F397802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 212 | 304 | 512 |
Family's Representative Sequence
| Representative Sequence | 3300049592|Ga0501076_0009479|Ga0501076_0009479_2373_3890 |
| Length | 505 |
| Sequence | MTNSLLWTPLAFGLVGLFLPKRASGWWATLGALVTLALAXXXVFDFDSGSSGLQHTVDVTWIAGLGVDYSLGIDGLNVFLVLLTAVLWVGGVAFAAFRQQERPQLFFFLMLVAETATIGAFLAQDLLLFVLFFDFMLVPFYFLFGIWGSDRSGEGGLTAPAATLKMIVYTLIGSLLMLVAAIATAIIAADGGHLTFSIAELQRQGIGIDSQRWIFWFFAAAFLVKMPAFMLHGWMPDAYRAAPLPALIVFSGVLAKVGAYGFLRVVLPLFPDATVEFQEVILVIALASVLYGSVMAFTQTNVRLIAGYSSVAQLGFITLGIFALRADGSDGAVLQMVNHGLVVAPIFVIVALLLERTGTEDIREMGGLATRAPVLAALFLVVAMGTLAIPGSANFIGEFYILNGLFQAKIVYACIAISGVAMSAYYALRMYQATMHNRLPAQQRAGYASREIGLRDGIVLAPLVLCIVALAFYPQLILKRTNPTVQQTVAKVTRGDAPNARLAER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 113 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 180 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 181 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 211 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 212 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 12.83 |
| Rhizosphere | 82.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000115 | 3300001977 | Bacteria | 9443 |
| 2 | JGI24740J21852_10000401 | 3300001979 | Bacteria | 18644 |
| 3 | JGI24748J21848_1000702 | 3300002074 | Bacteria | 3607 |
| 4 | JGI24034J26672_10000088 | 3300002239 | Bacteria | 17296 |
| 5 | JGI24742J22300_10001625 | 3300002244 | Bacteria | 3573 |
| 6 | JGI25404J52841_10000194 | 3300003659 | Bacteria | 7181 |
| 7 | Ga0070683_100034604 | 3300005329 | Bacteria | 4616 |
| 8 | Ga0070690_100091322 | 3300005330 | Bacteria | 2006 |
| 9 | Ga0070670_100106872 | 3300005331 | Bacteria | 2412 |
| 10 | Ga0070677_10000107 | 3300005333 | Bacteria | 27160 |
| 11 | Ga0070666_10002746 | 3300005335 | Bacteria | 10630 |
| 12 | Ga0070666_10124985 | 3300005335 | Bacteria | 1785 |
| 13 | Ga0070680_100026504 | 3300005336 | Bacteria | 4637 |
| 14 | Ga0070682_100000103 | 3300005337 | Bacteria | 76169 |
| 15 | Ga0068868_100000299 | 3300005338 | Bacteria | 33344 |
| 16 | Ga0068868_100019223 | 3300005338 | Bacteria | 5118 |
| 17 | Ga0070691_10000319 | 3300005341 | Bacteria | 17019 |
| 18 | Ga0070691_10000675 | 3300005341 | Bacteria | 13287 |
| 19 | Ga0070661_100000045 | 3300005344 | Bacteria | 94702 |
| 20 | Ga0070668_100001863 | 3300005347 | Bacteria | 15406 |
| 21 | Ga0070675_100000209 | 3300005354 | Bacteria | 37434 |
| 22 | Ga0070674_100000011 | 3300005356 | Bacteria | 134886 |
| 23 | Ga0070674_100000810 | 3300005356 | Bacteria | 16128 |
| 24 | Ga0070673_100002476 | 3300005364 | Bacteria | 11272 |
| 25 | Ga0070688_100000076 | 3300005365 | Bacteria | 49151 |
| 26 | Ga0070659_100027318 | 3300005366 | Bacteria | 4397 |
| 27 | Ga0070667_100001291 | 3300005367 | Bacteria | 22638 |
| 28 | Ga0070667_100006640 | 3300005367 | Bacteria | 9617 |
| 29 | Ga0070713_100000628 | 3300005436 | Bacteria | 22525 |
| 30 | Ga0070711_100005854 | 3300005439 | Bacteria | 7378 |
| 31 | Ga0070663_100001137 | 3300005455 | Bacteria | 14651 |
| 32 | Ga0070662_100000109 | 3300005457 | Bacteria | 45782 |
| 33 | Ga0070681_10044802 | 3300005458 | Bacteria | 4429 |
| 34 | Ga0070685_10000062 | 3300005466 | Bacteria | 62782 |
| 35 | Ga0070685_10000592 | 3300005466 | Bacteria | 20114 |
| 36 | Ga0070679_100002387 | 3300005530 | Bacteria | 17026 |
| 37 | Ga0070684_100014823 | 3300005535 | Bacteria | 6325 |
| 38 | Ga0070684_100064355 | 3300005535 | Bacteria | 3217 |
| 39 | Ga0070672_100000003 | 3300005543 | Bacteria | 159532 |
| 40 | Ga0068854_100008518 | 3300005578 | Bacteria | 6599 |
| 41 | Ga0068856_100065253 | 3300005614 | Bacteria | 3597 |
| 42 | Ga0068856_100091481 | 3300005614 | Bacteria | 3026 |
| 43 | Ga0068852_100000035 | 3300005616 | Bacteria | 99721 |
| 44 | Ga0068864_100000159 | 3300005618 | Bacteria | 62636 |
| 45 | Ga0068866_10000040 | 3300005718 | Bacteria | 49399 |
| 46 | Ga0068866_10000475 | 3300005718 | Bacteria | 18415 |
| 47 | Ga0068863_100000042 | 3300005841 | Bacteria | 154459 |
| 48 | Ga0068863_100005232 | 3300005841 | Bacteria | 12801 |
| 49 | Ga0068863_100069584 | 3300005841 | Bacteria | 3327 |
| 50 | Ga0068858_100000244 | 3300005842 | Bacteria | 58744 |
| 51 | Ga0068858_100000965 | 3300005842 | Bacteria | 29800 |
| 52 | Ga0068860_100010843 | 3300005843 | Bacteria | 8994 |
| 53 | Ga0068862_100019322 | 3300005844 | Bacteria | 5685 |
| 54 | Ga0081455_10012902 | 3300005937 | Bacteria | 8291 |
| 55 | Ga0081455_10052949 | 3300005937 | Bacteria | 3470 |
| 56 | Ga0081538_10000407 | 3300005981 | Bacteria | 48780 |
| 57 | Ga0081538_10009890 | 3300005981 | Bacteria | 7885 |
| 58 | Ga0081540_1000490 | 3300005983 | Bacteria | 38898 |
| 59 | Ga0081539_10004262 | 3300005985 | Bacteria | 16052 |
| 60 | Ga0070715_10000036 | 3300006163 | Bacteria | 74811 |
| 61 | Ga0075433_10000421 | 3300006852 | Bacteria | 27102 |
| 62 | Ga0075433_10031153 | 3300006852 | Bacteria | 4557 |
| 63 | Ga0068865_100000470 | 3300006881 | Bacteria | 22540 |
| 64 | Ga0105245_10000291 | 3300009098 | Bacteria | 47913 |
| 65 | Ga0105245_10000324 | 3300009098 | Bacteria | 44987 |
| 66 | Ga0105245_10009522 | 3300009098 | Bacteria | 8471 |
| 67 | Ga0105241_10039899 | 3300009174 | Bacteria | 3542 |
| 68 | Ga0105242_10000415 | 3300009176 | Bacteria | 33960 |
| 69 | Ga0105242_10004751 | 3300009176 | Bacteria | 10519 |
| 70 | Ga0105242_10039738 | 3300009176 | Bacteria | 3788 |
| 71 | Ga0105248_10003169 | 3300009177 | Bacteria | 18224 |
| 72 | Ga0105238_10000051 | 3300009551 | Bacteria | 141705 |
| 73 | Ga0105249_10000085 | 3300009553 | Bacteria | 133497 |
| 74 | Ga0157370_10025887 | 3300013104 | Bacteria | 5800 |
| 75 | Ga0157369_10000173 | 3300013105 | Bacteria | 90860 |
| 76 | Ga0157374_10003397 | 3300013296 | Bacteria | 13386 |
| 77 | Ga0157378_10030097 | 3300013297 | Bacteria | 4796 |
| 78 | Ga0157375_10001056 | 3300013308 | Bacteria | 23764 |
| 79 | Ga0157379_10066717 | 3300014968 | Bacteria | 3217 |
| 80 | Ga0157376_10040694 | 3300014969 | Bacteria | 3799 |
| 81 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 82 | Ga0207656_10011412 | 3300025321 | Bacteria | 3357 |
| 83 | Ga0207682_10000102 | 3300025893 | Bacteria | 38757 |
| 84 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 85 | Ga0207642_10000003 | 3300025899 | Bacteria | 650651 |
| 86 | Ga0207642_10000086 | 3300025899 | Bacteria | 24454 |
| 87 | Ga0207710_10000154 | 3300025900 | Bacteria | 73881 |
| 88 | Ga0207710_10021478 | 3300025900 | Bacteria | 2767 |
| 89 | Ga0207680_10067000 | 3300025903 | Bacteria | 2210 |
| 90 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 91 | Ga0207707_10049013 | 3300025912 | Bacteria | 3681 |
| 92 | Ga0207693_10005251 | 3300025915 | Bacteria | 10836 |
| 93 | Ga0207663_10005434 | 3300025916 | Bacteria | 6418 |
| 94 | Ga0207660_10013518 | 3300025917 | Bacteria | 5350 |
| 95 | Ga0207649_10000021 | 3300025920 | Bacteria | 209660 |
| 96 | Ga0207652_10000444 | 3300025921 | Bacteria | 42675 |
| 97 | Ga0207652_10002144 | 3300025921 | Bacteria | 16926 |
| 98 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 99 | Ga0207659_10000242 | 3300025926 | Bacteria | 33194 |
| 100 | Ga0207687_10000027 | 3300025927 | Bacteria | 168505 |
| 101 | Ga0207687_10000058 | 3300025927 | Bacteria | 85860 |
| 102 | Ga0207687_10000713 | 3300025927 | Bacteria | 22529 |
| 103 | Ga0207700_10000013 | 3300025928 | Bacteria | 230462 |
| 104 | Ga0207706_10000413 | 3300025933 | Bacteria | 45740 |
| 105 | Ga0207686_10000247 | 3300025934 | Bacteria | 41146 |
| 106 | Ga0207686_10001699 | 3300025934 | Bacteria | 12260 |
| 107 | Ga0207686_10040235 | 3300025934 | Bacteria | 2841 |
| 108 | Ga0207709_10006427 | 3300025935 | Bacteria | 6596 |
| 109 | Ga0207669_10000007 | 3300025937 | Bacteria | 169904 |
| 110 | Ga0207669_10000099 | 3300025937 | Bacteria | 43726 |
| 111 | Ga0207704_10000239 | 3300025938 | Bacteria | 27105 |
| 112 | Ga0207691_10000005 | 3300025940 | Bacteria | 163117 |
| 113 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 114 | Ga0207661_10029523 | 3300025944 | Bacteria | 4213 |
| 115 | Ga0207651_10001290 | 3300025960 | Bacteria | 11276 |
| 116 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 117 | Ga0207668_10072389 | 3300025972 | Bacteria | 2466 |
| 118 | Ga0207640_10003204 | 3300025981 | Bacteria | 8813 |
| 119 | Ga0207658_10001498 | 3300025986 | Bacteria | 18144 |
| 120 | Ga0207658_10014661 | 3300025986 | Bacteria | 5369 |
| 121 | Ga0207677_10004036 | 3300026023 | Bacteria | 7835 |
| 122 | Ga0207677_10010765 | 3300026023 | Bacteria | 5186 |
| 123 | Ga0207703_10000028 | 3300026035 | Bacteria | 208682 |
| 124 | Ga0207703_10000411 | 3300026035 | Bacteria | 45579 |
| 125 | Ga0207639_10011691 | 3300026041 | Bacteria | 6103 |
| 126 | Ga0207678_10003342 | 3300026067 | Bacteria | 14467 |
| 127 | Ga0207702_10000333 | 3300026078 | Bacteria | 54074 |
| 128 | Ga0207702_10015114 | 3300026078 | Bacteria | 6400 |
| 129 | Ga0207702_10041565 | 3300026078 | Bacteria | 3855 |
| 130 | Ga0207641_10000066 | 3300026088 | Bacteria | 155638 |
| 131 | Ga0207641_10029706 | 3300026088 | Bacteria | 4521 |
| 132 | Ga0207641_10051174 | 3300026088 | Bacteria | 3498 |
| 133 | Ga0207676_10000128 | 3300026095 | Bacteria | 66546 |
| 134 | Ga0207683_10036161 | 3300026121 | Bacteria | 4298 |
| 135 | Ga0207698_10000044 | 3300026142 | Bacteria | 94471 |
| 136 | Ga0207698_10027891 | 3300026142 | Bacteria | 4017 |
| 137 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 138 | Ga0268266_10000424 | 3300028379 | Bacteria | 64091 |
| 139 | Ga0268266_10001583 | 3300028379 | Bacteria | 26570 |
| 140 | Ga0268265_10004041 | 3300028380 | Bacteria | 10326 |
| 141 | Ga0268264_10002303 | 3300028381 | Bacteria | 16909 |
| 142 | Ga0265337_1000044 | 3300028556 | Bacteria | 54694 |
| 143 | Ga0265326_10000038 | 3300028558 | Bacteria | 88362 |
| 144 | Ga0265319_1000102 | 3300028563 | Bacteria | 66477 |
| 145 | Ga0265322_10000006 | 3300028654 | Bacteria | 231685 |
| 146 | Ga0265336_10001989 | 3300028666 | Bacteria | 8726 |
| 147 | Ga0265338_10000441 | 3300028800 | Bacteria | 74208 |
| 148 | Ga0265324_10000171 | 3300029957 | Bacteria | 50487 |
| 149 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 150 | Ga0265325_10030327 | 3300031241 | Bacteria | 2900 |
| 151 | Ga0265329_10004430 | 3300031242 | Bacteria | 5845 |
| 152 | Ga0265331_10000624 | 3300031250 | Bacteria | 30780 |
| 153 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 154 | Ga0265316_10013013 | 3300031344 | Bacteria | 7424 |
| 155 | Ga0265313_10038370 | 3300031595 | Bacteria | 2386 |
| 156 | Ga0265314_10000103 | 3300031711 | Bacteria | 127956 |
| 157 | Ga0373937_0040856 | 3300036401 | Bacteria | 4229 |
| 158 | Ga0451853_3408443 | 3300041512 | Bacteria | 5446 |
| 159 | Ga0466963_0000040 | 3300044694 | Bacteria | 41869 |
| 160 | Ga0466957_0010082 | 3300044842 | Bacteria | 5407 |
| 161 | Ga0495592_0000458 | 3300046454 | Bacteria | 30514 |
| 162 | Ga0495603_0000167 | 3300046455 | Bacteria | 33276 |
| 163 | Ga0495603_0000655 | 3300046455 | Bacteria | 19575 |
| 164 | Ga0495603_0019700 | 3300046455 | Bacteria | 4085 |
| 165 | Ga0495629_0000738 | 3300046459 | Bacteria | 26514 |
| 166 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 167 | Ga0495653_0081882 | 3300046463 | Bacteria | 2384 |
| 168 | Ga0495582_0000007 | 3300046473 | Bacteria | 139882 |
| 169 | Ga0495662_0000073 | 3300046476 | Bacteria | 35403 |
| 170 | Ga0495662_0013315 | 3300046476 | Bacteria | 4002 |
| 171 | Ga0495594_0000017 | 3300046499 | Bacteria | 88992 |
| 172 | Ga0495606_0000131 | 3300046507 | Bacteria | 127298 |
| 173 | Ga0495608_0001021 | 3300046511 | Bacteria | 19711 |
| 174 | Ga0495608_0057300 | 3300046511 | Bacteria | 2572 |
| 175 | Ga0495618_0000241 | 3300046514 | Bacteria | 39957 |
| 176 | Ga0495620_0001188 | 3300046515 | Bacteria | 15939 |
| 177 | Ga0495628_0014879 | 3300046516 | Bacteria | 6507 |
| 178 | Ga0495628_0022079 | 3300046516 | Bacteria | 5231 |
| 179 | Ga0495630_0000053 | 3300046517 | Bacteria | 93065 |
| 180 | Ga0495630_0003260 | 3300046517 | Bacteria | 11314 |
| 181 | Ga0495652_0000022 | 3300046529 | Bacteria | 178368 |
| 182 | Ga0495652_0076028 | 3300046529 | Bacteria | 2787 |
| 183 | Ga0495640_0014279 | 3300046533 | Bacteria | 6017 |
| 184 | Ga0495640_0018708 | 3300046533 | Bacteria | 5128 |
| 185 | Ga0495586_0002162 | 3300046535 | Bacteria | 10685 |
| 186 | Ga0495587_0030442 | 3300046536 | Bacteria | 3273 |
| 187 | Ga0495598_0005030 | 3300046537 | Bacteria | 2903 |
| 188 | Ga0495645_0014181 | 3300046543 | Bacteria | 5650 |
| 189 | Ga0495622_0000107 | 3300046557 | Bacteria | 72476 |
| 190 | Ga0495667_0000044 | 3300046559 | Bacteria | 121910 |
| 191 | Ga0495656_0000352 | 3300046615 | Bacteria | 15524 |
| 192 | Ga0495634_0000013 | 3300046642 | Bacteria | 130546 |
| 193 | Ga0495634_0000840 | 3300046642 | Bacteria | 29619 |
| 194 | Ga0495634_0023759 | 3300046642 | Bacteria | 4306 |
| 195 | Ga0495625_0000117 | 3300046660 | Bacteria | 121901 |
| 196 | Ga0495635_0001966 | 3300046663 | Bacteria | 13977 |
| 197 | Ga0495588_0000202 | 3300046674 | Bacteria | 59591 |
| 198 | Ga0495647_0000003 | 3300046681 | Bacteria | 145235 |
| 199 | Ga0495647_0004060 | 3300046681 | Bacteria | 4728 |
| 200 | Ga0495658_0000007 | 3300046683 | Bacteria | 139822 |
| 201 | Ga0495658_0003502 | 3300046683 | Bacteria | 7768 |
| 202 | Ga0495669_0000065 | 3300046684 | Bacteria | 69983 |
| 203 | Ga0495613_0000066 | 3300046689 | Bacteria | 102122 |
| 204 | Ga0495613_0000122 | 3300046689 | Bacteria | 77044 |
| 205 | Ga0495613_0156864 | 3300046689 | Bacteria | 1621 |
| 206 | Ga0495624_0006180 | 3300046690 | Bacteria | 8515 |
| 207 | Ga0495649_0001991 | 3300046694 | Bacteria | 14824 |
| 208 | Ga0495600_0002102 | 3300046809 | Bacteria | 11260 |
| 209 | Ga0495604_0000081 | 3300047317 | Bacteria | 82621 |
| 210 | Ga0495604_0035008 | 3300047317 | Bacteria | 3967 |
| 211 | Ga0495674_0000113 | 3300047319 | Bacteria | 60388 |
| 212 | Ga0495676_0005348 | 3300047321 | Bacteria | 11757 |
| 213 | Ga0495680_0000629 | 3300047322 | Bacteria | 39576 |
| 214 | Ga0495680_0001777 | 3300047322 | Bacteria | 22849 |
| 215 | Ga0495680_0006214 | 3300047322 | Bacteria | 11133 |
| 216 | Ga0495593_0056934 | 3300047673 | Bacteria | 2054 |
| 217 | Ga0495602_0000008 | 3300048088 | Bacteria | 260157 |
| 218 | Ga0495602_0009086 | 3300048088 | Bacteria | 10348 |
| 219 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 220 | Ga0496100_0000046 | 3300048903 | Bacteria | 77660 |
| 221 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 222 | Ga0496101_0000124 | 3300048904 | Bacteria | 75495 |
| 223 | Ga0496102_0000061 | 3300048905 | Bacteria | 167066 |
| 224 | Ga0496103_0000044 | 3300048906 | Bacteria | 167066 |
| 225 | Ga0496103_0066529 | 3300048906 | Bacteria | 2249 |
| 226 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 227 | Ga0496104_0000120 | 3300048907 | Bacteria | 72797 |
| 228 | Ga0496104_0000491 | 3300048907 | Bacteria | 34073 |
| 229 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 230 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 231 | Ga0496105_0000110 | 3300048908 | Bacteria | 56223 |
| 232 | Ga0496105_0156363 | 3300048908 | Bacteria | 1872 |
| 233 | Ga0496106_0000015 | 3300048909 | Bacteria | 187570 |
| 234 | Ga0496106_0000059 | 3300048909 | Bacteria | 87781 |
| 235 | Ga0496106_0000065 | 3300048909 | Bacteria | 84237 |
| 236 | Ga0496107_0000018 | 3300048910 | Bacteria | 158433 |
| 237 | Ga0496107_0000026 | 3300048910 | Bacteria | 108989 |
| 238 | Ga0496108_0000025 | 3300048911 | Bacteria | 177919 |
| 239 | Ga0496108_0000032 | 3300048911 | Bacteria | 158930 |
| 240 | Ga0496108_0000163 | 3300048911 | Bacteria | 62902 |
| 241 | Ga0496108_0003965 | 3300048911 | Bacteria | 11890 |
| 242 | Ga0496109_0000155 | 3300048912 | Bacteria | 66634 |
| 243 | Ga0496109_0000217 | 3300048912 | Bacteria | 56358 |
| 244 | Ga0496109_0018444 | 3300048912 | Bacteria | 6129 |
| 245 | Ga0496109_0133754 | 3300048912 | Bacteria | 2316 |
| 246 | Ga0496110_0000003 | 3300048913 | Bacteria | 144124 |
| 247 | Ga0496110_0024180 | 3300048913 | Bacteria | 5174 |
| 248 | Ga0496111_0000058 | 3300048914 | Bacteria | 44867 |
| 249 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 250 | Ga0496112_0018107 | 3300048915 | Bacteria | 6628 |
| 251 | Ga0496112_0164168 | 3300048915 | Bacteria | 2187 |
| 252 | Ga0496113_0000207 | 3300048916 | Bacteria | 27349 |
| 253 | Ga0496113_0004573 | 3300048916 | Bacteria | 8527 |
| 254 | Ga0496113_0024590 | 3300048916 | Bacteria | 4283 |
| 255 | Ga0496114_0000042 | 3300048917 | Bacteria | 133043 |
| 256 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 257 | Ga0496115_0003718 | 3300048918 | Bacteria | 10971 |
| 258 | Ga0496116_0000814 | 3300048919 | Bacteria | 39470 |
| 259 | Ga0496117_0004504 | 3300048920 | Bacteria | 15320 |
| 260 | Ga0496118_0020448 | 3300048921 | Bacteria | 5869 |
| 261 | Ga0496119_0013624 | 3300048922 | Bacteria | 6454 |
| 262 | Ga0496119_0033454 | 3300048922 | Bacteria | 3406 |
| 263 | Ga0496120_0007159 | 3300048923 | Bacteria | 8363 |
| 264 | Ga0496121_0016519 | 3300048924 | Bacteria | 7614 |
| 265 | Ga0496121_0046575 | 3300048924 | Bacteria | 3710 |
| 266 | Ga0496125_0017662 | 3300048928 | Bacteria | 6792 |
| 267 | Ga0496125_0103042 | 3300048928 | Bacteria | 2095 |
| 268 | Ga0496126_0048028 | 3300048929 | Bacteria | 3905 |
| 269 | Ga0501032_0010588 | 3300049569 | Bacteria | 6644 |
| 270 | Ga0501033_0001259 | 3300049570 | Bacteria | 22655 |
| 271 | Ga0501034_0047454 | 3300049571 | Bacteria | 4336 |
| 272 | Ga0501036_0000290 | 3300049572 | Bacteria | 34813 |
| 273 | Ga0501038_0001257 | 3300049574 | Bacteria | 23006 |
| 274 | Ga0501043_0011637 | 3300049579 | Bacteria | 6885 |
| 275 | Ga0501046_0001423 | 3300049580 | Bacteria | 23025 |
| 276 | Ga0501047_0005727 | 3300049581 | Bacteria | 11695 |
| 277 | Ga0501047_0059585 | 3300049581 | Bacteria | 3685 |
| 278 | Ga0501048_0000843 | 3300049582 | Bacteria | 22584 |
| 279 | Ga0501070_0014448 | 3300049586 | Bacteria | 6644 |
| 280 | Ga0501073_0008515 | 3300049589 | Bacteria | 7608 |
| 281 | Ga0501074_0072047 | 3300049590 | Bacteria | 2483 |
| 282 | Ga0501075_0013457 | 3300049591 | Bacteria | 5838 |
| 283 | Ga0501076_0009479 | 3300049592 | Bacteria | 7192 |
| 284 | Ga0501083_0040180 | 3300049744 | Bacteria | 3175 |
| 285 | Ga0501035_0000368 | 3300049822 | Bacteria | 51908 |
| 286 | Ga0501044_0025351 | 3300049823 | Bacteria | 6284 |
| 287 | nmdc:mga0a205_19_c2 | 3300050515 | Bacteria | 74147 |
| 288 | Ga0495601_0000061 | 3300053077 | Bacteria | 60136 |
| 289 | Ga0495601_0000090 | 3300053077 | Bacteria | 49013 |
| 290 | Ga0495601_0008741 | 3300053077 | Bacteria | 5976 |
| 291 | Ga0495601_0023865 | 3300053077 | Bacteria | 3761 |
| 292 | Ga0495612_0000116 | 3300053078 | Bacteria | 33433 |
| 293 | Ga0495612_0001063 | 3300053078 | Bacteria | 11240 |
| 294 | Ga0495655_0000003 | 3300053083 | Bacteria | 303053 |
| 295 | Ga0495655_0000816 | 3300053083 | Bacteria | 4898 |
| 296 | Ga0495595_0000083 | 3300053084 | Bacteria | 45482 |
| 297 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 298 | Ga0495619_0000869 | 3300053085 | Bacteria | 19824 |
| 299 | Ga0495619_0001450 | 3300053085 | Bacteria | 15618 |
| 300 | Ga0495619_0002049 | 3300053085 | Bacteria | 13384 |
| 301 | Ga0495619_0020518 | 3300053085 | Bacteria | 4210 |
| 302 | Ga0500641_0006228 | 3300053096 | Bacteria | 4234 |
| 303 | Ga0500628_000002 | 3300053129 | Bacteria | 357687 |
| 304 | Ga0501082_0008494 | 3300060353 | Bacteria | 8854 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053077 | Ga0495601_0008741 | Ga0495601_0008741_19_1419 | 447 |
| 2 | 3300046689 | Ga0495613_0156864 | Ga0495613_0156864_175_1602 | 457 |
| 3 | 3300048928 | Ga0496125_0017662 | Ga0496125_0017662_3825_5234 | 460 |
| 4 | 3300005347 | Ga0070668_100001863 | Ga0070668_1000018633 | 461 |
| 5 | 3300005367 | Ga0070667_100001291 | Ga0070667_1000012912 | 461 |
| 6 | 3300005844 | Ga0068862_100019322 | Ga0068862_1000193226 | 461 |
| 7 | 3300025986 | Ga0207658_10001498 | Ga0207658_1000149817 | 461 |
| 8 | 3300028380 | Ga0268265_10004041 | Ga0268265_100040419 | 461 |
| 9 | 3300009176 | Ga0105242_10000415 | Ga0105242_1000041534 | 467 |
| 10 | 3300025934 | Ga0207686_10001699 | Ga0207686_100016994 | 467 |
| 11 | 3300005981 | Ga0081538_10009890 | Ga0081538_100098905 | 468 |
| 12 | 3300053078 | Ga0495612_0001063 | Ga0495612_0001063_1229_2731 | 468 |
| 13 | 3300048903 | Ga0496100_0000046 | Ga0496100_0000046_65333_66883 | 469 |
| 14 | 3300048904 | Ga0496101_0000124 | Ga0496101_0000124_10766_12316 | 469 |
| 15 | 3300048909 | Ga0496106_0000059 | Ga0496106_0000059_10718_12268 | 469 |
| 16 | 3300048910 | Ga0496107_0000018 | Ga0496107_0000018_63156_64706 | 469 |
| 17 | 3300005981 | Ga0081538_10000407 | Ga0081538_1000040726 | 470 |
| 18 | 3300005937 | Ga0081455_10052949 | Ga0081455_100529492 | 472 |
| 19 | 3300048907 | Ga0496104_0000007 | Ga0496104_0000007_135278_136816 | 472 |
| 20 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_338217_339755 | 472 |
| 21 | 3300048922 | Ga0496119_0013624 | Ga0496119_0013624_3746_5284 | 472 |
| 22 | 3300048923 | Ga0496120_0007159 | Ga0496120_0007159_6633_8171 | 472 |
| 23 | 3300013297 | Ga0157378_10030097 | Ga0157378_100300972 | 474 |
| 24 | 3300009098 | Ga0105245_10000291 | Ga0105245_1000029125 | 475 |
| 25 | 3300025927 | Ga0207687_10000058 | Ga0207687_1000005846 | 475 |
| 26 | 3300047673 | Ga0495593_0056934 | Ga0495593_0056934_256_1833 | 480 |
| 27 | 3300048911 | Ga0496108_0003965 | Ga0496108_0003965_1358_2857 | 481 |
| 28 | 3300048916 | Ga0496113_0024590 | Ga0496113_0024590_1473_2972 | 481 |
| 29 | 3300005333 | Ga0070677_10000107 | Ga0070677_100001077 | 482 |
| 30 | 3300005337 | Ga0070682_100000103 | Ga0070682_10000010332 | 482 |
| 31 | 3300005578 | Ga0068854_100008518 | Ga0068854_1000085182 | 482 |
| 32 | 3300025893 | Ga0207682_10000102 | Ga0207682_100001027 | 482 |
| 33 | 3300025981 | Ga0207640_10003204 | Ga0207640_100032048 | 482 |
| 34 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_81179_82675 | 482 |
| 35 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_81179_82675 | 482 |
| 36 | 3300048909 | Ga0496106_0000065 | Ga0496106_0000065_26310_27806 | 482 |
| 37 | 3300048910 | Ga0496107_0000026 | Ga0496107_0000026_81179_82675 | 482 |
| 38 | 3300048911 | Ga0496108_0000032 | Ga0496108_0000032_47508_49034 | 483 |
| 39 | 3300048912 | Ga0496109_0000217 | Ga0496109_0000217_1135_2661 | 483 |
| 40 | 3300005985 | Ga0081539_10004262 | Ga0081539_100042622 | 484 |
| 41 | 3300005338 | Ga0068868_100019223 | Ga0068868_1000192232 | 485 |
| 42 | 3300005356 | Ga0070674_100000810 | Ga0070674_1000008106 | 485 |
| 43 | 3300005718 | Ga0068866_10000475 | Ga0068866_1000047516 | 485 |
| 44 | 3300009176 | Ga0105242_10039738 | Ga0105242_100397382 | 485 |
| 45 | 3300009553 | Ga0105249_10000085 | Ga0105249_10000085122 | 485 |
| 46 | 3300025899 | Ga0207642_10000086 | Ga0207642_1000008617 | 485 |
| 47 | 3300025937 | Ga0207669_10000007 | Ga0207669_10000007115 | 485 |
| 48 | 3300025961 | Ga0207712_10000033 | Ga0207712_10000033130 | 485 |
| 49 | 3300026023 | Ga0207677_10010765 | Ga0207677_100107655 | 485 |
| 50 | 3300046537 | Ga0495598_0005030 | Ga0495598_0005030_603_2093 | 485 |
| 51 | 3300049591 | Ga0501075_0013457 | Ga0501075_0013457_3179_4669 | 485 |
| 52 | 3300048907 | Ga0496104_0000120 | Ga0496104_0000120_24349_25947 | 486 |
| 53 | 3300048908 | Ga0496105_0000020 | Ga0496105_0000020_46851_48449 | 486 |
| 54 | 3300002074 | JGI24748J21848_1000702 | JGI24748J21848_10007022 | 487 |
| 55 | 3300002239 | JGI24034J26672_10000088 | JGI24034J26672_1000008810 | 487 |
| 56 | 3300002244 | JGI24742J22300_10001625 | JGI24742J22300_100016252 | 487 |
| 57 | 3300005329 | Ga0070683_100034604 | Ga0070683_1000346042 | 487 |
| 58 | 3300005439 | Ga0070711_100005854 | Ga0070711_1000058546 | 487 |
| 59 | 3300005457 | Ga0070662_100000109 | Ga0070662_10000010936 | 487 |
| 60 | 3300005535 | Ga0070684_100014823 | Ga0070684_1000148232 | 487 |
| 61 | 3300006852 | Ga0075433_10000421 | Ga0075433_1000042121 | 487 |
| 62 | 3300009551 | Ga0105238_10000051 | Ga0105238_1000005168 | 487 |
| 63 | 3300025916 | Ga0207663_10005434 | Ga0207663_100054346 | 487 |
| 64 | 3300025924 | Ga0207694_10000035 | Ga0207694_1000003569 | 487 |
| 65 | 3300025933 | Ga0207706_10000413 | Ga0207706_1000041313 | 487 |
| 66 | 3300025935 | Ga0207709_10006427 | Ga0207709_100064277 | 487 |
| 67 | 3300025944 | Ga0207661_10029523 | Ga0207661_100295232 | 487 |
| 68 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_510959_512488 | 487 |
| 69 | 3300050515 | nmdc:mga0a205_19_c2 | nmdc:mga0a205_19_c2_9995_11491 | 487 |
| 70 | 3300046559 | Ga0495667_0000044 | Ga0495667_0000044_110109_111620 | 488 |
| 71 | 3300047322 | Ga0495680_0006214 | Ga0495680_0006214_4695_6206 | 488 |
| 72 | 3300005455 | Ga0070663_100001137 | Ga0070663_10000113711 | 489 |
| 73 | 3300005530 | Ga0070679_100002387 | Ga0070679_1000023873 | 489 |
| 74 | 3300005842 | Ga0068858_100000965 | Ga0068858_10000096524 | 489 |
| 75 | 3300025921 | Ga0207652_10002144 | Ga0207652_100021443 | 489 |
| 76 | 3300025934 | Ga0207686_10040235 | Ga0207686_100402352 | 489 |
| 77 | 3300026035 | Ga0207703_10000028 | Ga0207703_10000028201 | 489 |
| 78 | 3300026067 | Ga0207678_10003342 | Ga0207678_1000334210 | 489 |
| 79 | 3300046642 | Ga0495634_0000013 | Ga0495634_0000013_119282_120793 | 489 |
| 80 | 3300048909 | Ga0496106_0000015 | Ga0496106_0000015_179028_180527 | 489 |
| 81 | 3300048911 | Ga0496108_0000163 | Ga0496108_0000163_36689_38188 | 489 |
| 82 | 3300048912 | Ga0496109_0000155 | Ga0496109_0000155_2268_3767 | 489 |
| 83 | 3300053085 | Ga0495619_0000015 | Ga0495619_0000015_193208_194707 | 489 |
| 84 | 3300006852 | Ga0075433_10031153 | Ga0075433_100311532 | 490 |
| 85 | 3300013104 | Ga0157370_10025887 | Ga0157370_100258872 | 490 |
| 86 | 3300046663 | Ga0495635_0001966 | Ga0495635_0001966_1655_3295 | 490 |
| 87 | 3300005365 | Ga0070688_100000076 | Ga0070688_1000000767 | 491 |
| 88 | 3300005466 | Ga0070685_10000062 | Ga0070685_100000627 | 491 |
| 89 | 3300014969 | Ga0157376_10040694 | Ga0157376_100406943 | 491 |
| 90 | 3300046514 | Ga0495618_0000241 | Ga0495618_0000241_33653_35161 | 491 |
| 91 | 3300046533 | Ga0495640_0018708 | Ga0495640_0018708_1731_3239 | 491 |
| 92 | 3300049581 | Ga0501047_0059585 | Ga0501047_0059585_1177_2679 | 491 |
| 93 | 3300046473 | Ga0495582_0000007 | Ga0495582_0000007_66147_67634 | 492 |
| 94 | 3300046660 | Ga0495625_0000117 | Ga0495625_0000117_108160_109731 | 492 |
| 95 | 3300046681 | Ga0495647_0000003 | Ga0495647_0000003_2371_3930 | 492 |
| 96 | 3300046683 | Ga0495658_0000007 | Ga0495658_0000007_66141_67628 | 492 |
| 97 | 3300046684 | Ga0495669_0000065 | Ga0495669_0000065_50916_52511 | 492 |
| 98 | 3300048922 | Ga0496119_0033454 | Ga0496119_0033454_568_2094 | 492 |
| 99 | 3300048924 | Ga0496121_0016519 | Ga0496121_0016519_1602_3134 | 492 |
| 100 | 3300048924 | Ga0496121_0046575 | Ga0496121_0046575_839_2398 | 492 |
| 101 | 3300048928 | Ga0496125_0103042 | Ga0496125_0103042_85_1611 | 492 |
| 102 | 3300049569 | Ga0501032_0010588 | Ga0501032_0010588_3051_4553 | 492 |
| 103 | 3300049570 | Ga0501033_0001259 | Ga0501033_0001259_3109_4611 | 492 |
| 104 | 3300049571 | Ga0501034_0047454 | Ga0501034_0047454_1829_3331 | 492 |
| 105 | 3300049572 | Ga0501036_0000290 | Ga0501036_0000290_15294_16796 | 492 |
| 106 | 3300049574 | Ga0501038_0001257 | Ga0501038_0001257_3503_5005 | 492 |
| 107 | 3300049580 | Ga0501046_0001423 | Ga0501046_0001423_3520_5022 | 492 |
| 108 | 3300049581 | Ga0501047_0005727 | Ga0501047_0005727_3098_4600 | 492 |
| 109 | 3300049582 | Ga0501048_0000843 | Ga0501048_0000843_3096_4598 | 492 |
| 110 | 3300049586 | Ga0501070_0014448 | Ga0501070_0014448_1640_3142 | 492 |
| 111 | 3300049589 | Ga0501073_0008515 | Ga0501073_0008515_2387_3889 | 492 |
| 112 | 3300049744 | Ga0501083_0040180 | Ga0501083_0040180_834_2336 | 492 |
| 113 | 3300049822 | Ga0501035_0000368 | Ga0501035_0000368_24698_26200 | 492 |
| 114 | 3300049823 | Ga0501044_0025351 | Ga0501044_0025351_3143_4645 | 492 |
| 115 | 3300060353 | Ga0501082_0008494 | Ga0501082_0008494_5822_7324 | 492 |
| 116 | 3300013296 | Ga0157374_10003397 | Ga0157374_100033972 | 493 |
| 117 | 3300028556 | Ga0265337_1000044 | Ga0265337_100004427 | 493 |
| 118 | 3300028558 | Ga0265326_10000038 | Ga0265326_1000003819 | 493 |
| 119 | 3300028654 | Ga0265322_10000006 | Ga0265322_10000006151 | 493 |
| 120 | 3300028666 | Ga0265336_10001989 | Ga0265336_100019892 | 493 |
| 121 | 3300029957 | Ga0265324_10000171 | Ga0265324_1000017139 | 493 |
| 122 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001620 | 493 |
| 123 | 3300031242 | Ga0265329_10004430 | Ga0265329_100044302 | 493 |
| 124 | 3300031250 | Ga0265331_10000624 | Ga0265331_1000062411 | 493 |
| 125 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003620 | 493 |
| 126 | 3300031344 | Ga0265316_10013013 | Ga0265316_100130136 | 493 |
| 127 | 3300031595 | Ga0265313_10038370 | Ga0265313_100383702 | 493 |
| 128 | 3300031711 | Ga0265314_10000103 | Ga0265314_1000010379 | 493 |
| 129 | 3300046543 | Ga0495645_0014181 | Ga0495645_0014181_767_2314 | 493 |
| 130 | 3300046809 | Ga0495600_0002102 | Ga0495600_0002102_1733_3301 | 493 |
| 131 | 3300048906 | Ga0496103_0066529 | Ga0496103_0066529_208_1767 | 493 |
| 132 | 3300048920 | Ga0496117_0004504 | Ga0496117_0004504_11184_12743 | 493 |
| 133 | 3300048921 | Ga0496118_0020448 | Ga0496118_0020448_3007_4566 | 493 |
| 134 | 3300049590 | Ga0501074_0072047 | Ga0501074_0072047_339_1865 | 493 |
| 135 | 3300053085 | Ga0495619_0002049 | Ga0495619_0002049_1626_3143 | 493 |
| 136 | 3300005335 | Ga0070666_10124985 | Ga0070666_101249852 | 494 |
| 137 | 3300005367 | Ga0070667_100006640 | Ga0070667_1000066408 | 494 |
| 138 | 3300005841 | Ga0068863_100000042 | Ga0068863_100000042140 | 494 |
| 139 | 3300005841 | Ga0068863_100005232 | Ga0068863_10000523213 | 494 |
| 140 | 3300025903 | Ga0207680_10067000 | Ga0207680_100670002 | 494 |
| 141 | 3300025986 | Ga0207658_10014661 | Ga0207658_100146612 | 494 |
| 142 | 3300026088 | Ga0207641_10000066 | Ga0207641_1000006683 | 494 |
| 143 | 3300026088 | Ga0207641_10029706 | Ga0207641_100297063 | 494 |
| 144 | 3300028379 | Ga0268266_10000424 | Ga0268266_1000042418 | 494 |
| 145 | 3300046499 | Ga0495594_0000017 | Ga0495594_0000017_5456_6955 | 494 |
| 146 | 3300046511 | Ga0495608_0057300 | Ga0495608_0057300_523_2022 | 494 |
| 147 | 3300046516 | Ga0495628_0022079 | Ga0495628_0022079_3477_4976 | 494 |
| 148 | 3300046529 | Ga0495652_0000022 | Ga0495652_0000022_69862_71373 | 494 |
| 149 | 3300046557 | Ga0495622_0000107 | Ga0495622_0000107_5437_6936 | 494 |
| 150 | 3300046642 | Ga0495634_0000840 | Ga0495634_0000840_9445_11001 | 494 |
| 151 | 3300048088 | Ga0495602_0009086 | Ga0495602_0009086_6462_7961 | 494 |
| 152 | 3300048929 | Ga0496126_0048028 | Ga0496126_0048028_690_2210 | 494 |
| 153 | 3300049579 | Ga0501043_0011637 | Ga0501043_0011637_4133_5704 | 494 |
| 154 | 3300053096 | Ga0500641_0006228 | Ga0500641_0006228_2566_4065 | 494 |
| 155 | 3300005330 | Ga0070690_100091322 | Ga0070690_1000913222 | 495 |
| 156 | 3300005331 | Ga0070670_100106872 | Ga0070670_1001068722 | 495 |
| 157 | 3300005335 | Ga0070666_10002746 | Ga0070666_100027466 | 495 |
| 158 | 3300005466 | Ga0070685_10000592 | Ga0070685_100005927 | 495 |
| 159 | 3300009098 | Ga0105245_10000324 | Ga0105245_1000032433 | 495 |
| 160 | 3300009098 | Ga0105245_10009522 | Ga0105245_100095223 | 495 |
| 161 | 3300025927 | Ga0207687_10000027 | Ga0207687_10000027103 | 495 |
| 162 | 3300025927 | Ga0207687_10000713 | Ga0207687_1000071323 | 495 |
| 163 | 3300046455 | Ga0495603_0000655 | Ga0495603_0000655_6754_8316 | 495 |
| 164 | 3300046476 | Ga0495662_0013315 | Ga0495662_0013315_1509_3026 | 495 |
| 165 | 3300046683 | Ga0495658_0003502 | Ga0495658_0003502_5208_6752 | 495 |
| 166 | 3300049592 | Ga0501076_0009479 | Ga0501076_0009479_2373_3890 | 495 |
| 167 | 3300005354 | Ga0070675_100000209 | Ga0070675_10000020932 | 496 |
| 168 | 3300025900 | Ga0207710_10021478 | Ga0207710_100214782 | 496 |
| 169 | 3300025926 | Ga0207659_10000242 | Ga0207659_1000024215 | 496 |
| 170 | 3300025972 | Ga0207668_10072389 | Ga0207668_100723891 | 496 |
| 171 | 3300026121 | Ga0207683_10036161 | Ga0207683_100361612 | 496 |
| 172 | 3300028379 | Ga0268266_10001583 | Ga0268266_100015837 | 496 |
| 173 | 3300046674 | Ga0495588_0000202 | Ga0495588_0000202_16235_17794 | 496 |
| 174 | 3300046681 | Ga0495647_0004060 | Ga0495647_0004060_939_2486 | 496 |
| 175 | 3300053083 | Ga0495655_0000816 | Ga0495655_0000816_2768_4291 | 496 |
| 176 | 3300053084 | Ga0495595_0000083 | Ga0495595_0000083_1599_3179 | 496 |
| 177 | 3300005338 | Ga0068868_100000299 | Ga0068868_10000029928 | 497 |
| 178 | 3300005344 | Ga0070661_100000045 | Ga0070661_10000004583 | 497 |
| 179 | 3300005614 | Ga0068856_100065253 | Ga0068856_1000652532 | 497 |
| 180 | 3300013105 | Ga0157369_10000173 | Ga0157369_1000017377 | 497 |
| 181 | 3300025920 | Ga0207649_10000021 | Ga0207649_100000219 | 497 |
| 182 | 3300026023 | Ga0207677_10004036 | Ga0207677_100040367 | 497 |
| 183 | 3300026041 | Ga0207639_10011691 | Ga0207639_100116915 | 497 |
| 184 | 3300026078 | Ga0207702_10041565 | Ga0207702_100415652 | 497 |
| 185 | 3300026142 | Ga0207698_10027891 | Ga0207698_100278912 | 497 |
| 186 | 3300046455 | Ga0495603_0019700 | Ga0495603_0019700_2335_3969 | 497 |
| 187 | 3300003659 | JGI25404J52841_10000194 | JGI25404J52841_100001943 | 498 |
| 188 | 3300005341 | Ga0070691_10000675 | Ga0070691_100006755 | 498 |
| 189 | 3300005616 | Ga0068852_100000035 | Ga0068852_10000003584 | 498 |
| 190 | 3300005937 | Ga0081455_10012902 | Ga0081455_100129025 | 498 |
| 191 | 3300005983 | Ga0081540_1000490 | Ga0081540_10004908 | 498 |
| 192 | 3300006881 | Ga0068865_100000470 | Ga0068865_1000004704 | 498 |
| 193 | 3300009176 | Ga0105242_10004751 | Ga0105242_100047518 | 498 |
| 194 | 3300009177 | Ga0105248_10003169 | Ga0105248_100031697 | 498 |
| 195 | 3300017792 | Ga0163161_10000018 | Ga0163161_10000018199 | 498 |
| 196 | 3300025900 | Ga0207710_10000154 | Ga0207710_100001543 | 498 |
| 197 | 3300025934 | Ga0207686_10000247 | Ga0207686_100002478 | 498 |
| 198 | 3300025938 | Ga0207704_10000239 | Ga0207704_100002392 | 498 |
| 199 | 3300025941 | Ga0207711_10000019 | Ga0207711_10000019381 | 498 |
| 200 | 3300026142 | Ga0207698_10000044 | Ga0207698_1000004454 | 498 |
| 201 | 3300046507 | Ga0495606_0000131 | Ga0495606_0000131_99167_100741 | 498 |
| 202 | 3300046517 | Ga0495630_0000053 | Ga0495630_0000053_54944_56518 | 498 |
| 203 | 3300046517 | Ga0495630_0003260 | Ga0495630_0003260_5383_6939 | 498 |
| 204 | 3300046529 | Ga0495652_0076028 | Ga0495652_0076028_966_2510 | 498 |
| 205 | 3300046642 | Ga0495634_0023759 | Ga0495634_0023759_1085_2629 | 498 |
| 206 | 3300046690 | Ga0495624_0006180 | Ga0495624_0006180_2066_3643 | 498 |
| 207 | 3300048905 | Ga0496102_0000061 | Ga0496102_0000061_59961_61505 | 498 |
| 208 | 3300048906 | Ga0496103_0000044 | Ga0496103_0000044_59961_61505 | 498 |
| 209 | 3300048911 | Ga0496108_0000025 | Ga0496108_0000025_109457_111007 | 498 |
| 210 | 3300048912 | Ga0496109_0018444 | Ga0496109_0018444_1530_3080 | 498 |
| 211 | 3300048919 | Ga0496116_0000814 | Ga0496116_0000814_23435_24973 | 498 |
| 212 | 3300053077 | Ga0495601_0000061 | Ga0495601_0000061_56869_58431 | 498 |
| 213 | 3300053077 | Ga0495601_0023865 | Ga0495601_0023865_96_1640 | 498 |
| 214 | 3300053083 | Ga0495655_0000003 | Ga0495655_0000003_296401_297945 | 498 |
| 215 | 3300053129 | Ga0500628_000002 | Ga0500628_000002_296401_297945 | 498 |
| 216 | 3300005366 | Ga0070659_100027318 | Ga0070659_1000273182 | 499 |
| 217 | 3300005841 | Ga0068863_100069584 | Ga0068863_1000695842 | 499 |
| 218 | 3300014968 | Ga0157379_10066717 | Ga0157379_100667172 | 499 |
| 219 | 3300026088 | Ga0207641_10051174 | Ga0207641_100511742 | 499 |
| 220 | 3300046463 | Ga0495653_0081882 | Ga0495653_0081882_631_2208 | 499 |
| 221 | 3300046615 | Ga0495656_0000352 | Ga0495656_0000352_2230_3816 | 499 |
| 222 | 3300046689 | Ga0495613_0000122 | Ga0495613_0000122_25878_27449 | 499 |
| 223 | 3300047317 | Ga0495604_0035008 | Ga0495604_0035008_489_2060 | 499 |
| 224 | 3300048088 | Ga0495602_0000008 | Ga0495602_0000008_198482_200053 | 499 |
| 225 | 3300048907 | Ga0496104_0000491 | Ga0496104_0000491_15049_16599 | 499 |
| 226 | 3300048908 | Ga0496105_0000110 | Ga0496105_0000110_53113_54663 | 499 |
| 227 | 3300048912 | Ga0496109_0133754 | Ga0496109_0133754_104_1654 | 499 |
| 228 | 3300053078 | Ga0495612_0000116 | Ga0495612_0000116_10650_12239 | 499 |
| 229 | 3300001979 | JGI24740J21852_10000401 | JGI24740J21852_1000040116 | 500 |
| 230 | 3300005336 | Ga0070680_100026504 | Ga0070680_1000265043 | 500 |
| 231 | 3300005341 | Ga0070691_10000319 | Ga0070691_100003195 | 500 |
| 232 | 3300005436 | Ga0070713_100000628 | Ga0070713_10000062814 | 500 |
| 233 | 3300005535 | Ga0070684_100064355 | Ga0070684_1000643552 | 500 |
| 234 | 3300005543 | Ga0070672_100000003 | Ga0070672_10000000378 | 500 |
| 235 | 3300005614 | Ga0068856_100091481 | Ga0068856_1000914812 | 500 |
| 236 | 3300005618 | Ga0068864_100000159 | Ga0068864_10000015918 | 500 |
| 237 | 3300005842 | Ga0068858_100000244 | Ga0068858_10000024455 | 500 |
| 238 | 3300009174 | Ga0105241_10039899 | Ga0105241_100398993 | 500 |
| 239 | 3300013308 | Ga0157375_10001056 | Ga0157375_1000105616 | 500 |
| 240 | 3300025912 | Ga0207707_10049013 | Ga0207707_100490132 | 500 |
| 241 | 3300025915 | Ga0207693_10005251 | Ga0207693_100052517 | 500 |
| 242 | 3300025917 | Ga0207660_10013518 | Ga0207660_100135183 | 500 |
| 243 | 3300025921 | Ga0207652_10000444 | Ga0207652_1000044438 | 500 |
| 244 | 3300025928 | Ga0207700_10000013 | Ga0207700_10000013131 | 500 |
| 245 | 3300025940 | Ga0207691_10000005 | Ga0207691_1000000578 | 500 |
| 246 | 3300026035 | Ga0207703_10000411 | Ga0207703_100004118 | 500 |
| 247 | 3300026078 | Ga0207702_10000333 | Ga0207702_100003333 | 500 |
| 248 | 3300026078 | Ga0207702_10015114 | Ga0207702_100151142 | 500 |
| 249 | 3300026095 | Ga0207676_10000128 | Ga0207676_1000012848 | 500 |
| 250 | 3300028379 | Ga0268266_10000076 | Ga0268266_1000007684 | 500 |
| 251 | 3300041512 | Ga0451853_3408443 | Ga0451853_3408443_2892_4490 | 500 |
| 252 | 3300044694 | Ga0466963_0000040 | Ga0466963_0000040_17608_19212 | 500 |
| 253 | 3300046454 | Ga0495592_0000458 | Ga0495592_0000458_2363_3964 | 500 |
| 254 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_289287_290888 | 500 |
| 255 | 3300046511 | Ga0495608_0001021 | Ga0495608_0001021_16274_17875 | 500 |
| 256 | 3300046515 | Ga0495620_0001188 | Ga0495620_0001188_11995_13608 | 500 |
| 257 | 3300046535 | Ga0495586_0002162 | Ga0495586_0002162_4927_6525 | 500 |
| 258 | 3300046689 | Ga0495613_0000066 | Ga0495613_0000066_38197_39798 | 500 |
| 259 | 3300046694 | Ga0495649_0001991 | Ga0495649_0001991_2314_3912 | 500 |
| 260 | 3300047321 | Ga0495676_0005348 | Ga0495676_0005348_9322_10923 | 500 |
| 261 | 3300047322 | Ga0495680_0001777 | Ga0495680_0001777_18876_20477 | 500 |
| 262 | 3300048908 | Ga0496105_0156363 | Ga0496105_0156363_120_1703 | 500 |
| 263 | 3300048913 | Ga0496110_0000003 | Ga0496110_0000003_70195_71751 | 500 |
| 264 | 3300048914 | Ga0496111_0000058 | Ga0496111_0000058_7804_9360 | 500 |
| 265 | 3300048915 | Ga0496112_0018107 | Ga0496112_0018107_2518_4095 | 500 |
| 266 | 3300048916 | Ga0496113_0000207 | Ga0496113_0000207_4024_5601 | 500 |
| 267 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_239068_240666 | 500 |
| 268 | 3300053077 | Ga0495601_0000090 | Ga0495601_0000090_46215_47813 | 500 |
| 269 | 3300005458 | Ga0070681_10044802 | Ga0070681_100448022 | 501 |
| 270 | 3300028563 | Ga0265319_1000102 | Ga0265319_10001027 | 501 |
| 271 | 3300028800 | Ga0265338_10000441 | Ga0265338_100004418 | 501 |
| 272 | 3300031241 | Ga0265325_10030327 | Ga0265325_100303272 | 501 |
| 273 | 3300044842 | Ga0466957_0010082 | Ga0466957_0010082_3193_4761 | 501 |
| 274 | 3300046476 | Ga0495662_0000073 | Ga0495662_0000073_2375_4006 | 501 |
| 275 | 3300046516 | Ga0495628_0014879 | Ga0495628_0014879_1127_2776 | 501 |
| 276 | 3300048913 | Ga0496110_0024180 | Ga0496110_0024180_528_2123 | 501 |
| 277 | 3300048915 | Ga0496112_0164168 | Ga0496112_0164168_457_2001 | 501 |
| 278 | 3300048916 | Ga0496113_0004573 | Ga0496113_0004573_5914_7458 | 501 |
| 279 | 3300048917 | Ga0496114_0000042 | Ga0496114_0000042_72431_73996 | 501 |
| 280 | 3300053085 | Ga0495619_0020518 | Ga0495619_0020518_209_1804 | 501 |
| 281 | 3300005356 | Ga0070674_100000011 | Ga0070674_10000001197 | 502 |
| 282 | 3300005718 | Ga0068866_10000040 | Ga0068866_100000409 | 502 |
| 283 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001649 | 502 |
| 284 | 3300025899 | Ga0207642_10000003 | Ga0207642_10000003649 | 502 |
| 285 | 3300025937 | Ga0207669_10000099 | Ga0207669_1000009933 | 502 |
| 286 | 3300036401 | Ga0373937_0040856 | Ga0373937_0040856_842_2506 | 502 |
| 287 | 3300046459 | Ga0495629_0000738 | Ga0495629_0000738_1709_3274 | 502 |
| 288 | 3300046533 | Ga0495640_0014279 | Ga0495640_0014279_3250_4845 | 502 |
| 289 | 3300046536 | Ga0495587_0030442 | Ga0495587_0030442_94_1692 | 502 |
| 290 | 3300047319 | Ga0495674_0000113 | Ga0495674_0000113_41384_42979 | 502 |
| 291 | 3300048918 | Ga0496115_0003718 | Ga0496115_0003718_5989_7575 | 502 |
| 292 | 3300005364 | Ga0070673_100002476 | Ga0070673_1000024768 | 503 |
| 293 | 3300005843 | Ga0068860_100010843 | Ga0068860_1000108435 | 503 |
| 294 | 3300006163 | Ga0070715_10000036 | Ga0070715_1000003638 | 503 |
| 295 | 3300025321 | Ga0207656_10011412 | Ga0207656_100114122 | 503 |
| 296 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001221 | 503 |
| 297 | 3300025960 | Ga0207651_10001290 | Ga0207651_100012904 | 503 |
| 298 | 3300028381 | Ga0268264_10002303 | Ga0268264_100023037 | 503 |
| 299 | 3300046455 | Ga0495603_0000167 | Ga0495603_0000167_20993_22594 | 503 |
| 300 | 3300047322 | Ga0495680_0000629 | Ga0495680_0000629_29387_30955 | 503 |
| 301 | 3300053085 | Ga0495619_0000869 | Ga0495619_0000869_12879_14480 | 503 |
| 302 | 3300053085 | Ga0495619_0001450 | Ga0495619_0001450_10243_11868 | 503 |
| 303 | 3300047317 | Ga0495604_0000081 | Ga0495604_0000081_16010_17614 | 505 |
| 304 | 3300001977 | JGI24746J21847_1000115 | JGI24746J21847_10001158 | 509 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7aqq-assembly1.cif.gz_M | cryo-em structure of arabidopsis thaliana complex-i (membrane core) | 0.897 | 2 | 265 |
| 7aqq-assembly1.cif.gz_M | cryo-em structure of arabidopsis thaliana complex-i (membrane core) | 0.884 | 2 | 265 |
| 7wg5-assembly1.cif.gz_F | cyclic electron transport supercomplex ndh-psi from arabidopsis | 0.8543 | 3 | 431 |
| 6i1p-assembly2.cif.gz_U | respiratory complex i from thermus thermophilus with bound nadh | 0.8515 | 1 | 464 |
| 6zjy-assembly1.cif.gz_M | respiratory complex i from thermus thermophilus, nad+ dataset, minor state | 0.8465 | 1 | 467 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9305 | 2 | 120 | 1.20.1070.10 |
| af_M1FQK6_1_136_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9232 | 3 | 121 | 1.20.1070.10 |
| af_P0AFE8_1_132_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8835 | 2 | 120 | 1.20.1070.10 |
| af_P26288_1_130_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8489 | 2 | 120 | 1.20.1070.10 |
| af_M1FQK6_1_136_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.8082 | 3 | 121 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1UQ06-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9449 | 2 | 133 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A2V7J423-F1-model_v4 | NADH:quinone oxidoreductase/Mrp antiporter membrane subunit domain-containing protein | 0.9391 | 2 | 291 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A528B264-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9387 | 2 | 302 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A4Q5QT70-F1-model_v4 | NADH-quinone oxidoreductase subunit M | 0.9384 | 2 | 246 |
GO:0003954
GO:0008137 GO:0012505 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A379CYL0-F1-model_v4 | deleted | 0.9368 | 2 | 294 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar