ga0068860_100010843 3300005843 Bacteria 8994
53 Ga0068862_100019322 3300005844 Bacteria 5685
54 Ga0081455_10012902 3300005937 Bacteria 8291
55 Ga0081455_10052949 3300005937 Bacteria 3470
56 Ga0081538_10000407 3300005981 Bacteria 48780
57 Ga0081538_10009890 3300005981 Bacteria 7885
58 Ga0081540_1000490 3300005983 Bacteria 38898
59 Ga0081539_10004262 3300005985 Bacteria 16052
60 Ga0070715_10000036 3300006163 Bacteria 74811
61 Ga0075433_10000421 3300006852 Bacteria 27102
62 Ga0075433_10031153 3300006852 Bacteria 4557
63 Ga0068865_100000470 3300006881 Bacteria 22540
64 Ga0105245_10000291 3300009098 Bacteria 47913
65 Ga0105245_10000324 3300009098 Bacteria 44987
66 Ga0105245_10009522 3300009098 Bacteria 8471
67 Ga0105241_10039899 3300009174 Bacteria 3542
68 Ga0105242_10000415 3300009176 Bacteria 33960
69 Ga0105242_10004751 3300009176 Bacteria 10519
70 Ga0105242_10039738 3300009176 Bacteria 3788
71 Ga0105248_10003169 3300009177 Bacteria 18224
72 Ga0105238_10000051 3300009551 Bacteria 141705
73 Ga0105249_10000085 3300009553 Bacteria 133497
74 Ga0157370_10025887 3300013104 Bacteria 5800
75 Ga0157369_10000173 3300013105 Bacteria 90860
76 Ga0157374_10003397 3300013296 Bacteria 13386
77 Ga0157378_10030097 3300013297 Bacteria 4796
78 Ga0157375_10001056 3300013308 Bacteria 23764
79 Ga0157379_10066717 3300014968 Bacteria 3217
80 Ga0157376_10040694 3300014969 Bacteria 3799
81 Ga0163161_10000018 3300017792 Bacteria 228801
82 Ga0207656_10011412 3300025321 Bacteria 3357
83 Ga0207682_10000102 3300025893 Bacteria 38757
84 Ga0207642_10000001 3300025899 Bacteria 714030
85 Ga0207642_10000003 3300025899 Bacteria 650651
86 Ga0207642_10000086 3300025899 Bacteria 24454
87 Ga0207710_10000154 3300025900 Bacteria 73881
88 Ga0207710_10021478 3300025900 Bacteria 2767
89 Ga0207680_10067000 3300025903 Bacteria 2210
90 Ga0207685_10000001 3300025905 Bacteria 604473
91 Ga0207707_10049013 3300025912 Bacteria 3681
92 Ga0207693_10005251 3300025915 Bacteria 10836
93 Ga0207663_10005434 3300025916 Bacteria 6418
94 Ga0207660_10013518 3300025917 Bacteria 5350
95 Ga0207649_10000021 3300025920 Bacteria 209660
96 Ga0207652_10000444 3300025921 Bacteria 42675
97 Ga0207652_10002144 3300025921 Bacteria 16926
98 Ga0207694_10000035 3300025924 Bacteria 195870
99 Ga0207659_10000242 3300025926 Bacteria 33194
100 Ga0207687_10000027 3300025927 Bacteria 168505
101 Ga0207687_10000058 3300025927 Bacteria 85860
102 Ga0207687_10000713 3300025927 Bacteria 22529
103 Ga0207700_10000013 3300025928 Bacteria 230462
104 Ga0207706_10000413 3300025933 Bacteria 45740
105 Ga0207686_10000247 3300025934 Bacteria 41146
106 Ga0207686_10001699 3300025934 Bacteria 12260
107 Ga0207686_10040235 3300025934 Bacteria 2841
108 Ga0207709_10006427 3300025935 Bacteria 6596
109 Ga0207669_10000007 3300025937 Bacteria 169904
110 Ga0207669_10000099 3300025937 Bacteria 43726
111 Ga0207704_10000239 3300025938 Bacteria 27105
112 Ga0207691_10000005 3300025940 Bacteria 163117
113 Ga0207711_10000019 3300025941 Bacteria 412779
114 Ga0207661_10029523 3300025944 Bacteria 4213
115 Ga0207651_10001290 3300025960 Bacteria 11276
116 Ga0207712_10000033 3300025961 Bacteria 209336
117 Ga0207668_10072389 3300025972 Bacteria 2466
118 Ga0207640_10003204 3300025981 Bacteria 8813
119 Ga0207658_10001498 3300025986 Bacteria 18144
120 Ga0207658_10014661 3300025986 Bacteria 5369
121 Ga0207677_10004036 3300026023 Bacteria 7835
122 Ga0207677_10010765 3300026023 Bacteria 5186
123 Ga0207703_10000028 3300026035 Bacteria 208682
124 Ga0207703_10000411 3300026035 Bacteria 45579
125 Ga0207639_10011691 3300026041 Bacteria 6103
126 Ga0207678_10003342 3300026067 Bacteria 14467
127 Ga0207702_10000333 3300026078 Bacteria 54074
128 Ga0207702_10015114 3300026078 Bacteria 6400
129 Ga0207702_10041565 3300026078 Bacteria 3855
130 Ga0207641_10000066 3300026088 Bacteria 155638
131 Ga0207641_10029706 3300026088 Bacteria 4521
132 Ga0207641_10051174 3300026088 Bacteria 3498
133 Ga0207676_10000128 3300026095 Bacteria 66546
134 Ga0207683_10036161 3300026121 Bacteria 4298
135 Ga0207698_10000044 3300026142 Bacteria 94471
136 Ga0207698_10027891 3300026142 Bacteria 4017
137 Ga0268266_10000076 3300028379 Bacteria 217644
138 Ga0268266_10000424 3300028379 Bacteria 64091
139 Ga0268266_10001583 3300028379 Bacteria 26570
140 Ga0268265_10004041 3300028380 Bacteria 10326
141 Ga0268264_10002303 3300028381 Bacteria 16909
142 Ga0265337_1000044 3300028556 Bacteria 54694
143 Ga0265326_10000038 3300028558 Bacteria 88362
144 Ga0265319_1000102 3300028563 Bacteria 66477
145 Ga0265322_10000006 3300028654 Bacteria 231685
146 Ga0265336_10001989 3300028666 Bacteria 8726
147 Ga0265338_10000441 3300028800 Bacteria 74208
148 Ga0265324_10000171 3300029957 Bacteria 50487
149 Ga0265320_10000001 3300031240 Bacteria 847191
150 Ga0265325_10030327 3300031241 Bacteria 2900
151 Ga0265329_10004430 3300031242 Bacteria 5845
152 Ga0265331_10000624 3300031250 Bacteria 30780
153 Ga0265327_10000003 3300031251 Bacteria 852750
154 Ga0265316_10013013 3300031344 Bacteria 7424
155 Ga0265313_10038370 3300031595 Bacteria 2386
156 Ga0265314_10000103 3300031711 Bacteria 127956
157 Ga0373937_0040856 3300036401 Bacteria 4229
158 Ga0451853_3408443 3300041512 Bacteria 5446
159 Ga0466963_0000040 3300044694 Bacteria 41869
160 Ga0466957_0010082 3300044842 Bacteria 5407
161 Ga0495592_0000458 3300046454 Bacteria 30514
162 Ga0495603_0000167 3300046455 Bacteria 33276
163 Ga0495603_0000655 3300046455 Bacteria 19575
164 Ga0495603_0019700 3300046455 Bacteria 4085
165 Ga0495629_0000738 3300046459 Bacteria 26514
166 Ga0495641_0000001 3300046461 Bacteria 485224
167 Ga0495653_0081882 3300046463 Bacteria 2384
168 Ga0495582_0000007 3300046473 Bacteria 139882
169 Ga0495662_0000073 3300046476 Bacteria 35403
170 Ga0495662_0013315 3300046476 Bacteria 4002
171 Ga0495594_0000017 3300046499 Bacteria 88992
172 Ga0495606_0000131 3300046507 Bacteria 127298
173 Ga0495608_0001021 3300046511 Bacteria 19711
174 Ga0495608_0057300 3300046511 Bacteria 2572
175 Ga0495618_0000241 3300046514 Bacteria 39957
176 Ga0495620_0001188 3300046515 Bacteria 15939
177 Ga0495628_0014879 3300046516 Bacteria 6507
178 Ga0495628_0022079 3300046516 Bacteria 5231
179 Ga0495630_0000053 3300046517 Bacteria 93065
180 Ga0495630_0003260 3300046517 Bacteria 11314
181 Ga0495652_0000022 3300046529 Bacteria 178368
182 Ga0495652_0076028 3300046529 Bacteria 2787
183 Ga0495640_0014279 3300046533 Bacteria 6017
184 Ga0495640_0018708 3300046533 Bacteria 5128
185 Ga0495586_0002162 3300046535 Bacteria 10685
186 Ga0495587_0030442 3300046536 Bacteria 3273
187 Ga0495598_0005030 3300046537 Bacteria 2903
188 Ga0495645_0014181 3300046543 Bacteria 5650
189 Ga0495622_0000107 3300046557 Bacteria 72476
190 Ga0495667_0000044 3300046559 Bacteria 121910
191 Ga0495656_0000352 3300046615 Bacteria 15524
192 Ga0495634_0000013 3300046642 Bacteria 130546
193 Ga0495634_0000840 3300046642 Bacteria 29619
194 Ga0495634_0023759 3300046642 Bacteria 4306
195 Ga0495625_0000117 3300046660 Bacteria 121901
196 Ga0495635_0001966 3300046663 Bacteria 13977
197 Ga0495588_0000202 3300046674 Bacteria 59591
198 Ga0495647_0000003 3300046681 Bacteria 145235
199 Ga0495647_0004060 3300046681 Bacteria 4728
200 Ga0495658_0000007 3300046683 Bacteria 139822
201 Ga0495658_0003502 3300046683 Bacteria 7768
202 Ga0495669_0000065 3300046684 Bacteria 69983
203 Ga0495613_0000066 3300046689 Bacteria 102122
204 Ga0495613_0000122 3300046689 Bacteria 77044
205 Ga0495613_0156864 3300046689 Bacteria 1621
206 Ga0495624_0006180 3300046690 Bacteria 8515
207 Ga0495649_0001991 3300046694 Bacteria 14824
208 Ga0495600_0002102 3300046809 Bacteria 11260
209 Ga0495604_0000081 3300047317 Bacteria 82621
210 Ga0495604_0035008 3300047317 Bacteria 3967
211 Ga0495674_0000113 3300047319 Bacteria 60388
212 Ga0495676_0005348 3300047321 Bacteria 11757
213 Ga0495680_0000629 3300047322 Bacteria 39576
214 Ga0495680_0001777 3300047322 Bacteria 22849
215 Ga0495680_0006214 3300047322 Bacteria 11133
216 Ga0495593_0056934 3300047673 Bacteria 2054
217 Ga0495602_0000008 3300048088 Bacteria 260157
218 Ga0495602_0009086 3300048088 Bacteria 10348
219 Ga0496100_0000003 3300048903 Bacteria 360802
220 Ga0496100_0000046 3300048903 Bacteria 77660
221 Ga0496101_0000003 3300048904 Bacteria 406565
222 Ga0496101_0000124 3300048904 Bacteria 75495
223 Ga0496102_0000061 3300048905 Bacteria 167066
224 Ga0496103_0000044 3300048906 Bacteria 167066
225 Ga0496103_0066529 3300048906 Bacteria 2249
226 Ga0496104_0000007 3300048907 Bacteria 524804
227 Ga0496104_0000120 3300048907 Bacteria 72797
228 Ga0496104_0000491 3300048907 Bacteria 34073
229 Ga0496105_0000002 3300048908 Bacteria 753215
230 Ga0496105_0000020 3300048908 Bacteria 181484
231 Ga0496105_0000110 3300048908 Bacteria 56223
232 Ga0496105_0156363 3300048908 Bacteria 1872
233 Ga0496106_0000015 3300048909 Bacteria 187570
234 Ga0496106_0000059 3300048909 Bacteria 87781
235 Ga0496106_0000065 3300048909 Bacteria 84237
236 Ga0496107_0000018 3300048910 Bacteria 158433
237 Ga0496107_0000026 3300048910 Bacteria 108989
238 Ga0496108_0000025 3300048911 Bacteria 177919
239 Ga0496108_0000032 3300048911 Bacteria 158930
240 Ga0496108_0000163 3300048911 Bacteria 62902
241 Ga0496108_0003965 3300048911 Bacteria 11890
242 Ga0496109_0000155 3300048912 Bacteria 66634
243 Ga0496109_0000217 3300048912 Bacteria 56358
244 Ga0496109_0018444 3300048912 Bacteria 6129
245 Ga0496109_0133754 3300048912 Bacteria 2316
246 Ga0496110_0000003 3300048913 Bacteria 144124
247 Ga0496110_0024180 3300048913 Bacteria 5174
248 Ga0496111_0000058 3300048914 Bacteria 44867
249 Ga0496112_0000003 3300048915 Bacteria 660147
250 Ga0496112_0018107 3300048915 Bacteria 6628
251 Ga0496112_0164168 3300048915 Bacteria 2187
252 Ga0496113_0000207 3300048916 Bacteria 27349
253 Ga0496113_0004573 3300048916 Bacteria 8527
254 Ga0496113_0024590 3300048916 Bacteria 4283
255 Ga0496114_0000042 3300048917 Bacteria 133043
256 Ga0496115_0000005 3300048918 Bacteria 290756
257 Ga0496115_0003718 3300048918 Bacteria 10971
258 Ga0496116_0000814 3300048919 Bacteria 39470
259 Ga0496117_0004504 3300048920 Bacteria 15320
260 Ga0496118_0020448 3300048921 Bacteria 5869
261 Ga0496119_0013624 3300048922 Bacteria 6454
262 Ga0496119_0033454 3300048922 Bacteria 3406
263 Ga0496120_0007159 3300048923 Bacteria 8363
264 Ga0496121_0016519 3300048924 Bacteria 7614
265 Ga0496121_0046575 3300048924 Bacteria 3710
266 Ga0496125_0017662 3300048928 Bacteria 6792
267 Ga0496125_0103042 3300048928 Bacteria 2095
268 Ga0496126_0048028 3300048929 Bacteria 3905
269 Ga0501032_0010588 3300049569 Bacteria 6644
270 Ga0501033_0001259 3300049570 Bacteria 22655
271 Ga0501034_0047454 3300049571 Bacteria 4336
272 Ga0501036_0000290 3300049572 Bacteria 34813
273 Ga0501038_0001257 3300049574 Bacteria 23006
274 Ga0501043_0011637 3300049579 Bacteria 6885
275 Ga0501046_0001423 3300049580 Bacteria 23025
276 Ga0501047_0005727 3300049581 Bacteria 11695
277 Ga0501047_0059585 3300049581 Bacteria 3685
278 Ga0501048_0000843 3300049582 Bacteria 22584
279 Ga0501070_0014448 3300049586 Bacteria 6644
280 Ga0501073_0008515 3300049589 Bacteria 7608
281 Ga0501074_0072047 3300049590 Bacteria 2483
282 Ga0501075_0013457 3300049591 Bacteria 5838
283 Ga0501076_0009479 3300049592 Bacteria 7192
284 Ga0501083_0040180 3300049744 Bacteria 3175
285 Ga0501035_0000368 3300049822 Bacteria 51908
286 Ga0501044_0025351 3300049823 Bacteria 6284
287 nmdc:mga0a205_19_c2 3300050515 Bacteria 74147
288 Ga0495601_0000061 3300053077 Bacteria 60136
289 Ga0495601_0000090 3300053077 Bacteria 49013
290 Ga0495601_0008741 3300053077 Bacteria 5976
291 Ga0495601_0023865 3300053077 Bacteria 3761
292 Ga0495612_0000116 3300053078 Bacteria 33433
293 Ga0495612_0001063 3300053078 Bacteria 11240
294 Ga0495655_0000003 3300053083 Bacteria 303053
295 Ga0495655_0000816 3300053083 Bacteria 4898
296 Ga0495595_0000083 3300053084 Bacteria 45482
297 Ga0495619_0000015 3300053085 Bacteria 252787
298 Ga0495619_0000869 3300053085 Bacteria 19824
299 Ga0495619_0001450 3300053085 Bacteria 15618
300 Ga0495619_0002049 3300053085 Bacteria 13384
301 Ga0495619_0020518 3300053085 Bacteria 4210
302 Ga0500641_0006228 3300053096 Bacteria 4234
303 Ga0500628_000002 3300053129 Bacteria 357687
304 Ga0501082_0008494 3300060353 Bacteria 8854

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0008741 Ga0495601_0008741_19_1419 447
2 3300046689 Ga0495613_0156864 Ga0495613_0156864_175_1602 457
3 3300048928 Ga0496125_0017662 Ga0496125_0017662_3825_5234 460
4 3300005347 Ga0070668_100001863 Ga0070668_1000018633 461
5 3300005367 Ga0070667_100001291 Ga0070667_1000012912 461
6 3300005844 Ga0068862_100019322 Ga0068862_1000193226 461
7 3300025986 Ga0207658_10001498 Ga0207658_1000149817 461
8 3300028380 Ga0268265_10004041 Ga0268265_100040419 461
9 3300009176 Ga0105242_10000415 Ga0105242_1000041534 467
10 3300025934 Ga0207686_10001699 Ga0207686_100016994 467
11 3300005981 Ga0081538_10009890 Ga0081538_100098905 468
12 3300053078 Ga0495612_0001063 Ga0495612_0001063_1229_2731 468
13 3300048903 Ga0496100_0000046 Ga0496100_0000046_65333_66883 469
14 3300048904 Ga0496101_0000124 Ga0496101_0000124_10766_12316 469
15 3300048909 Ga0496106_0000059 Ga0496106_0000059_10718_12268 469
16 3300048910 Ga0496107_0000018 Ga0496107_0000018_63156_64706 469
17 3300005981 Ga0081538_10000407 Ga0081538_1000040726 470
18 3300005937 Ga0081455_10052949 Ga0081455_100529492 472
19 3300048907 Ga0496104_0000007 Ga0496104_0000007_135278_136816 472
20 3300048908 Ga0496105_0000002 Ga0496105_0000002_338217_339755 472
21 3300048922 Ga0496119_0013624 Ga0496119_0013624_3746_5284 472
22 3300048923 Ga0496120_0007159 Ga0496120_0007159_6633_8171 472
23 3300013297 Ga0157378_10030097 Ga0157378_100300972 474
24 3300009098 Ga0105245_10000291 Ga0105245_1000029125 475
25 3300025927 Ga0207687_10000058 Ga0207687_1000005846 475
26 3300047673 Ga0495593_0056934 Ga0495593_0056934_256_1833 480
27 3300048911 Ga0496108_0003965 Ga0496108_0003965_1358_2857 481
28 3300048916 Ga0496113_0024590 Ga0496113_0024590_1473_2972 481
29 3300005333 Ga0070677_10000107 Ga0070677_100001077 482
30 3300005337 Ga0070682_100000103 Ga0070682_10000010332 482
31 3300005578 Ga0068854_100008518 Ga0068854_1000085182 482
32 3300025893 Ga0207682_10000102 Ga0207682_100001027 482
33 3300025981 Ga0207640_10003204 Ga0207640_100032048 482
34 3300048903 Ga0496100_0000003 Ga0496100_0000003_81179_82675 482
35 3300048904 Ga0496101_0000003 Ga0496101_0000003_81179_82675 482
36 3300048909 Ga0496106_0000065 Ga0496106_0000065_26310_27806 482
37 3300048910 Ga0496107_0000026 Ga0496107_0000026_81179_82675 482
38 3300048911 Ga0496108_0000032 Ga0496108_0000032_47508_49034 483
39 3300048912 Ga0496109_0000217 Ga0496109_0000217_1135_2661 483
40 3300005985 Ga0081539_10004262 Ga0081539_100042622 484
41 3300005338 Ga0068868_100019223 Ga0068868_1000192232 485
42 3300005356 Ga0070674_100000810 Ga0070674_1000008106 485
43 3300005718 Ga0068866_10000475 Ga0068866_1000047516 485
44 3300009176 Ga0105242_10039738 Ga0105242_100397382 485
45 3300009553 Ga0105249_10000085 Ga0105249_10000085122 485
46 3300025899 Ga0207642_10000086 Ga0207642_1000008617 485
47 3300025937 Ga0207669_10000007 Ga0207669_10000007115 485
48 3300025961 Ga0207712_10000033 Ga0207712_10000033130 485
49 3300026023 Ga0207677_10010765 Ga0207677_100107655 485
50 3300046537 Ga0495598_0005030 Ga0495598_0005030_603_2093 485
51 3300049591 Ga0501075_0013457 Ga0501075_0013457_3179_4669 485
52 3300048907 Ga0496104_0000120 Ga0496104_0000120_24349_25947 486
53 3300048908 Ga0496105_0000020 Ga0496105_0000020_46851_48449 486
54 3300002074 JGI24748J21848_1000702 JGI24748J21848_10007022 487
55 3300002239 JGI24034J26672_10000088 JGI24034J26672_1000008810 487
56 3300002244 JGI24742J22300_10001625 JGI24742J22300_100016252 487
57 3300005329 Ga0070683_100034604 Ga0070683_1000346042 487
58 3300005439 Ga0070711_100005854 Ga0070711_1000058546 487
59 3300005457 Ga0070662_100000109 Ga0070662_10000010936 487
60 3300005535 Ga0070684_100014823 Ga0070684_1000148232 487
61 3300006852 Ga0075433_10000421 Ga0075433_1000042121 487
62 3300009551 Ga0105238_10000051 Ga0105238_1000005168 487
63 3300025916 Ga0207663_10005434 Ga0207663_100054346 487
64 3300025924 Ga0207694_10000035 Ga0207694_1000003569 487
65 3300025933 Ga0207706_10000413 Ga0207706_1000041313 487
66 3300025935 Ga0207709_10006427 Ga0207709_100064277 487
67 3300025944 Ga0207661_10029523 Ga0207661_100295232 487
68 3300048915 Ga0496112_0000003 Ga0496112_0000003_510959_512488 487
69 3300050515 nmdc:mga0a205_19_c2 nmdc:mga0a205_19_c2_9995_11491 487
70 3300046559 Ga0495667_0000044 Ga0495667_0000044_110109_111620 488
71 3300047322 Ga0495680_0006214 Ga0495680_0006214_4695_6206 488
72 3300005455 Ga0070663_100001137 Ga0070663_10000113711 489
73 3300005530 Ga0070679_100002387 Ga0070679_1000023873 489
74 3300005842 Ga0068858_100000965 Ga0068858_10000096524 489
75 3300025921 Ga0207652_10002144 Ga0207652_100021443 489
76 3300025934 Ga0207686_10040235 Ga0207686_100402352 489
77 3300026035 Ga0207703_10000028 Ga0207703_10000028201 489
78 3300026067 Ga0207678_10003342 Ga0207678_1000334210 489
79 3300046642 Ga0495634_0000013 Ga0495634_0000013_119282_120793 489
80 3300048909 Ga0496106_0000015 Ga0496106_0000015_179028_180527 489
81 3300048911 Ga0496108_0000163 Ga0496108_0000163_36689_38188 489
82 3300048912 Ga0496109_0000155 Ga0496109_0000155_2268_3767 489
83 3300053085 Ga0495619_0000015 Ga0495619_0000015_193208_194707 489
84 3300006852 Ga0075433_10031153 Ga0075433_100311532 490
85 3300013104 Ga0157370_10025887 Ga0157370_100258872 490
86 3300046663 Ga0495635_0001966 Ga0495635_0001966_1655_3295 490
87 3300005365 Ga0070688_100000076 Ga0070688_1000000767 491
88 3300005466 Ga0070685_10000062 Ga0070685_100000627 491
89 3300014969 Ga0157376_10040694 Ga0157376_100406943 491
90 3300046514 Ga0495618_0000241 Ga0495618_0000241_33653_35161 491
91 3300046533 Ga0495640_0018708 Ga0495640_0018708_1731_3239 491
92 3300049581 Ga0501047_0059585 Ga0501047_0059585_1177_2679 491
93 3300046473 Ga0495582_0000007 Ga0495582_0000007_66147_67634 492
94 3300046660 Ga0495625_0000117 Ga0495625_0000117_108160_109731 492
95 3300046681 Ga0495647_0000003 Ga0495647_0000003_2371_3930 492
96 3300046683 Ga0495658_0000007 Ga0495658_0000007_66141_67628 492
97 3300046684 Ga0495669_0000065 Ga0495669_0000065_50916_52511 492
98 3300048922 Ga0496119_0033454 Ga0496119_0033454_568_2094 492
99 3300048924 Ga0496121_0016519 Ga0496121_0016519_1602_3134 492
100 3300048924 Ga0496121_0046575 Ga0496121_0046575_839_2398 492
101 3300048928 Ga0496125_0103042 Ga0496125_0103042_85_1611 492
102 3300049569 Ga0501032_0010588 Ga0501032_0010588_3051_4553 492
103 3300049570 Ga0501033_0001259 Ga0501033_0001259_3109_4611 492
104 3300049571 Ga0501034_0047454 Ga0501034_0047454_1829_3331 492
105 3300049572 Ga0501036_0000290 Ga0501036_0000290_15294_16796 492
106 3300049574 Ga0501038_0001257 Ga0501038_0001257_3503_5005 492
107 3300049580 Ga0501046_0001423 Ga0501046_0001423_3520_5022 492
108 3300049581 Ga0501047_0005727 Ga0501047_0005727_3098_4600 492
109 3300049582 Ga0501048_0000843 Ga0501048_0000843_3096_4598 492
110 3300049586 Ga0501070_0014448 Ga0501070_0014448_1640_3142 492
111 3300049589 Ga0501073_0008515 Ga0501073_0008515_2387_3889 492
112 3300049744 Ga0501083_0040180 Ga0501083_0040180_834_2336 492
113 3300049822 Ga0501035_0000368 Ga0501035_0000368_24698_26200 492
114 3300049823 Ga0501044_0025351 Ga0501044_0025351_3143_4645 492
115 3300060353 Ga0501082_0008494 Ga0501082_0008494_5822_7324 492
116 3300013296 Ga0157374_10003397 Ga0157374_100033972 493
117 3300028556 Ga0265337_1000044 Ga0265337_100004427 493
118 3300028558 Ga0265326_10000038 Ga0265326_1000003819 493
119 3300028654 Ga0265322_10000006 Ga0265322_10000006151 493
120 3300028666 Ga0265336_10001989 Ga0265336_100019892 493
121 3300029957 Ga0265324_10000171 Ga0265324_1000017139 493
122 3300031240 Ga0265320_10000001 Ga0265320_10000001620 493
123 3300031242 Ga0265329_10004430 Ga0265329_100044302 493
124 3300031250 Ga0265331_10000624 Ga0265331_1000062411 493
125 3300031251 Ga0265327_10000003 Ga0265327_10000003620 493
126 3300031344 Ga0265316_10013013 Ga0265316_100130136 493
127 3300031595 Ga0265313_10038370 Ga0265313_100383702 493
128 3300031711 Ga0265314_10000103 Ga0265314_1000010379 493
129 3300046543 Ga0495645_0014181 Ga0495645_0014181_767_2314 493
130 3300046809 Ga0495600_0002102 Ga0495600_0002102_1733_3301 493
131 3300048906 Ga0496103_0066529 Ga0496103_0066529_208_1767 493
132 3300048920 Ga0496117_0004504 Ga0496117_0004504_11184_12743 493
133 3300048921 Ga0496118_0020448 Ga0496118_0020448_3007_4566 493
134 3300049590 Ga0501074_0072047 Ga0501074_0072047_339_1865 493
135 3300053085 Ga0495619_0002049 Ga0495619_0002049_1626_3143 493
136 3300005335 Ga0070666_10124985 Ga0070666_101249852 494
137 3300005367 Ga0070667_100006640 Ga0070667_1000066408 494
138 3300005841 Ga0068863_100000042 Ga0068863_100000042140 494
139 3300005841 Ga0068863_100005232 Ga0068863_10000523213 494
140 3300025903 Ga0207680_10067000 Ga0207680_100670002 494
141 3300025986 Ga0207658_10014661 Ga0207658_100146612 494
142 3300026088 Ga0207641_10000066 Ga0207641_1000006683 494
143 3300026088 Ga0207641_10029706 Ga0207641_100297063 494
144 3300028379 Ga0268266_10000424 Ga0268266_1000042418 494
145 3300046499 Ga0495594_0000017 Ga0495594_0000017_5456_6955 494
146 3300046511 Ga0495608_0057300 Ga0495608_0057300_523_2022 494
147 3300046516 Ga0495628_0022079 Ga0495628_0022079_3477_4976 494
148 3300046529 Ga0495652_0000022 Ga0495652_0000022_69862_71373 494
149 3300046557 Ga0495622_0000107 Ga0495622_0000107_5437_6936 494
150 3300046642 Ga0495634_0000840 Ga0495634_0000840_9445_11001 494
151 3300048088 Ga0495602_0009086 Ga0495602_0009086_6462_7961 494
152 3300048929 Ga0496126_0048028 Ga0496126_0048028_690_2210 494
153 3300049579 Ga0501043_0011637 Ga0501043_0011637_4133_5704 494
154 3300053096 Ga0500641_0006228 Ga0500641_0006228_2566_4065 494
155 3300005330 Ga0070690_100091322 Ga0070690_1000913222 495
156 3300005331 Ga0070670_100106872 Ga0070670_1001068722 495
157 3300005335 Ga0070666_10002746 Ga0070666_100027466 495
158 3300005466 Ga0070685_10000592 Ga0070685_100005927 495
159 3300009098 Ga0105245_10000324 Ga0105245_1000032433 495
160 3300009098 Ga0105245_10009522 Ga0105245_100095223 495
161 3300025927 Ga0207687_10000027 Ga0207687_10000027103 495
162 3300025927 Ga0207687_10000713 Ga0207687_1000071323 495
163 3300046455 Ga0495603_0000655 Ga0495603_0000655_6754_8316 495
164 3300046476 Ga0495662_0013315 Ga0495662_0013315_1509_3026 495
165 3300046683 Ga0495658_0003502 Ga0495658_0003502_5208_6752 495
166 3300049592 Ga0501076_0009479 Ga0501076_0009479_2373_3890 495
167 3300005354 Ga0070675_100000209 Ga0070675_10000020932 496
168 3300025900 Ga0207710_10021478 Ga0207710_100214782 496
169 3300025926 Ga0207659_10000242 Ga0207659_1000024215 496
170 3300025972 Ga0207668_10072389 Ga0207668_100723891 496
171 3300026121 Ga0207683_10036161 Ga0207683_100361612 496
172 3300028379 Ga0268266_10001583 Ga0268266_100015837 496
173 3300046674 Ga0495588_0000202 Ga0495588_0000202_16235_17794 496
174 3300046681 Ga0495647_0004060 Ga0495647_0004060_939_2486 496
175 3300053083 Ga0495655_0000816 Ga0495655_0000816_2768_4291 496
176 3300053084 Ga0495595_0000083 Ga0495595_0000083_1599_3179 496
177 3300005338 Ga0068868_100000299 Ga0068868_10000029928 497
178 3300005344 Ga0070661_100000045 Ga0070661_10000004583 497
179 3300005614 Ga0068856_100065253 Ga0068856_1000652532 497
180 3300013105 Ga0157369_10000173 Ga0157369_1000017377 497
181 3300025920 Ga0207649_10000021 Ga0207649_100000219 497
182 3300026023 Ga0207677_10004036 Ga0207677_100040367 497
183 3300026041 Ga0207639_10011691 Ga0207639_100116915 497
184 3300026078 Ga0207702_10041565 Ga0207702_100415652 497
185 3300026142 Ga0207698_10027891 Ga0207698_100278912 497
186 3300046455 Ga0495603_0019700 Ga0495603_0019700_2335_3969 497
187 3300003659 JGI25404J52841_10000194 JGI25404J52841_100001943 498
188 3300005341 Ga0070691_10000675 Ga0070691_100006755 498
189 3300005616 Ga0068852_100000035 Ga0068852_10000003584 498
190 3300005937 Ga0081455_10012902 Ga0081455_100129025 498
191 3300005983 Ga0081540_1000490 Ga0081540_10004908 498
192 3300006881 Ga0068865_100000470 Ga0068865_1000004704 498
193 3300009176 Ga0105242_10004751 Ga0105242_100047518 498
194 3300009177 Ga0105248_10003169 Ga0105248_100031697 498
195 3300017792 Ga0163161_10000018 Ga0163161_10000018199 498
196 3300025900 Ga0207710_10000154 Ga0207710_100001543 498
197 3300025934 Ga0207686_10000247 Ga0207686_100002478 498
198 3300025938 Ga0207704_10000239 Ga0207704_100002392 498
199 3300025941 Ga0207711_10000019 Ga0207711_10000019381 498
200 3300026142 Ga0207698_10000044 Ga0207698_1000004454 498
201 3300046507 Ga0495606_0000131 Ga0495606_0000131_99167_100741 498
202 3300046517 Ga0495630_0000053 Ga0495630_0000053_54944_56518 498
203 3300046517 Ga0495630_0003260 Ga0495630_0003260_5383_6939 498
204 3300046529 Ga0495652_0076028 Ga0495652_0076028_966_2510 498
205 3300046642 Ga0495634_0023759 Ga0495634_0023759_1085_2629 498
206 3300046690 Ga0495624_0006180 Ga0495624_0006180_2066_3643 498
207 3300048905 Ga0496102_0000061 Ga0496102_0000061_59961_61505 498
208 3300048906 Ga0496103_0000044 Ga0496103_0000044_59961_61505 498
209 3300048911 Ga0496108_0000025 Ga0496108_0000025_109457_111007 498
210 3300048912 Ga0496109_0018444 Ga0496109_0018444_1530_3080 498
211 3300048919 Ga0496116_0000814 Ga0496116_0000814_23435_24973 498
212 3300053077 Ga0495601_0000061 Ga0495601_0000061_56869_58431 498
213 3300053077 Ga0495601_0023865 Ga0495601_0023865_96_1640 498
214 3300053083 Ga0495655_0000003 Ga0495655_0000003_296401_297945 498
215 3300053129 Ga0500628_000002 Ga0500628_000002_296401_297945 498
216 3300005366 Ga0070659_100027318 Ga0070659_1000273182 499
217 3300005841 Ga0068863_100069584 Ga0068863_1000695842 499
218 3300014968 Ga0157379_10066717 Ga0157379_100667172 499
219 3300026088 Ga0207641_10051174 Ga0207641_100511742 499
220 3300046463 Ga0495653_0081882 Ga0495653_0081882_631_2208 499
221 3300046615 Ga0495656_0000352 Ga0495656_0000352_2230_3816 499
222 3300046689 Ga0495613_0000122 Ga0495613_0000122_25878_27449 499
223 3300047317 Ga0495604_0035008 Ga0495604_0035008_489_2060 499
224 3300048088 Ga0495602_0000008 Ga0495602_0000008_198482_200053 499
225 3300048907 Ga0496104_0000491 Ga0496104_0000491_15049_16599 499
226 3300048908 Ga0496105_0000110 Ga0496105_0000110_53113_54663 499
227 3300048912 Ga0496109_0133754 Ga0496109_0133754_104_1654 499
228 3300053078 Ga0495612_0000116 Ga0495612_0000116_10650_12239 499
229 3300001979 JGI24740J21852_10000401 JGI24740J21852_1000040116 500
230 3300005336 Ga0070680_100026504 Ga0070680_1000265043 500
231 3300005341 Ga0070691_10000319 Ga0070691_100003195 500
232 3300005436 Ga0070713_100000628 Ga0070713_10000062814 500
233 3300005535 Ga0070684_100064355 Ga0070684_1000643552 500
234 3300005543 Ga0070672_100000003 Ga0070672_10000000378 500
235 3300005614 Ga0068856_100091481 Ga0068856_1000914812 500
236 3300005618 Ga0068864_100000159 Ga0068864_10000015918 500
237 3300005842 Ga0068858_100000244 Ga0068858_10000024455 500
238 3300009174 Ga0105241_10039899 Ga0105241_100398993 500
239 3300013308 Ga0157375_10001056 Ga0157375_1000105616 500
240 3300025912 Ga0207707_10049013 Ga0207707_100490132 500
241 3300025915 Ga0207693_10005251 Ga0207693_100052517 500
242 3300025917 Ga0207660_10013518 Ga0207660_100135183 500
243 3300025921 Ga0207652_10000444 Ga0207652_1000044438 500
244 3300025928 Ga0207700_10000013 Ga0207700_10000013131 500
245 3300025940 Ga0207691_10000005 Ga0207691_1000000578 500
246 3300026035 Ga0207703_10000411 Ga0207703_100004118 500
247 3300026078 Ga0207702_10000333 Ga0207702_100003333 500
248 3300026078 Ga0207702_10015114 Ga0207702_100151142 500
249 3300026095 Ga0207676_10000128 Ga0207676_1000012848 500
250 3300028379 Ga0268266_10000076 Ga0268266_1000007684 500
251 3300041512 Ga0451853_3408443 Ga0451853_3408443_2892_4490 500
252 3300044694 Ga0466963_0000040 Ga0466963_0000040_17608_19212 500
253 3300046454 Ga0495592_0000458 Ga0495592_0000458_2363_3964 500
254 3300046461 Ga0495641_0000001 Ga0495641_0000001_289287_290888 500
255 3300046511 Ga0495608_0001021 Ga0495608_0001021_16274_17875 500
256 3300046515 Ga0495620_0001188 Ga0495620_0001188_11995_13608 500
257 3300046535 Ga0495586_0002162 Ga0495586_0002162_4927_6525 500
258 3300046689 Ga0495613_0000066 Ga0495613_0000066_38197_39798 500
259 3300046694 Ga0495649_0001991 Ga0495649_0001991_2314_3912 500
260 3300047321 Ga0495676_0005348 Ga0495676_0005348_9322_10923 500
261 3300047322 Ga0495680_0001777 Ga0495680_0001777_18876_20477 500
262 3300048908 Ga0496105_0156363 Ga0496105_0156363_120_1703 500
263 3300048913 Ga0496110_0000003 Ga0496110_0000003_70195_71751 500
264 3300048914 Ga0496111_0000058 Ga0496111_0000058_7804_9360 500
265 3300048915 Ga0496112_0018107 Ga0496112_0018107_2518_4095 500
266 3300048916 Ga0496113_0000207 Ga0496113_0000207_4024_5601 500
267 3300048918 Ga0496115_0000005 Ga0496115_0000005_239068_240666 500
268 3300053077 Ga0495601_0000090 Ga0495601_0000090_46215_47813 500
269 3300005458 Ga0070681_10044802 Ga0070681_100448022 501
270 3300028563 Ga0265319_1000102 Ga0265319_10001027 501
271 3300028800 Ga0265338_10000441 Ga0265338_100004418 501
272 3300031241 Ga0265325_10030327 Ga0265325_100303272 501
273 3300044842 Ga0466957_0010082 Ga0466957_0010082_3193_4761 501
274 3300046476 Ga0495662_0000073 Ga0495662_0000073_2375_4006 501
275 3300046516 Ga0495628_0014879 Ga0495628_0014879_1127_2776 501
276 3300048913 Ga0496110_0024180 Ga0496110_0024180_528_2123 501
277 3300048915 Ga0496112_0164168 Ga0496112_0164168_457_2001 501
278 3300048916 Ga0496113_0004573 Ga0496113_0004573_5914_7458 501
279 3300048917 Ga0496114_0000042 Ga0496114_0000042_72431_73996 501
280 3300053085 Ga0495619_0020518 Ga0495619_0020518_209_1804 501
281 3300005356 Ga0070674_100000011 Ga0070674_10000001197 502
282 3300005718 Ga0068866_10000040 Ga0068866_100000409 502
283 3300025899 Ga0207642_10000001 Ga0207642_10000001649 502
284 3300025899 Ga0207642_10000003 Ga0207642_10000003649 502
285 3300025937 Ga0207669_10000099 Ga0207669_1000009933 502
286 3300036401 Ga0373937_0040856 Ga0373937_0040856_842_2506 502
287 3300046459 Ga0495629_0000738 Ga0495629_0000738_1709_3274 502
288 3300046533 Ga0495640_0014279 Ga0495640_0014279_3250_4845 502
289 3300046536 Ga0495587_0030442 Ga0495587_0030442_94_1692 502
290 3300047319 Ga0495674_0000113 Ga0495674_0000113_41384_42979 502
291 3300048918 Ga0496115_0003718 Ga0496115_0003718_5989_7575 502
292 3300005364 Ga0070673_100002476 Ga0070673_1000024768 503
293 3300005843 Ga0068860_100010843 Ga0068860_1000108435 503
294 3300006163 Ga0070715_10000036 Ga0070715_1000003638 503
295 3300025321 Ga0207656_10011412 Ga0207656_100114122 503
296 3300025905 Ga0207685_10000001 Ga0207685_10000001221 503
297 3300025960 Ga0207651_10001290 Ga0207651_100012904 503
298 3300028381 Ga0268264_10002303 Ga0268264_100023037 503
299 3300046455 Ga0495603_0000167 Ga0495603_0000167_20993_22594 503
300 3300047322 Ga0495680_0000629 Ga0495680_0000629_29387_30955 503
301 3300053085 Ga0495619_0000869 Ga0495619_0000869_12879_14480 503
302 3300053085 Ga0495619_0001450 Ga0495619_0001450_10243_11868 503
303 3300047317 Ga0495604_0000081 Ga0495604_0000081_16010_17614 505
304 3300001977 JGI24746J21847_1000115 JGI24746J21847_10001158 509

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

123

423

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aqq-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.897 2 265
7aqq-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.884 2 265
7wg5-assembly1.cif.gz_F cyclic electron transport supercomplex ndh-psi from arabidopsis 0.8543 3 431
6i1p-assembly2.cif.gz_U respiratory complex i from thermus thermophilus with bound nadh 0.8515 1 464
6zjy-assembly1.cif.gz_M respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.8465 1 467
ID Description Score Start End Superfamily
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9305 2 120 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9232 3 121 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8835 2 120 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8489 2 120 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8082 3 121 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7W1UQ06-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9449 2 133 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A2V7J423-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter membrane subunit domain-containing protein 0.9391 2 291 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A528B264-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9387 2 302 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A4Q5QT70-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9384 2 246 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A379CYL0-F1-model_v4 deleted 0.9368 2 294

Feature Viewer

pLDDT pTM Quality
76.25 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map