F397799

General Info

Members Datasets Scaffolds Average Seq Length
304 167 608 144

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0852891|Ga0501048_0852891_62_556
Length 164
Sequence LDCRNLFGVRYLGVDYGARRIGLAVSDETATLARPWQVVTAGTDLQASARQVAALVATAASGIDPLRFAGVVLGLPRRLNGEDNEQTPHVRIFASALQAATGLPVHLQDERLSSLEAEARLGVRERDWRRRKARLDAAAAAVILQDFLDARARGLETRGLDDDP

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.28
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 26.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0852891 3300049582 Bacteria 655
2 Ga0065712_10000948 3300005290 Bacteria 16632
3 Ga0065712_10103172 3300005290 Unclassified 1991
4 Ga0065715_10099004 3300005293 Bacteria 3470
5 Ga0070658_10530809 3300005327 Bacteria 1018
6 Ga0070676_10001436 3300005328 Bacteria 12032
7 Ga0070690_100146957 3300005330 Archaea 1605
8 Ga0070670_100170848 3300005331 Unclassified 1885
9 Ga0070677_10117097 3300005333 Bacteria 1198
10 Ga0068869_100452944 3300005334 Bacteria 1064
11 Ga0070666_10228867 3300005335 Bacteria 1313
12 Ga0070680_100429003 3300005336 Bacteria 1128
13 Ga0070689_100182048 3300005340 Unclassified 1707
14 Ga0070689_100217655 3300005340 Bacteria 1566
15 Ga0070691_10000554 3300005341 Bacteria 14199
16 Ga0070687_100021459 3300005343 Bacteria 3036
17 Ga0070661_100361161 3300005344 Bacteria 1141
18 Ga0070661_100514620 3300005344 Bacteria 959
19 Ga0070668_100826809 3300005347 Unclassified 824
20 Ga0070669_100011077 3300005353 Bacteria 6401
21 Ga0070669_100022090 3300005353 Bacteria 4551
22 Ga0070675_100528412 3300005354 Bacteria 1065
23 Ga0070675_102009804 3300005354 Unclassified 533
24 Ga0070671_100023406 3300005355 Bacteria 5055
25 Ga0070671_100077172 3300005355 Bacteria 2784
26 Ga0070674_100062433 3300005356 Unclassified 2603
27 Ga0070674_100659814 3300005356 Bacteria 890
28 Ga0070673_100109162 3300005364 Bacteria 2292
29 Ga0070673_100436651 3300005364 Bacteria 1176
30 Ga0070673_101490039 3300005364 Bacteria 638
31 Ga0070688_100155758 3300005365 Unclassified 1565
32 Ga0070667_100005780 3300005367 Bacteria 10322
33 Ga0070667_100345999 3300005367 Bacteria 1345
34 Ga0070703_10057334 3300005406 Bacteria 1264
35 Ga0070709_10031668 3300005434 Bacteria 3182
36 Ga0070709_10521561 3300005434 Unclassified 905
37 Ga0070701_10056171 3300005438 Unclassified 2059
38 Ga0070705_100023110 3300005440 Bacteria 3333
39 Ga0070705_100332759 3300005440 Bacteria 1101
40 Ga0070700_100026871 3300005441 Bacteria 3405
41 Ga0070694_100051289 3300005444 Bacteria 2784
42 Ga0070694_100109648 3300005444 Bacteria 1965
43 Ga0070708_100520763 3300005445 Unclassified 1122
44 Ga0070678_100114389 3300005456 Unclassified 2116
45 Ga0068867_100007398 3300005459 Bacteria 7768
46 Ga0068867_102025084 3300005459 Unclassified 544
47 Ga0070685_10269432 3300005466 Bacteria 1136
48 Ga0070706_101419779 3300005467 Bacteria 635
49 Ga0070707_100379784 3300005468 Unclassified 1373
50 Ga0070699_100017870 3300005518 Bacteria 6090
51 Ga0070699_100223285 3300005518 Bacteria 1679
52 Ga0070679_100803077 3300005530 Bacteria 884
53 Ga0070684_100260026 3300005535 Unclassified 1588
54 Ga0070697_100192404 3300005536 Bacteria 1732
55 Ga0070697_100319570 3300005536 Unclassified 1337
56 Ga0070697_100835547 3300005536 Bacteria 816
57 Ga0068853_100424879 3300005539 Bacteria 1247
58 Ga0070672_100004283 3300005543 Bacteria 9328
59 Ga0070672_100088757 3300005543 Bacteria 2490
60 Ga0070672_100127911 3300005543 Bacteria 2086
61 Ga0070672_100798680 3300005543 Bacteria 830
62 Ga0070686_100019979 3300005544 Bacteria 3958
63 Ga0070686_100483325 3300005544 Bacteria 958
64 Ga0070695_100001237 3300005545 Bacteria 14040
65 Ga0070695_100576684 3300005545 Bacteria 880
66 Ga0070695_101388777 3300005545 Bacteria 582
67 Ga0070696_100007978 3300005546 Bacteria 7068
68 Ga0070693_100450003 3300005547 Bacteria 904
69 Ga0070665_101048507 3300005548 Unclassified 827
70 Ga0070665_101608940 3300005548 Unclassified 657
71 Ga0070704_100001748 3300005549 Bacteria 11869
72 Ga0070704_101629909 3300005549 Bacteria 595
73 Ga0070704_101644676 3300005549 Unclassified 593
74 Ga0068855_100283471 3300005563 Bacteria 1839
75 Ga0070664_100828161 3300005564 Unclassified 866
76 Ga0068854_100021372 3300005578 Bacteria 4391
77 Ga0068854_100021702 3300005578 Bacteria 4360
78 Ga0070702_100001780 3300005615 Bacteria 8942
79 Ga0068852_100449042 3300005616 Bacteria 1276
80 Ga0068852_100589804 3300005616 Bacteria 1115
81 Ga0068852_101264976 3300005616 Bacteria 759
82 Ga0068859_100344538 3300005617 Bacteria 1585
83 Ga0068859_101390812 3300005617 Bacteria 774
84 Ga0068864_100058886 3300005618 Unclassified 3321
85 Ga0068864_100798651 3300005618 Unclassified 927
86 Ga0068861_100002888 3300005719 Bacteria 11326
87 Ga0068861_101071841 3300005719 Bacteria 773
88 Ga0068863_100089970 3300005841 Bacteria 2911
89 Ga0068863_100261274 3300005841 Bacteria 1674
90 Ga0068863_100327962 3300005841 Bacteria 1488
91 Ga0068863_100951141 3300005841 Bacteria 861
92 Ga0068858_100040560 3300005842 Bacteria 4318
93 Ga0068858_100059375 3300005842 Unclassified 3535
94 Ga0068858_100088349 3300005842 Bacteria 2884
95 Ga0068860_100026598 3300005843 Bacteria 5577
96 Ga0068860_100425499 3300005843 Archaea 1317
97 Ga0068860_100585784 3300005843 Bacteria 1120
98 Ga0068860_101148237 3300005843 Bacteria 797
99 Ga0068862_100018510 3300005844 Bacteria 5801
100 Ga0068862_101251618 3300005844 Bacteria 742
101 Ga0081455_10052224 3300005937 Bacteria 3501
102 Ga0081455_10520146 3300005937 Bacteria 794
103 Ga0075432_10056635 3300006058 Unclassified 1390
104 Ga0075432_10130413 3300006058 Bacteria 952
105 Ga0097621_100086750 3300006237 Unclassified 2613
106 Ga0068871_100646771 3300006358 Bacteria 965
107 Ga0075428_101689131 3300006844 Unclassified 661
108 Ga0075433_10024986 3300006852 Bacteria 5048
109 Ga0075433_10391943 3300006852 Bacteria 1226
110 Ga0075433_10701677 3300006852 Bacteria 886
111 Ga0075434_100058776 3300006871 Bacteria 3821
112 Ga0075434_100484465 3300006871 Bacteria 1258
113 Ga0075434_101347731 3300006871 Bacteria 724
114 Ga0068865_100041425 3300006881 Bacteria 3134
115 Ga0068865_100827330 3300006881 Bacteria 800
116 Ga0068865_101324531 3300006881 Bacteria 641
117 Ga0075436_100011383 3300006914 Bacteria 6108
118 Ga0075436_100130434 3300006914 Unclassified 1762
119 Ga0075436_100391934 3300006914 Bacteria 1005
120 Ga0097620_100344527 3300006931 Bacteria 1585
121 Ga0097620_101390361 3300006931 Bacteria 774
122 Ga0075435_100011065 3300007076 Bacteria 6618
123 Ga0075435_100087815 3300007076 Bacteria 2562
124 Ga0075435_100161395 3300007076 Bacteria 1888
125 Ga0075435_100166739 3300007076 Bacteria 1857
126 Ga0111539_10004632 3300009094 Bacteria 17960
127 Ga0111539_10099585 3300009094 Bacteria 3413
128 Ga0111539_10419964 3300009094 Bacteria 1558
129 Ga0111539_11297026 3300009094 Bacteria 845
130 Ga0105247_10014933 3300009101 Bacteria 4655
131 Ga0105247_10509836 3300009101 Unclassified 878
132 Ga0114129_10016775 3300009147 Bacteria 10427
133 Ga0114129_10028659 3300009147 Bacteria 7889
134 Ga0114129_10188155 3300009147 Bacteria 2805
135 Ga0114129_10641799 3300009147 Bacteria 1371
136 Ga0105243_10044334 3300009148 Bacteria 3489
137 Ga0105243_10393991 3300009148 Bacteria 1284
138 Ga0105243_10915727 3300009148 Bacteria 873
139 Ga0105241_10089514 3300009174 Bacteria 2425
140 Ga0105248_10003474 3300009177 Bacteria 17498
141 Ga0105248_10007664 3300009177 Bacteria 11862
142 Ga0105248_10063407 3300009177 Bacteria 4149
143 Ga0105248_10289360 3300009177 Bacteria 1845
144 Ga0163162_12361805 3300013306 Bacteria 611
145 Ga0157375_10186557 3300013308 Bacteria 2227
146 Ga0157375_10201844 3300013308 Bacteria 2144
147 Ga0157375_11604213 3300013308 Unclassified 769
148 Ga0163163_10021671 3300014325 Bacteria 6067
149 Ga0157380_10375483 3300014326 Archaea 1340
150 Ga0157380_12408819 3300014326 Unclassified 592
151 Ga0157377_10360557 3300014745 Unclassified 978
152 Ga0157379_10015192 3300014968 Bacteria 6753
153 Ga0157379_10102378 3300014968 Bacteria 2571
154 Ga0157376_10048497 3300014969 Bacteria 3512
155 Ga0182005_1256880 3300015265 Bacteria 542
156 Ga0207710_10014187 3300025900 Bacteria 3357
157 Ga0207710_10359498 3300025900 Unclassified 742
158 Ga0207688_10057285 3300025901 Bacteria 2190
159 Ga0207688_10242626 3300025901 Unclassified 1090
160 Ga0207645_10002829 3300025907 Bacteria 13470
161 Ga0207643_10009120 3300025908 Bacteria 5329
162 Ga0207705_11107821 3300025909 Unclassified 610
163 Ga0207684_10742437 3300025910 Bacteria 832
164 Ga0207684_10975635 3300025910 Unclassified 710
165 Ga0207662_10031711 3300025918 Bacteria 3071
166 Ga0207662_10067549 3300025918 Bacteria 2156
167 Ga0207662_10206314 3300025918 Bacteria 1274
168 Ga0207662_10944955 3300025918 Bacteria 611
169 Ga0207681_10269317 3300025923 Bacteria 1336
170 Ga0207650_10200492 3300025925 Unclassified 1598
171 Ga0207650_10497198 3300025925 Bacteria 1019
172 Ga0207659_10042460 3300025926 Unclassified 3189
173 Ga0207659_10595392 3300025926 Bacteria 942
174 Ga0207659_11631989 3300025926 Unclassified 550
175 Ga0207644_10190730 3300025931 Bacteria 1611
176 Ga0207709_10035526 3300025935 Bacteria 2947
177 Ga0207670_10046789 3300025936 Bacteria 2876
178 Ga0207670_11499647 3300025936 Bacteria 573
179 Ga0207704_10595505 3300025938 Bacteria 904
180 Ga0207691_10001395 3300025940 Bacteria 24180
181 Ga0207691_10141995 3300025940 Bacteria 2116
182 Ga0207691_10148125 3300025940 Bacteria 2065
183 Ga0207691_10731029 3300025940 Bacteria 834
184 Ga0207711_10017296 3300025941 Bacteria 5992
185 Ga0207711_10035532 3300025941 Bacteria 4225
186 Ga0207711_10126755 3300025941 Bacteria 2285
187 Ga0207711_10208548 3300025941 Bacteria 1785
188 Ga0207711_10279328 3300025941 Bacteria 1538
189 Ga0207661_10030613 3300025944 Bacteria 4148
190 Ga0207661_10512040 3300025944 Bacteria 1097
191 Ga0207679_10096400 3300025945 Unclassified 2301
192 Ga0207679_10668538 3300025945 Unclassified 941
193 Ga0207651_10104877 3300025960 Unclassified 2107
194 Ga0207651_10373095 3300025960 Bacteria 1207
195 Ga0207651_10628083 3300025960 Unclassified 941
196 Ga0207651_11057799 3300025960 Bacteria 726
197 Ga0207668_10561573 3300025972 Bacteria 990
198 Ga0207668_11075843 3300025972 Unclassified 720
199 Ga0207640_10013386 3300025981 Bacteria 4699
200 Ga0207640_10020281 3300025981 Bacteria 3945
201 Ga0207640_10065175 3300025981 Bacteria 2430
202 Ga0207658_10065094 3300025986 Unclassified 2737
203 Ga0207658_10226275 3300025986 Bacteria 1576
204 Ga0207703_10010906 3300026035 Bacteria 7083
205 Ga0207703_10015857 3300026035 Bacteria 5878
206 Ga0207703_10541698 3300026035 Bacteria 1097
207 Ga0207703_11530753 3300026035 Bacteria 642
208 Ga0207708_10002607 3300026075 Bacteria 13262
209 Ga0207641_10167140 3300026088 Bacteria 2004
210 Ga0207641_10296069 3300026088 Bacteria 1527
211 Ga0207641_10903063 3300026088 Bacteria 877
212 Ga0207648_10001574 3300026089 Bacteria 25012
213 Ga0207648_11455807 3300026089 Unclassified 644
214 Ga0207676_10050883 3300026095 Unclassified 3232
215 Ga0207676_10501912 3300026095 Bacteria 1152
216 Ga0207676_10521083 3300026095 Unclassified 1132
217 Ga0207675_100001401 3300026118 Bacteria 24104
218 Ga0207683_10138037 3300026121 Unclassified 2195
219 Ga0207683_10526099 3300026121 Unclassified 1093
220 Ga0207698_10749044 3300026142 Bacteria 975
221 Ga0207698_11143376 3300026142 Bacteria 792
222 Ga0207428_10009603 3300027907 Bacteria 8667
223 Ga0207428_10114038 3300027907 Bacteria 2077
224 Ga0268266_10715222 3300028379 Bacteria 966
225 Ga0268265_10005201 3300028380 Bacteria 8915
226 Ga0268265_10916967 3300028380 Bacteria 861
227 Ga0268265_11681203 3300028380 Bacteria 640
228 Ga0268264_10011178 3300028381 Bacteria 7413
229 Ga0268264_10492917 3300028381 Bacteria 1194
230 Ga0265316_10010480 3300031344 Bacteria 8442
231 Ga0307408_101376339 3300031548 Unclassified 664
232 Ga0307411_10890114 3300032005 Bacteria 790
233 Ga0373948_0008455 3300034817 Unclassified 1753
234 Ga0373958_0106345 3300034819 Bacteria 664
235 Ga0373958_0179627 3300034819 Bacteria 544
236 Ga0373959_0001213 3300034820 Unclassified 4166
237 Ga0373938_0007636 3300034957 Unclassified 1908
238 Ga0373928_0010485 3300035084 Unclassified 1821
239 Ga0373929_0000458 3300035085 Bacteria 7760
240 Ga0373940_0001457 3300035088 Unclassified 4284
241 Ga0373949_0005447 3300035090 Unclassified 2837
242 Ga0373949_0090316 3300035090 Unclassified 828
243 Ga0373951_0008168 3300035091 Unclassified 2370
244 Ga0373952_0015253 3300035092 Unclassified 1549
245 Ga0373952_0128225 3300035092 Unclassified 694
246 Ga0373932_0006640 3300035112 Unclassified 2740
247 Ga0373932_0062611 3300035112 Bacteria 1135
248 Ga0373939_0002216 3300035114 Bacteria 4601
249 Ga0373941_0000110 3300035115 Bacteria 13891
250 Ga0373941_0036976 3300035115 Unclassified 1488
251 Ga0373960_0004709 3300035121 Unclassified 3138
252 Ga0373960_0077337 3300035121 Unclassified 1041
253 Ga0373942_0002554 3300035207 Unclassified 4399
254 Ga0373961_0001153 3300035241 Bacteria 8257
255 Ga0373962_0002286 3300035242 Bacteria 4577
256 Ga0373931_0018314 3300035691 Bacteria 3482
257 Ga0373931_0199086 3300035691 Bacteria 1195
258 Ga0451577_0738422 3300042876 Unclassified 891
259 Ga0453684_0424183 3300044712 Bacteria 1485
260 Ga0451576_0132094 3300045051 Unclassified 2603
261 Ga0451576_0175032 3300045051 Unclassified 2240
262 Ga0495639_0252387 3300046475 Unclassified 872
263 Ga0495585_0357379 3300046492 Unclassified 709
264 Ga0495594_0316649 3300046499 Bacteria 889
265 Ga0495621_0356087 3300046539 Unclassified 615
266 Ga0495656_0138835 3300046615 Unclassified 1164
267 Ga0495656_0614373 3300046615 Unclassified 582
268 Ga0495669_0313282 3300046684 Bacteria 757
269 Ga0495613_0545842 3300046689 Unclassified 776
270 Ga0495674_0626544 3300047319 Unclassified 850
271 Ga0496101_1590833 3300048904 Unclassified 508
272 Ga0496102_0485920 3300048905 Bacteria 1156
273 Ga0496102_0999653 3300048905 Unclassified 757
274 Ga0496103_0534692 3300048906 Bacteria 749
275 Ga0496104_0052884 3300048907 Bacteria 3836
276 Ga0496106_0201495 3300048909 Bacteria 1584
277 Ga0496108_0005111 3300048911 Bacteria 10603
278 Ga0496109_2048729 3300048912 Archaea 504
279 Ga0496110_1636407 3300048913 Bacteria 554
280 Ga0496112_0020120 3300048915 Bacteria 6318
281 Ga0496112_1050690 3300048915 Unclassified 733
282 Ga0496113_0060246 3300048916 Bacteria 2861
283 Ga0496113_0071820 3300048916 Bacteria 2633
284 nmdc:mga05p37_124362_c1 3300050507 Bacteria 3168
285 nmdc:mga05p37_206834_c1 3300050507 Bacteria 2374
286 nmdc:mga09592_1263706_c1 3300050508 Bacteria 608
287 nmdc:mga09592_403180_c1 3300050508 Unclassified 1182
288 nmdc:mga08y16_232835_c1 3300050511 Bacteria 1905
289 nmdc:mga08y16_2853_c1 3300050511 Bacteria 17774
290 nmdc:mga08y16_3489_c1 3300050511 Bacteria 16324
291 nmdc:mga08y16_596069_c1 3300050511 Bacteria 1114
292 nmdc:mga0n895_1045755_c1 3300050512 Unclassified 796
293 nmdc:mga0n895_13742_c1 3300050512 Bacteria 7320
294 nmdc:mga0n895_32981_c1 3300050512 Bacteria 4974
295 nmdc:mga0n895_450500_c1 3300050512 Unclassified 1299
296 nmdc:mga0n895_531315_c1 3300050512 Bacteria 1183
297 nmdc:mga0n895_888127_c1 3300050512 Bacteria 877
298 nmdc:mga0rr50_1121952_c1 3300050513 Bacteria 669
299 nmdc:mga0rr50_18469_c1 3300050513 Bacteria 4685
300 nmdc:mga0rr50_20119_c1 3300050513 Unclassified 4523
301 nmdc:mga08x19_121186_c1 3300050514 Bacteria 1754
302 nmdc:mga08x19_161541_c1 3300050514 Bacteria 1522
303 nmdc:mga0a205_113793_c2 3300050515 Bacteria 2167
304 nmdc:mga0a205_9349_c1 3300050515 Bacteria 8956
305 Ga0501048_0852891
306 Ga0065712_10000948
307 Ga0065712_10103172
308 Ga0065715_10099004
309 Ga0070658_10530809
310 Ga0070676_10001436
311 Ga0070690_100146957
312 Ga0070670_100170848
313 Ga0070677_10117097
314 Ga0068869_100452944
315 Ga0070666_10228867
316 Ga0070680_100429003
317 Ga0070689_100182048
318 Ga0070689_100217655
319 Ga0070691_10000554
320 Ga0070687_100021459
321 Ga0070661_100361161
322 Ga0070661_100514620
323 Ga0070668_100826809
324 Ga0070669_100011077
325 Ga0070669_100022090
326 Ga0070675_100528412
327 Ga0070675_102009804
328 Ga0070671_100023406
329 Ga0070671_100077172
330 Ga0070674_100062433
331 Ga0070674_100659814
332 Ga0070673_100109162
333 Ga0070673_100436651
334 Ga0070673_101490039
335 Ga0070688_100155758
336 Ga0070667_100005780
337 Ga0070667_100345999
338 Ga0070703_10057334
339 Ga0070709_10031668
340 Ga0070709_10521561
341 Ga0070701_10056171
342 Ga0070705_100023110
343 Ga0070705_100332759
344 Ga0070700_100026871
345 Ga0070694_100051289
346 Ga0070694_100109648
347 Ga0070708_100520763
348 Ga0070678_100114389
349 Ga0068867_100007398
350 Ga0068867_102025084
351 Ga0070685_10269432
352 Ga0070706_101419779
353 Ga0070707_100379784
354 Ga0070699_100017870
355 Ga0070699_100223285
356 Ga0070679_100803077
357 Ga0070684_100260026
358 Ga0070697_100192404
359 Ga0070697_100319570
360 Ga0070697_100835547
361 Ga0068853_100424879
362 Ga0070672_100004283
363 Ga0070672_100088757
364 Ga0070672_100127911
365 Ga0070672_100798680
366 Ga0070686_100019979
367 Ga0070686_100483325
368 Ga0070695_100001237
369 Ga0070695_100576684
370 Ga0070695_101388777
371 Ga0070696_100007978
372 Ga0070693_100450003
373 Ga0070665_101048507
374 Ga0070665_101608940
375 Ga0070704_100001748
376 Ga0070704_101629909
377 Ga0070704_101644676
378 Ga0068855_100283471
379 Ga0070664_100828161
380 Ga0068854_100021372
381 Ga0068854_100021702
382 Ga0070702_100001780
383 Ga0068852_100449042
384 Ga0068852_100589804
385 Ga0068852_101264976
386 Ga0068859_100344538
387 Ga0068859_101390812
388 Ga0068864_100058886
389 Ga0068864_100798651
390 Ga0068861_100002888
391 Ga0068861_101071841
392 Ga0068863_100089970
393 Ga0068863_100261274
394 Ga0068863_100327962
395 Ga0068863_100951141
396 Ga0068858_100040560
397 Ga0068858_100059375
398 Ga0068858_100088349
399 Ga0068860_100026598
400 Ga0068860_100425499
401 Ga0068860_100585784
402 Ga0068860_101148237
403 Ga0068862_100018510
404 Ga0068862_101251618
405 Ga0081455_10052224
406 Ga0081455_10520146
407 Ga0075432_10056635
408 Ga0075432_10130413
409 Ga0097621_100086750
410 Ga0068871_100646771
411 Ga0075428_101689131
412 Ga0075433_10024986
413 Ga0075433_10391943
414 Ga0075433_10701677
415 Ga0075434_100058776
416 Ga0075434_100484465
417 Ga0075434_101347731
418 Ga0068865_100041425
419 Ga0068865_100827330
420 Ga0068865_101324531
421 Ga0075436_100011383
422 Ga0075436_100130434
423 Ga0075436_100391934
424 Ga0097620_100344527
425 Ga0097620_101390361
426 Ga0075435_100011065
427 Ga0075435_100087815
428 Ga0075435_100161395
429 Ga0075435_100166739
430 Ga0111539_10004632
431 Ga0111539_10099585
432 Ga0111539_10419964
433 Ga0111539_11297026
434 Ga0105247_10014933
435 Ga0105247_10509836
436 Ga0114129_10016775
437 Ga0114129_10028659
438 Ga0114129_10188155
439 Ga0114129_10641799
440 Ga0105243_10044334
441 Ga0105243_10393991
442 Ga0105243_10915727
443 Ga0105241_10089514
444 Ga0105248_10003474
445 Ga0105248_10007664
446 Ga0105248_10063407
447 Ga0105248_10289360
448 Ga0163162_12361805
449 Ga0157375_10186557
450 Ga0157375_10201844
451 Ga0157375_11604213
452 Ga0163163_10021671
453 Ga0157380_10375483
454 Ga0157380_12408819
455 Ga0157377_10360557
456 Ga0157379_10015192
457 Ga0157379_10102378
458 Ga0157376_10048497
459 Ga0182005_1256880
460 Ga0207710_10014187
461 Ga0207710_10359498
462 Ga0207688_10057285
463 Ga0207688_10242626
464 Ga0207645_10002829
465 Ga0207643_10009120
466 Ga0207705_11107821
467 Ga0207684_10742437
468 Ga0207684_10975635
469 Ga0207662_10031711
470 Ga0207662_10067549
471 Ga0207662_10206314
472 Ga0207662_10944955
473 Ga0207681_10269317
474 Ga0207650_10200492
475 Ga0207650_10497198
476 Ga0207659_10042460
477 Ga0207659_10595392
478 Ga0207659_11631989
479 Ga0207644_10190730
480 Ga0207709_10035526
481 Ga0207670_10046789
482 Ga0207670_11499647
483 Ga0207704_10595505
484 Ga0207691_10001395
485 Ga0207691_10141995
486 Ga0207691_10148125
487 Ga0207691_10731029
488 Ga0207711_10017296
489 Ga0207711_10035532
490 Ga0207711_10126755
491 Ga0207711_10208548
492 Ga0207711_10279328
493 Ga0207661_10030613
494 Ga0207661_10512040
495 Ga0207679_10096400
496 Ga0207679_10668538
497 Ga0207651_10104877
498 Ga0207651_10373095
499 Ga0207651_10628083
500 Ga0207651_11057799
501 Ga0207668_10561573
502 Ga0207668_11075843
503 Ga0207640_10013386
504 Ga0207640_10020281
505 Ga0207640_10065175
506 Ga0207658_10065094
507 Ga0207658_10226275
508 Ga0207703_10010906
509 Ga0207703_10015857
510 Ga0207703_10541698
511 Ga0207703_11530753
512 Ga0207708_10002607
513 Ga0207641_10167140
514 Ga0207641_10296069
515 Ga0207641_10903063
516 Ga0207648_10001574
517 Ga0207648_11455807
518 Ga0207676_10050883
519 Ga0207676_10501912
520 Ga0207676_10521083
521 Ga0207675_100001401
522 Ga0207683_10138037
523 Ga0207683_10526099
524 Ga0207698_10749044
525 Ga0207698_11143376
526 Ga0207428_10009603
527 Ga0207428_10114038
528 Ga0268266_10715222
529 Ga0268265_10005201
530 Ga0268265_10916967
531 Ga0268265_11681203
532 Ga0268264_10011178
533 Ga0268264_10492917
534 Ga0265316_10010480
535 Ga0307408_101376339
536 Ga0307411_10890114
537 Ga0373948_0008455
538 Ga0373958_0106345
539 Ga0373958_0179627
540 Ga0373959_0001213
541 Ga0373938_0007636
542 Ga0373928_0010485
543 Ga0373929_0000458
544 Ga0373940_0001457
545 Ga0373949_0005447
546 Ga0373949_0090316
547 Ga0373951_0008168
548 Ga0373952_0015253
549 Ga0373952_0128225
550 Ga0373932_0006640
551 Ga0373932_0062611
552 Ga0373939_0002216
553 Ga0373941_0000110
554 Ga0373941_0036976
555 Ga0373960_0004709
556 Ga0373960_0077337
557 Ga0373942_0002554
558 Ga0373961_0001153
559 Ga0373962_0002286
560 Ga0373931_0018314
561 Ga0373931_0199086
562 Ga0451577_0738422
563 Ga0453684_0424183
564 Ga0451576_0132094
565 Ga0451576_0175032
566 Ga0495639_0252387
567 Ga0495585_0357379
568 Ga0495594_0316649
569 Ga0495621_0356087
570 Ga0495656_0138835
571 Ga0495656_0614373
572 Ga0495669_0313282
573 Ga0495613_0545842
574 Ga0495674_0626544
575 Ga0496101_1590833
576 Ga0496102_0485920
577 Ga0496102_0999653
578 Ga0496103_0534692
579 Ga0496104_0052884
580 Ga0496106_0201495
581 Ga0496108_0005111
582 Ga0496109_2048729
583 Ga0496110_1636407
584 Ga0496112_0020120
585 Ga0496112_1050690
586 Ga0496113_0060246
587 Ga0496113_0071820
588 nmdc:mga05p37_124362_c1
589 nmdc:mga05p37_206834_c1
590 nmdc:mga09592_1263706_c1
591 nmdc:mga09592_403180_c1
592 nmdc:mga08y16_232835_c1
593 nmdc:mga08y16_2853_c1
594 nmdc:mga08y16_3489_c1
595 nmdc:mga08y16_596069_c1
596 nmdc:mga0n895_1045755_c1
597 nmdc:mga0n895_13742_c1
598 nmdc:mga0n895_32981_c1
599 nmdc:mga0n895_450500_c1
600 nmdc:mga0n895_531315_c1
601 nmdc:mga0n895_888127_c1
602 nmdc:mga0rr50_1121952_c1
603 nmdc:mga0rr50_18469_c1
604 nmdc:mga0rr50_20119_c1
605 nmdc:mga08x19_121186_c1
606 nmdc:mga08x19_161541_c1
607 nmdc:mga0a205_113793_c2
608 nmdc:mga0a205_9349_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03652

RuvX

Holliday junction resolvase

9

150

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8775 1 143
1nmn-assembly1.cif.gz_A structure of yqgf from escherichia coli, a hypothetical protein 0.8708 1 143
1nu0-assembly1.cif.gz_A structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.8528 2 143
1nu0-assembly1.cif.gz_A structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein 0.8347 2 143
7w89-assembly1.cif.gz_A the structure of deinococcus radiodurans yqgf 0.8305 1 140
ID Description Score Start End Superfamily
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8912 2 142 3.30.420.140
af_F4IC62_83_217_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8517 5 141 3.30.420.140
af_P9WGV7_22_163_3.30.420.140 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8502 2 142 3.30.420.140
4mcaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8483 38 100 3.40.50.1970
1nu0A00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;YqgF/RNase H-like domain 0.8442 1 142 3.30.420.140
ID Description Score Start End GO Terms
AF-A0A1F8V5R4-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9536 3 141 GO:0000967
GO:0004518
GO:0005829
AF-A0A2V8E556-F1-model_v4 Holliday junction resolvase RuvX 0.9489 2 140 GO:0000967
GO:0004518
GO:0005829
AF-A0A3D5ZRW7-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.944 1 140 GO:0000967
GO:0004518
GO:0005829
AF-A0A2V8J030-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9432 2 143 GO:0000967
GO:0004518
GO:0005829
AF-A0A2V8F9Q6-F1-model_v4 Putative pre-16S rRNA nuclease (EC 3.1.-.-) 0.9421 2 140 GO:0000967
GO:0004518
GO:0005829

Map