F397772

General Info

Members Datasets Scaffolds Average Seq Length
304 155 608 177

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0166694|Ga0496103_0166694_111_719
Length 202
Sequence MTLNKDCIQSVSSVVISGKVFRSVWEKRLPAEAPAHENRWATTIASLVVGALFFALWFWLLPQWLGFRAEMPADAPRRWLAAIPSVLGFAVALRCIWDFGWTGRGTPAPIAPPQRLVVVGFYRYVRNPMYVGFATGWVGLWIVFGRATREAIIGVVTAALAVHLFVAFYEEPTLKRKFGADYEEYCRNVRRWLPRVSAWKRQ

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.91
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 32.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0166694 3300048906 Bacteria 1413
2 Ga0070658_10215364 3300005327 Bacteria 1623
3 Ga0070683_100034758 3300005329 Bacteria 4606
4 Ga0070670_100067449 3300005331 Unclassified 3070
5 Ga0070670_100314231 3300005331 Bacteria 1372
6 Ga0070682_101037456 3300005337 Unclassified 683
7 Ga0070660_100345570 3300005339 Bacteria 1225
8 Ga0070661_100234741 3300005344 Bacteria 1410
9 Ga0070675_100680855 3300005354 Unclassified 936
10 Ga0070671_100329239 3300005355 Bacteria 1302
11 Ga0070659_100432176 3300005366 Bacteria 1114
12 Ga0070667_100187083 3300005367 Bacteria 1833
13 Ga0070709_10052687 3300005434 Unclassified 2559
14 Ga0070709_10065833 3300005434 Bacteria 2322
15 Ga0070714_100061534 3300005435 Bacteria 3225
16 Ga0070714_100095136 3300005435 Unclassified 2615
17 Ga0070714_100097649 3300005435 Bacteria 2583
18 Ga0070714_100248139 3300005435 Bacteria 1645
19 Ga0070714_101827569 3300005435 Unclassified 593
20 Ga0070713_100045042 3300005436 Unclassified 3613
21 Ga0070713_100051915 3300005436 Bacteria 3393
22 Ga0070713_100084310 3300005436 Bacteria 2719
23 Ga0070713_100152095 3300005436 Bacteria 2059
24 Ga0070713_100301990 3300005436 Bacteria 1474
25 Ga0070713_100706246 3300005436 Bacteria 963
26 Ga0070710_10127321 3300005437 Unclassified 1549
27 Ga0070710_10310988 3300005437 Bacteria 1031
28 Ga0070711_100006588 3300005439 Bacteria 7013
29 Ga0070711_100016537 3300005439 Bacteria 4685
30 Ga0070711_100264167 3300005439 Unclassified 1355
31 Ga0070708_100004898 3300005445 Bacteria 10574
32 Ga0070708_100019996 3300005445 Bacteria 5638
33 Ga0070708_100024402 3300005445 Bacteria 5159
34 Ga0070708_100093836 3300005445 Bacteria 2737
35 Ga0070708_100153714 3300005445 Bacteria 2141
36 Ga0070708_100165928 3300005445 Unclassified 2060
37 Ga0070708_100276657 3300005445 Unclassified 1579
38 Ga0070708_100509388 3300005445 Unclassified 1135
39 Ga0070662_100141385 3300005457 Bacteria 1866
40 Ga0070681_10224687 3300005458 Bacteria 1792
41 Ga0070706_100004226 3300005467 Bacteria 13937
42 Ga0070706_100006218 3300005467 Bacteria 11290
43 Ga0070706_100014783 3300005467 Bacteria 7212
44 Ga0070706_100304020 3300005467 Bacteria 1488
45 Ga0070706_100660797 3300005467 Unclassified 970
46 Ga0070707_100011043 3300005468 Bacteria 8411
47 Ga0070707_100017488 3300005468 Bacteria 6741
48 Ga0070707_100115736 3300005468 Plasmid 2602
49 Ga0070707_100180799 3300005468 Unclassified 2056
50 Ga0070707_100206106 3300005468 Unclassified 1916
51 Ga0070707_101120336 3300005468 Unclassified 753
52 Ga0070698_100006742 3300005471 Bacteria 12452
53 Ga0070698_100020904 3300005471 Bacteria 6858
54 Ga0070698_100812717 3300005471 Bacteria 879
55 Ga0070698_101092387 3300005471 Unclassified 746
56 Ga0070699_100000107 3300005518 Bacteria 78143
57 Ga0070699_100007325 3300005518 Bacteria 9604
58 Ga0070699_100112394 3300005518 Bacteria 2392
59 Ga0070679_100150806 3300005530 Bacteria 2301
60 Ga0070684_100531191 3300005535 Unclassified 1091
61 Ga0070697_100000224 3300005536 Bacteria 46645
62 Ga0070697_100013736 3300005536 Bacteria 6352
63 Ga0070697_100034418 3300005536 Unclassified 4084
64 Ga0070697_100068564 3300005536 Bacteria 2904
65 Ga0070697_100191417 3300005536 Unclassified 1736
66 Ga0070697_100635171 3300005536 Unclassified 940
67 Ga0070697_100945869 3300005536 Bacteria 765
68 Ga0070696_100061819 3300005546 Unclassified 2620
69 Ga0070693_100027790 3300005547 Bacteria 3070
70 Ga0070665_100012350 3300005548 Bacteria 8607
71 Ga0070665_100502631 3300005548 Unclassified 1223
72 Ga0068855_100078771 3300005563 Bacteria 3822
73 Ga0068855_101023765 3300005563 Bacteria 866
74 Ga0068855_101180444 3300005563 Unclassified 797
75 Ga0068857_100258263 3300005577 Unclassified 1598
76 Ga0068856_100120582 3300005614 Bacteria 2624
77 Ga0068852_100479232 3300005616 Bacteria 1236
78 Ga0068864_100135555 3300005618 Bacteria 2216
79 Ga0068851_10125293 3300005834 Unclassified 1384
80 Ga0068863_100025777 3300005841 Bacteria 5608
81 Ga0068863_100051287 3300005841 Bacteria 3911
82 Ga0068863_100961753 3300005841 Unclassified 856
83 Ga0068860_100412367 3300005843 Unclassified 1338
84 Ga0068860_100766218 3300005843 Unclassified 977
85 Ga0081540_1014142 3300005983 Bacteria 5135
86 Ga0070717_10003659 3300006028 Bacteria 11035
87 Ga0070717_10013158 3300006028 Bacteria 6326
88 Ga0070717_10054365 3300006028 Unclassified 3302
89 Ga0070717_10136000 3300006028 Unclassified 2116
90 Ga0070717_10262363 3300006028 Bacteria 1528
91 Ga0070717_10463052 3300006028 Bacteria 1144
92 Ga0070717_10719579 3300006028 Bacteria 907
93 Ga0070715_10327181 3300006163 Unclassified 829
94 Ga0070716_100000797 3300006173 Bacteria 13518
95 Ga0070716_100028494 3300006173 Bacteria 3009
96 Ga0070716_100087436 3300006173 Bacteria 1878
97 Ga0070716_100236488 3300006173 Bacteria 1236
98 Ga0070716_100938467 3300006173 Unclassified 680
99 Ga0070712_100000854 3300006175 Bacteria 18137
100 Ga0070712_100007225 3300006175 Bacteria 6929
101 Ga0070712_100015362 3300006175 Bacteria 4929
102 Ga0070712_100099874 3300006175 Bacteria 2143
103 Ga0070712_100292817 3300006175 Bacteria 1315
104 Ga0075433_10015644 3300006852 Bacteria 6231
105 Ga0075434_100006260 3300006871 Bacteria 10901
106 Ga0075434_100096932 3300006871 Unclassified 2954
107 Ga0075434_100147278 3300006871 Bacteria 2375
108 Ga0075434_101304984 3300006871 Unclassified 737
109 Ga0075436_100002289 3300006914 Archaea 13211
110 Ga0075435_100104766 3300007076 Bacteria 2347
111 Ga0075435_100280152 3300007076 Bacteria 1423
112 Ga0075435_100285173 3300007076 Unclassified 1410
113 Ga0075435_100488327 3300007076 Bacteria 1064
114 Ga0075435_100718081 3300007076 Unclassified 869
115 Ga0099794_10101092 3300007265 Unclassified 1439
116 Ga0105240_10902746 3300009093 Bacteria 950
117 Ga0105241_10028102 3300009174 Unclassified 4189
118 Ga0105241_10111569 3300009174 Bacteria 2190
119 Ga0105241_10364521 3300009174 Unclassified 1258
120 Ga0105248_10098324 3300009177 Bacteria 3297
121 Ga0105248_11559871 3300009177 Unclassified 748
122 Ga0105238_10097003 3300009551 Bacteria 2934
123 Ga0105249_12494909 3300009553 Unclassified 589
124 Ga0105239_10016729 3300010375 Bacteria 8106
125 Ga0105239_10312209 3300010375 Unclassified 1772
126 Ga0157373_10105484 3300013100 Unclassified 1982
127 Ga0157373_10210738 3300013100 Unclassified 1370
128 Ga0157369_10129231 3300013105 Bacteria 2678
129 Ga0157374_10022690 3300013296 Bacteria 5602
130 Ga0157374_10055059 3300013296 Bacteria 3711
131 Ga0157374_10073854 3300013296 Bacteria 3219
132 Ga0157378_10388722 3300013297 Bacteria 1372
133 Ga0157378_10696537 3300013297 Bacteria 1035
134 Ga0163162_10120022 3300013306 Bacteria 2732
135 Ga0163162_10197849 3300013306 Unclassified 2138
136 Ga0157372_10206804 3300013307 Bacteria 2274
137 Ga0157372_10253355 3300013307 Bacteria 2044
138 Ga0163163_10004230 3300014325 Bacteria 12234
139 Ga0163163_10049344 3300014325 Bacteria 4142
140 Ga0163163_10128549 3300014325 Bacteria 2572
141 Ga0182008_10037825 3300014497 Bacteria 2414
142 Ga0157376_10136263 3300014969 Bacteria 2197
143 Ga0182007_10081891 3300015262 Bacteria 1059
144 Ga0213873_10015945 3300021358 Bacteria 1692
145 Ga0213874_10063840 3300021377 Bacteria 1160
146 Ga0228598_1032930 3300024227 Bacteria 1021
147 Ga0207656_10069391 3300025321 Bacteria 1563
148 Ga0207692_10010196 3300025898 Unclassified 3952
149 Ga0207685_10034935 3300025905 Unclassified 1830
150 Ga0207685_10279009 3300025905 Unclassified 819
151 Ga0207685_10379663 3300025905 Unclassified 720
152 Ga0207699_10006186 3300025906 Bacteria 5774
153 Ga0207699_10026207 3300025906 Bacteria 3210
154 Ga0207699_10068492 3300025906 Unclassified 2161
155 Ga0207699_10077154 3300025906 Bacteria 2055
156 Ga0207684_10000301 3300025910 Bacteria 70279
157 Ga0207684_10001345 3300025910 Bacteria 26945
158 Ga0207684_10031337 3300025910 Bacteria 4523
159 Ga0207684_10130837 3300025910 Unclassified 2154
160 Ga0207684_10495078 3300025910 Unclassified 1048
161 Ga0207684_11021478 3300025910 Unclassified 691
162 Ga0207654_10024557 3300025911 Unclassified 3243
163 Ga0207654_10786186 3300025911 Bacteria 687
164 Ga0207707_10042134 3300025912 Bacteria 3986
165 Ga0207693_10000934 3300025915 Bacteria 26273
166 Ga0207693_10002119 3300025915 Bacteria 17311
167 Ga0207693_10012376 3300025915 Bacteria 6891
168 Ga0207693_10056275 3300025915 Bacteria 3084
169 Ga0207693_10108422 3300025915 Bacteria 2178
170 Ga0207693_10111315 3300025915 Bacteria 2147
171 Ga0207663_10029945 3300025916 Plasmid 3204
172 Ga0207663_10729786 3300025916 Unclassified 786
173 Ga0207652_10329639 3300025921 Bacteria 1378
174 Ga0207646_10022089 3300025922 Bacteria 5869
175 Ga0207646_10535831 3300025922 Bacteria 1053
176 Ga0207646_11155459 3300025922 Unclassified 680
177 Ga0207681_10422193 3300025923 Unclassified 1081
178 Ga0207650_10294811 3300025925 Bacteria 1323
179 Ga0207659_10861540 3300025926 Unclassified 779
180 Ga0207700_10093246 3300025928 Bacteria 2382
181 Ga0207700_10177520 3300025928 Bacteria 1781
182 Ga0207700_10331544 3300025928 Unclassified 1321
183 Ga0207700_10451975 3300025928 Bacteria 1132
184 Ga0207700_10509067 3300025928 Bacteria 1066
185 Ga0207700_10599912 3300025928 Bacteria 980
186 Ga0207664_10120857 3300025929 Unclassified 2192
187 Ga0207706_10016916 3300025933 Bacteria 6578
188 Ga0207665_10001139 3300025939 Bacteria 17877
189 Ga0207665_10016036 3300025939 Plasmid 4920
190 Ga0207665_10178878 3300025939 Bacteria 1535
191 Ga0207665_10194087 3300025939 Bacteria 1477
192 Ga0207665_10224976 3300025939 Bacteria 1377
193 Ga0207665_11070009 3300025939 Unclassified 643
194 Ga0207689_10387997 3300025942 Unclassified 1163
195 Ga0207667_10140694 3300025949 Bacteria 2485
196 Ga0207667_10164678 3300025949 Unclassified 2280
197 Ga0207667_10634401 3300025949 Bacteria 1075
198 Ga0207667_10936426 3300025949 Unclassified 856
199 Ga0207712_10127582 3300025961 Unclassified 1934
200 Ga0207658_10136173 3300025986 Bacteria 1981
201 Ga0207677_10591974 3300026023 Unclassified 972
202 Ga0207678_10408694 3300026067 Bacteria 1176
203 Ga0207702_10384341 3300026078 Unclassified 1351
204 Ga0207641_10201388 3300026088 Unclassified 1836
205 Ga0207641_11213435 3300026088 Unclassified 754
206 Ga0207676_10092187 3300026095 Bacteria 2491
207 Ga0207674_10331365 3300026116 Bacteria 1472
208 Ga0207674_10355716 3300026116 Bacteria 1416
209 Ga0207698_10031542 3300026142 Bacteria 3827
210 Ga0265338_10144819 3300028800 Unclassified 1855
211 Ga0265338_10179350 3300028800 Bacteria 1616
212 Ga0265338_10280248 3300028800 Unclassified 1218
213 Ga0265338_10378940 3300028800 Bacteria 1012
214 Ga0265762_1001313 3300030760 Bacteria 4522
215 Ga0265760_10040672 3300031090 Bacteria 1385
216 Ga0265325_10010504 3300031241 Bacteria 5357
217 Ga0265325_10186935 3300031241 Bacteria 962
218 Ga0265340_10090261 3300031247 Bacteria 1433
219 Ga0265340_10161537 3300031247 Unclassified 1018
220 Ga0265339_10005718 3300031249 Bacteria 8252
221 Ga0265339_10055442 3300031249 Unclassified 2150
222 Ga0265339_10069486 3300031249 Bacteria 1880
223 Ga0265316_10298845 3300031344 Bacteria 1173
224 Ga0265316_10306768 3300031344 Unclassified 1155
225 Ga0265314_10128360 3300031711 Bacteria 1585
226 Ga0265342_10108813 3300031712 Bacteria 1571
227 Ga0373934_0062093 3300035086 Bacteria 1489
228 Ga0373960_0062047 3300035121 Bacteria 1137
229 Ga0373955_0317109 3300035172 Bacteria 941
230 Ga0373927_0045571 3300035695 Bacteria 2836
231 Ga0373927_0188345 3300035695 Bacteria 1354
232 Ga0373937_0130921 3300036401 Bacteria 2343
233 Ga0436364_0887456 3300037853 Bacteria 1500
234 Ga0436361_0226398 3300039447 Bacteria 2413
235 Ga0436361_0634719 3300039447 Bacteria 33284
236 Ga0436363_0758363 3300039450 Bacteria 1935
237 Ga0436363_1387711 3300039450 Bacteria 1347
238 Ga0436362_0572844 3300039453 Bacteria 5559
239 Ga0466966_0426723 3300044684 Unclassified 797
240 Ga0466959_0159791 3300045049 Bacteria 1585
241 Ga0451576_0513627 3300045051 Bacteria 1259
242 Ga0451576_1512673 3300045051 Unclassified 697
243 Ga0466967_0493250 3300045976 Bacteria 1201
244 Ga0495603_0171438 3300046455 Bacteria 1257
245 Ga0495651_0080090 3300046462 Bacteria 2468
246 Ga0495653_0144668 3300046463 Bacteria 1668
247 Ga0495580_0001097 3300046472 Bacteria 23738
248 Ga0495580_0005524 3300046472 Bacteria 10438
249 Ga0495580_0020839 3300046472 Bacteria 4845
250 Ga0495580_0158354 3300046472 Bacteria 1568
251 Ga0495580_0186921 3300046472 Bacteria 1430
252 Ga0495580_0194233 3300046472 Bacteria 1399
253 Ga0495580_0301313 3300046472 Unclassified 1091
254 Ga0495582_0022213 3300046473 Bacteria 3472
255 Ga0495582_0422687 3300046473 Unclassified 769
256 Ga0495662_0076454 3300046476 Unclassified 1626
257 Ga0495594_0078387 3300046499 Bacteria 1844
258 Ga0495630_0338959 3300046517 Unclassified 1150
259 Ga0495665_0017152 3300046531 Bacteria 3896
260 Ga0495645_0048631 3300046543 Bacteria 3088
261 Ga0495645_0636338 3300046543 Unclassified 653
262 Ga0495667_0060780 3300046559 Bacteria 2478
263 Ga0495668_0397117 3300046616 Unclassified 758
264 Ga0495635_0070453 3300046663 Bacteria 2397
265 Ga0495635_0270897 3300046663 Bacteria 1142
266 Ga0495659_0006329 3300046664 Bacteria 3741
267 Ga0495669_0003185 3300046684 Bacteria 6757
268 Ga0495624_0147112 3300046690 Bacteria 1442
269 Ga0495600_0229278 3300046809 Unclassified 1186
270 Ga0495675_0075469 3300047444 Unclassified 2125
271 Ga0495684_0471330 3300047471 Unclassified 869
272 Ga0495602_0507639 3300048088 Unclassified 842
273 Ga0496102_0177057 3300048905 Unclassified 2009
274 Ga0496102_0461723 3300048905 Unclassified 1191
275 Ga0496104_0041476 3300048907 Bacteria 4316
276 Ga0496104_0119528 3300048907 Unclassified 2530
277 Ga0496105_0337180 3300048908 Unclassified 1206
278 Ga0496105_0774464 3300048908 Unclassified 731
279 Ga0496107_0258706 3300048910 Bacteria 1295
280 Ga0496108_0035814 3300048911 Bacteria 4127
281 Ga0496109_0041374 3300048912 Bacteria 4174
282 Ga0496109_0271544 3300048912 Bacteria 1598
283 Ga0496110_0143512 3300048913 Bacteria 2159
284 Ga0496110_0158173 3300048913 Bacteria 2053
285 Ga0496111_0013007 3300048914 Bacteria 5650
286 Ga0496111_0170542 3300048914 Unclassified 1617
287 Ga0496112_0047498 3300048915 Unclassified 4211
288 Ga0496112_1297972 3300048915 Bacteria 643
289 Ga0496113_0088491 3300048916 Bacteria 2382
290 Ga0496113_0340312 3300048916 Unclassified 1203
291 Ga0496115_0098809 3300048918 Bacteria 2391
292 Ga0496115_0357045 3300048918 Bacteria 1191
293 Ga0496119_0065057 3300048922 Bacteria 2162
294 nmdc:mga0n895_1130207_c1 3300050512 Unclassified 760
295 nmdc:mga0n895_309759_c1 3300050512 Bacteria 1600
296 nmdc:mga0n895_6864_c1 3300050512 Bacteria 9722
297 nmdc:mga0rr50_34063_c1 3300050513 Bacteria 3644
298 nmdc:mga0rr50_390762_c1 3300050513 Bacteria 1174
299 nmdc:mga0rr50_635204_c1 3300050513 Unclassified 911
300 nmdc:mga08x19_685_c1 3300050514 Bacteria 21761
301 nmdc:mga0a205_20322_c1 3300050515 Bacteria 6263
302 Ga0495601_0167603 3300053077 Unclassified 1435
303 Ga0495619_0109215 3300053085 Bacteria 1889
304 Ga0495619_0746424 3300053085 Unclassified 664
305 Ga0496103_0166694
306 Ga0070658_10215364
307 Ga0070683_100034758
308 Ga0070670_100067449
309 Ga0070670_100314231
310 Ga0070682_101037456
311 Ga0070660_100345570
312 Ga0070661_100234741
313 Ga0070675_100680855
314 Ga0070671_100329239
315 Ga0070659_100432176
316 Ga0070667_100187083
317 Ga0070709_10052687
318 Ga0070709_10065833
319 Ga0070714_100061534
320 Ga0070714_100095136
321 Ga0070714_100097649
322 Ga0070714_100248139
323 Ga0070714_101827569
324 Ga0070713_100045042
325 Ga0070713_100051915
326 Ga0070713_100084310
327 Ga0070713_100152095
328 Ga0070713_100301990
329 Ga0070713_100706246
330 Ga0070710_10127321
331 Ga0070710_10310988
332 Ga0070711_100006588
333 Ga0070711_100016537
334 Ga0070711_100264167
335 Ga0070708_100004898
336 Ga0070708_100019996
337 Ga0070708_100024402
338 Ga0070708_100093836
339 Ga0070708_100153714
340 Ga0070708_100165928
341 Ga0070708_100276657
342 Ga0070708_100509388
343 Ga0070662_100141385
344 Ga0070681_10224687
345 Ga0070706_100004226
346 Ga0070706_100006218
347 Ga0070706_100014783
348 Ga0070706_100304020
349 Ga0070706_100660797
350 Ga0070707_100011043
351 Ga0070707_100017488
352 Ga0070707_100115736
353 Ga0070707_100180799
354 Ga0070707_100206106
355 Ga0070707_101120336
356 Ga0070698_100006742
357 Ga0070698_100020904
358 Ga0070698_100812717
359 Ga0070698_101092387
360 Ga0070699_100000107
361 Ga0070699_100007325
362 Ga0070699_100112394
363 Ga0070679_100150806
364 Ga0070684_100531191
365 Ga0070697_100000224
366 Ga0070697_100013736
367 Ga0070697_100034418
368 Ga0070697_100068564
369 Ga0070697_100191417
370 Ga0070697_100635171
371 Ga0070697_100945869
372 Ga0070696_100061819
373 Ga0070693_100027790
374 Ga0070665_100012350
375 Ga0070665_100502631
376 Ga0068855_100078771
377 Ga0068855_101023765
378 Ga0068855_101180444
379 Ga0068857_100258263
380 Ga0068856_100120582
381 Ga0068852_100479232
382 Ga0068864_100135555
383 Ga0068851_10125293
384 Ga0068863_100025777
385 Ga0068863_100051287
386 Ga0068863_100961753
387 Ga0068860_100412367
388 Ga0068860_100766218
389 Ga0081540_1014142
390 Ga0070717_10003659
391 Ga0070717_10013158
392 Ga0070717_10054365
393 Ga0070717_10136000
394 Ga0070717_10262363
395 Ga0070717_10463052
396 Ga0070717_10719579
397 Ga0070715_10327181
398 Ga0070716_100000797
399 Ga0070716_100028494
400 Ga0070716_100087436
401 Ga0070716_100236488
402 Ga0070716_100938467
403 Ga0070712_100000854
404 Ga0070712_100007225
405 Ga0070712_100015362
406 Ga0070712_100099874
407 Ga0070712_100292817
408 Ga0075433_10015644
409 Ga0075434_100006260
410 Ga0075434_100096932
411 Ga0075434_100147278
412 Ga0075434_101304984
413 Ga0075436_100002289
414 Ga0075435_100104766
415 Ga0075435_100280152
416 Ga0075435_100285173
417 Ga0075435_100488327
418 Ga0075435_100718081
419 Ga0099794_10101092
420 Ga0105240_10902746
421 Ga0105241_10028102
422 Ga0105241_10111569
423 Ga0105241_10364521
424 Ga0105248_10098324
425 Ga0105248_11559871
426 Ga0105238_10097003
427 Ga0105249_12494909
428 Ga0105239_10016729
429 Ga0105239_10312209
430 Ga0157373_10105484
431 Ga0157373_10210738
432 Ga0157369_10129231
433 Ga0157374_10022690
434 Ga0157374_10055059
435 Ga0157374_10073854
436 Ga0157378_10388722
437 Ga0157378_10696537
438 Ga0163162_10120022
439 Ga0163162_10197849
440 Ga0157372_10206804
441 Ga0157372_10253355
442 Ga0163163_10004230
443 Ga0163163_10049344
444 Ga0163163_10128549
445 Ga0182008_10037825
446 Ga0157376_10136263
447 Ga0182007_10081891
448 Ga0213873_10015945
449 Ga0213874_10063840
450 Ga0228598_1032930
451 Ga0207656_10069391
452 Ga0207692_10010196
453 Ga0207685_10034935
454 Ga0207685_10279009
455 Ga0207685_10379663
456 Ga0207699_10006186
457 Ga0207699_10026207
458 Ga0207699_10068492
459 Ga0207699_10077154
460 Ga0207684_10000301
461 Ga0207684_10001345
462 Ga0207684_10031337
463 Ga0207684_10130837
464 Ga0207684_10495078
465 Ga0207684_11021478
466 Ga0207654_10024557
467 Ga0207654_10786186
468 Ga0207707_10042134
469 Ga0207693_10000934
470 Ga0207693_10002119
471 Ga0207693_10012376
472 Ga0207693_10056275
473 Ga0207693_10108422
474 Ga0207693_10111315
475 Ga0207663_10029945
476 Ga0207663_10729786
477 Ga0207652_10329639
478 Ga0207646_10022089
479 Ga0207646_10535831
480 Ga0207646_11155459
481 Ga0207681_10422193
482 Ga0207650_10294811
483 Ga0207659_10861540
484 Ga0207700_10093246
485 Ga0207700_10177520
486 Ga0207700_10331544
487 Ga0207700_10451975
488 Ga0207700_10509067
489 Ga0207700_10599912
490 Ga0207664_10120857
491 Ga0207706_10016916
492 Ga0207665_10001139
493 Ga0207665_10016036
494 Ga0207665_10178878
495 Ga0207665_10194087
496 Ga0207665_10224976
497 Ga0207665_11070009
498 Ga0207689_10387997
499 Ga0207667_10140694
500 Ga0207667_10164678
501 Ga0207667_10634401
502 Ga0207667_10936426
503 Ga0207712_10127582
504 Ga0207658_10136173
505 Ga0207677_10591974
506 Ga0207678_10408694
507 Ga0207702_10384341
508 Ga0207641_10201388
509 Ga0207641_11213435
510 Ga0207676_10092187
511 Ga0207674_10331365
512 Ga0207674_10355716
513 Ga0207698_10031542
514 Ga0265338_10144819
515 Ga0265338_10179350
516 Ga0265338_10280248
517 Ga0265338_10378940
518 Ga0265762_1001313
519 Ga0265760_10040672
520 Ga0265325_10010504
521 Ga0265325_10186935
522 Ga0265340_10090261
523 Ga0265340_10161537
524 Ga0265339_10005718
525 Ga0265339_10055442
526 Ga0265339_10069486
527 Ga0265316_10298845
528 Ga0265316_10306768
529 Ga0265314_10128360
530 Ga0265342_10108813
531 Ga0373934_0062093
532 Ga0373960_0062047
533 Ga0373955_0317109
534 Ga0373927_0045571
535 Ga0373927_0188345
536 Ga0373937_0130921
537 Ga0436364_0887456
538 Ga0436361_0226398
539 Ga0436361_0634719
540 Ga0436363_0758363
541 Ga0436363_1387711
542 Ga0436362_0572844
543 Ga0466966_0426723
544 Ga0466959_0159791
545 Ga0451576_0513627
546 Ga0451576_1512673
547 Ga0466967_0493250
548 Ga0495603_0171438
549 Ga0495651_0080090
550 Ga0495653_0144668
551 Ga0495580_0001097
552 Ga0495580_0005524
553 Ga0495580_0020839
554 Ga0495580_0158354
555 Ga0495580_0186921
556 Ga0495580_0194233
557 Ga0495580_0301313
558 Ga0495582_0022213
559 Ga0495582_0422687
560 Ga0495662_0076454
561 Ga0495594_0078387
562 Ga0495630_0338959
563 Ga0495665_0017152
564 Ga0495645_0048631
565 Ga0495645_0636338
566 Ga0495667_0060780
567 Ga0495668_0397117
568 Ga0495635_0070453
569 Ga0495635_0270897
570 Ga0495659_0006329
571 Ga0495669_0003185
572 Ga0495624_0147112
573 Ga0495600_0229278
574 Ga0495675_0075469
575 Ga0495684_0471330
576 Ga0495602_0507639
577 Ga0496102_0177057
578 Ga0496102_0461723
579 Ga0496104_0041476
580 Ga0496104_0119528
581 Ga0496105_0337180
582 Ga0496105_0774464
583 Ga0496107_0258706
584 Ga0496108_0035814
585 Ga0496109_0041374
586 Ga0496109_0271544
587 Ga0496110_0143512
588 Ga0496110_0158173
589 Ga0496111_0013007
590 Ga0496111_0170542
591 Ga0496112_0047498
592 Ga0496112_1297972
593 Ga0496113_0088491
594 Ga0496113_0340312
595 Ga0496115_0098809
596 Ga0496115_0357045
597 Ga0496119_0065057
598 nmdc:mga0n895_1130207_c1
599 nmdc:mga0n895_309759_c1
600 nmdc:mga0n895_6864_c1
601 nmdc:mga0rr50_34063_c1
602 nmdc:mga0rr50_390762_c1
603 nmdc:mga0rr50_635204_c1
604 nmdc:mga08x19_685_c1
605 nmdc:mga0a205_20322_c1
606 Ga0495601_0167603
607 Ga0495619_0109215
608 Ga0495619_0746424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

76

181

0.89

PF06966

DUF1295

Protein of unknown function (DUF1295)

97

189

0.75

Map