F397670

General Info

Members Datasets Scaffolds Average Seq Length
304 190 608 127

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0339589|Ga0373936_0339589_199_633
Length 144
Sequence MLLLQHNAGFAALSRMPKQPHVTLSRRERQIMDILYQRGKASASEVREAMEAAPGYSAVRAMLRVLEEKGHVRHQAEGLKYVYVPTVARDKAKRSAVKHVMETFFNGSAEQIVAALLDVASTQLTRGELDRMSEMIEKAKKEGK

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.99
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 32.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0339589 3300035113 Unclassified 683
2 Ga0065707_10579967 3300005295 Bacteria 702
3 Ga0070683_100152630 3300005329 Bacteria 2190
4 Ga0070683_101379288 3300005329 Unclassified 677
5 Ga0070683_101555163 3300005329 Unclassified 636
6 Ga0068869_101755010 3300005334 Unclassified 554
7 Ga0070680_101130474 3300005336 Unclassified 677
8 Ga0070689_100319173 3300005340 Bacteria 1297
9 Ga0070691_10275230 3300005341 Bacteria 911
10 Ga0070669_100066127 3300005353 Bacteria 2664
11 Ga0070669_101639077 3300005353 Unclassified 560
12 Ga0070673_100915321 3300005364 Bacteria 814
13 Ga0070688_101083519 3300005365 Bacteria 640
14 Ga0070709_10234952 3300005434 Bacteria 1313
15 Ga0070709_10771079 3300005434 Bacteria 753
16 Ga0070710_10565084 3300005437 Unclassified 787
17 Ga0070711_100555803 3300005439 Bacteria 953
18 Ga0070711_100848883 3300005439 Unclassified 777
19 Ga0070700_100701136 3300005441 Unclassified 805
20 Ga0070694_101315959 3300005444 Bacteria 608
21 Ga0070663_100157944 3300005455 Unclassified 1744
22 Ga0070678_100599146 3300005456 Bacteria 983
23 Ga0070681_11455355 3300005458 Unclassified 609
24 Ga0070685_10176027 3300005466 Bacteria 1374
25 Ga0070684_100092432 3300005535 Bacteria 2692
26 Ga0070686_100233936 3300005544 Bacteria 1334
27 Ga0070695_101200910 3300005545 Bacteria 624
28 Ga0070665_100711630 3300005548 Bacteria 1017
29 Ga0070704_100281220 3300005549 Bacteria 1379
30 Ga0070704_102067661 3300005549 Unclassified 529
31 Ga0070664_100099799 3300005564 Unclassified 2523
32 Ga0068857_100380146 3300005577 Bacteria 1311
33 Ga0068852_102070248 3300005616 Unclassified 591
34 Ga0068859_100447084 3300005617 Bacteria 1388
35 Ga0068859_100733151 3300005617 Bacteria 1078
36 Ga0068859_102022980 3300005617 Unclassified 636
37 Ga0068864_100014251 3300005618 Bacteria 6601
38 Ga0068870_10533713 3300005840 Unclassified 787
39 Ga0068863_100108925 3300005841 Unclassified 2637
40 Ga0068858_101578456 3300005842 Bacteria 647
41 Ga0068858_102042861 3300005842 Bacteria 567
42 Ga0068862_100116346 3300005844 Bacteria 2352
43 Ga0068862_101676365 3300005844 Unclassified 644
44 Ga0068862_102433047 3300005844 Unclassified 535
45 Ga0081455_10045612 3300005937 Bacteria 3812
46 Ga0070717_10077520 3300006028 Bacteria 2783
47 Ga0070712_100650410 3300006175 Unclassified 896
48 Ga0070712_101501720 3300006175 Bacteria 589
49 Ga0097621_100014261 3300006237 Bacteria 5943
50 Ga0097621_100505589 3300006237 Bacteria 1095
51 Ga0097621_101396170 3300006237 Unclassified 663
52 Ga0068871_100395393 3300006358 Unclassified 1230
53 Ga0068871_102181604 3300006358 Bacteria 528
54 Ga0075428_100068085 3300006844 Bacteria 3895
55 Ga0075431_100241633 3300006847 Bacteria 1837
56 Ga0075431_100907870 3300006847 Unclassified 850
57 Ga0068865_100303194 3300006881 Unclassified 1279
58 Ga0075436_101386555 3300006914 Unclassified 533
59 Ga0097620_100152534 3300006931 Bacteria 2386
60 Ga0097620_100447106 3300006931 Bacteria 1388
61 Ga0097620_100733169 3300006931 Bacteria 1078
62 Ga0097620_102022843 3300006931 Unclassified 636
63 Ga0075435_100560188 3300007076 Unclassified 990
64 Ga0105240_10012343 3300009093 Bacteria 11798
65 Ga0111539_10067872 3300009094 Bacteria 4210
66 Ga0111539_11269347 3300009094 Bacteria 855
67 Ga0105245_11423880 3300009098 Bacteria 743
68 Ga0114129_10211017 3300009147 Bacteria 2625
69 Ga0105241_10644901 3300009174 Bacteria 961
70 Ga0105242_10636248 3300009176 Bacteria 1035
71 Ga0105248_10033906 3300009177 Bacteria 5705
72 Ga0105248_10832870 3300009177 Bacteria 1041
73 Ga0105248_11189281 3300009177 Bacteria 862
74 Ga0105238_10278355 3300009551 Bacteria 1654
75 Ga0157373_10026522 3300013100 Bacteria 4184
76 Ga0157370_10699482 3300013104 Bacteria 925
77 Ga0157369_10003559 3300013105 Bacteria 18509
78 Ga0157369_10226134 3300013105 Bacteria 1957
79 Ga0157369_10821471 3300013105 Unclassified 954
80 Ga0157369_11431862 3300013105 Unclassified 703
81 Ga0157374_10082376 3300013296 Bacteria 3055
82 Ga0157374_10553749 3300013296 Bacteria 1158
83 Ga0157374_10834807 3300013296 Bacteria 938
84 Ga0157378_11153338 3300013297 Unclassified 813
85 Ga0157378_11758029 3300013297 Unclassified 668
86 Ga0157372_11763137 3300013307 Unclassified 712
87 Ga0157375_10115888 3300013308 Bacteria 2783
88 Ga0157375_10230507 3300013308 Bacteria 2011
89 Ga0157375_12256225 3300013308 Bacteria 649
90 Ga0157375_12810853 3300013308 Bacteria 582
91 Ga0163163_10006220 3300014325 Bacteria 10413
92 Ga0163163_10010992 3300014325 Bacteria 8183
93 Ga0163163_12706486 3300014325 Unclassified 553
94 Ga0163163_13178472 3300014325 Unclassified 512
95 Ga0157380_10000121 3300014326 Bacteria 43521
96 Ga0157380_11154168 3300014326 Unclassified 816
97 Ga0157380_11242443 3300014326 Unclassified 790
98 Ga0157380_12200316 3300014326 Bacteria 615
99 Ga0157379_10866879 3300014968 Unclassified 855
100 Ga0157376_11095625 3300014969 Bacteria 822
101 Ga0213876_10021639 3300021384 Bacteria 3400
102 Ga0207682_10211157 3300025893 Unclassified 895
103 Ga0207699_10804408 3300025906 Bacteria 691
104 Ga0207695_10007685 3300025913 Bacteria 13655
105 Ga0207693_10709657 3300025915 Bacteria 779
106 Ga0207663_11001998 3300025916 Unclassified 670
107 Ga0207663_11265894 3300025916 Unclassified 594
108 Ga0207663_11355580 3300025916 Unclassified 573
109 Ga0207660_10940330 3300025917 Unclassified 705
110 Ga0207694_10260436 3300025924 Bacteria 1421
111 Ga0207650_10641736 3300025925 Bacteria 895
112 Ga0207659_11295457 3300025926 Bacteria 626
113 Ga0207686_10669117 3300025934 Bacteria 823
114 Ga0207709_11070151 3300025935 Bacteria 661
115 Ga0207670_11631185 3300025936 Bacteria 548
116 Ga0207711_10033016 3300025941 Bacteria 4378
117 Ga0207711_10140168 3300025941 Bacteria 2175
118 Ga0207661_10010527 3300025944 Bacteria 6662
119 Ga0207661_10046487 3300025944 Unclassified 3442
120 Ga0207661_10553484 3300025944 Bacteria 1054
121 Ga0207679_10122427 3300025945 Unclassified 2073
122 Ga0207677_10816877 3300026023 Bacteria 836
123 Ga0207677_11723948 3300026023 Bacteria 581
124 Ga0207703_11620677 3300026035 Bacteria 623
125 Ga0207678_10124025 3300026067 Bacteria 2204
126 Ga0207678_10832828 3300026067 Unclassified 815
127 Ga0207708_10144211 3300026075 Bacteria 1870
128 Ga0207641_10245031 3300026088 Bacteria 1672
129 Ga0207676_10003973 3300026095 Bacteria 10432
130 Ga0207676_10258879 3300026095 Unclassified 1570
131 Ga0207676_12270861 3300026095 Bacteria 540
132 Ga0207674_10395103 3300026116 Bacteria 1336
133 Ga0207428_10041988 3300027907 Bacteria 3700
134 Ga0207428_10235154 3300027907 Bacteria 1370
135 Ga0268266_10936264 3300028379 Bacteria 838
136 Ga0268265_10360323 3300028380 Bacteria 1331
137 Ga0268265_11286250 3300028380 Unclassified 731
138 Ga0268264_11571617 3300028381 Bacteria 668
139 Ga0265316_10124332 3300031344 Bacteria 1946
140 Ga0265316_10309523 3300031344 Unclassified 1149
141 Ga0265342_10555726 3300031712 Unclassified 582
142 Ga0316577_10088914 3300031733 Bacteria 1729
143 Ga0373926_0021202 3300035083 Bacteria 2249
144 Ga0373944_0098822 3300035089 Unclassified 984
145 Ga0373923_0196321 3300035111 Unclassified 932
146 Ga0373953_0030651 3300035117 Bacteria 2087
147 Ga0373953_0142378 3300035117 Bacteria 1026
148 Ga0373954_0003071 3300035118 Bacteria 7050
149 Ga0373954_0118037 3300035118 Unclassified 1287
150 Ga0373956_0070037 3300035119 Unclassified 1600
151 Ga0373957_0295586 3300035120 Bacteria 686
152 Ga0373946_0647594 3300035171 Unclassified 550
153 Ga0373955_0191265 3300035172 Bacteria 1217
154 Ga0373924_0527045 3300035410 Bacteria 531
155 Ga0373935_0159562 3300035692 Unclassified 1536
156 Ga0373935_1004416 3300035692 Unclassified 620
157 Ga0373935_1379991 3300035692 Bacteria 527
158 Ga0373927_0000958 3300035695 Bacteria 22007
159 Ga0373927_0007882 3300035695 Bacteria 7201
160 Ga0373927_0260186 3300035695 Unclassified 1141
161 Ga0373927_0261257 3300035695 Unclassified 1139
162 Ga0373933_0137130 3300035724 Unclassified 1542
163 Ga0373933_0446525 3300035724 Bacteria 846
164 Ga0373947_0000524 3300035725 Bacteria 22377
165 Ga0373947_0041070 3300035725 Bacteria 2757
166 Ga0373947_0061064 3300035725 Unclassified 2290
167 Ga0373937_0051331 3300036401 Bacteria 3780
168 Ga0373937_0160136 3300036401 Unclassified 2110
169 Ga0373937_0175268 3300036401 Bacteria 2013
170 Ga0373937_0219170 3300036401 Unclassified 1791
171 Ga0373937_1378255 3300036401 Unclassified 653
172 Ga0373937_1382559 3300036401 Bacteria 652
173 Ga0373925_0001782 3300037068 Bacteria 17977
174 Ga0373925_0162946 3300037068 Unclassified 1757
175 Ga0373925_1028785 3300037068 Bacteria 678
176 Ga0436365_0226867 3300039437 Bacteria 1450
177 Ga0436365_0641258 3300039437 Bacteria 632
178 Ga0436362_1085597 3300039453 Unclassified 1835
179 Ga0451841_1084198 3300041498 Bacteria 598
180 Ga0466963_0313559 3300044694 Bacteria 1104
181 Ga0466964_0337371 3300044706 Unclassified 771
182 Ga0451576_0038210 3300045051 Bacteria 5081
183 Ga0451576_0473910 3300045051 Unclassified 1315
184 Ga0451576_0509788 3300045051 Bacteria 1264
185 Ga0466967_0358309 3300045976 Bacteria 1413
186 Ga0495592_0307003 3300046454 Bacteria 1030
187 Ga0495651_0022530 3300046462 Bacteria 4896
188 Ga0495651_0036449 3300046462 Bacteria 3830
189 Ga0495651_0360134 3300046462 Unclassified 959
190 Ga0495653_0513788 3300046463 Unclassified 745
191 Ga0495580_0007994 3300046472 Bacteria 8451
192 Ga0495580_0013663 3300046472 Bacteria 6189
193 Ga0495580_0071824 3300046472 Unclassified 2418
194 Ga0495580_0119271 3300046472 Unclassified 1832
195 Ga0495580_0314596 3300046472 Bacteria 1065
196 Ga0495580_0570192 3300046472 Bacteria 750
197 Ga0495582_0142101 3300046473 Bacteria 1361
198 Ga0495582_0380202 3300046473 Unclassified 814
199 Ga0495639_0518388 3300046475 Unclassified 609
200 Ga0495662_0245876 3300046476 Bacteria 881
201 Ga0495664_0071695 3300046477 Bacteria 2069
202 Ga0495664_0595191 3300046477 Bacteria 657
203 Ga0495594_0635257 3300046499 Bacteria 605
204 Ga0495608_0241554 3300046511 Bacteria 1128
205 Ga0495628_0217206 3300046516 Bacteria 1437
206 Ga0495630_1255324 3300046517 Unclassified 559
207 Ga0495630_1346852 3300046517 Unclassified 537
208 Ga0495652_0212133 3300046529 Bacteria 1461
209 Ga0495652_0349349 3300046529 Bacteria 1060
210 Ga0495665_0123093 3300046531 Bacteria 1358
211 Ga0495640_0477866 3300046533 Bacteria 759
212 Ga0495586_0340334 3300046535 Bacteria 861
213 Ga0495586_0485337 3300046535 Unclassified 713
214 Ga0495587_0085272 3300046536 Bacteria 1829
215 Ga0495645_0013151 3300046543 Bacteria 5851
216 Ga0495645_0134041 3300046543 Bacteria 1734
217 Ga0495645_0252016 3300046543 Bacteria 1173
218 Ga0495667_0000507 3300046559 Bacteria 24847
219 Ga0495667_0052911 3300046559 Bacteria 2674
220 Ga0495667_0138611 3300046559 Unclassified 1568
221 Ga0495667_0163461 3300046559 Bacteria 1431
222 Ga0495611_0078561 3300046648 Bacteria 1515
223 Ga0495635_0422683 3300046663 Bacteria 883
224 Ga0495635_0424464 3300046663 Bacteria 881
225 Ga0495635_0631067 3300046663 Unclassified 698
226 Ga0495657_0000221 3300046675 Bacteria 51304
227 Ga0495657_0151677 3300046675 Unclassified 1439
228 Ga0495599_0074478 3300046678 Bacteria 2120
229 Ga0495599_0095352 3300046678 Bacteria 1856
230 Ga0495623_0009526 3300046679 Bacteria 6308
231 Ga0495623_0278780 3300046679 Bacteria 931
232 Ga0495646_0207098 3300046680 Bacteria 1066
233 Ga0495647_0052998 3300046681 Unclassified 1581
234 Ga0495669_0299284 3300046684 Unclassified 775
235 Ga0495669_0412254 3300046684 Bacteria 655
236 Ga0495613_0044968 3300046689 Bacteria 3266
237 Ga0495613_0210687 3300046689 Bacteria 1367
238 Ga0495613_0533393 3300046689 Unclassified 787
239 Ga0495624_0799341 3300046690 Unclassified 558
240 Ga0495600_0197419 3300046809 Bacteria 1293
241 Ga0495600_0267272 3300046809 Unclassified 1085
242 Ga0495581_0153151 3300047315 Unclassified 1347
243 Ga0495604_0213065 3300047317 Bacteria 1334
244 Ga0495604_0221621 3300047317 Bacteria 1302
245 Ga0495604_0323881 3300047317 Unclassified 1029
246 Ga0495604_0394294 3300047317 Unclassified 912
247 Ga0495674_0038136 3300047319 Bacteria 4315
248 Ga0495674_0461758 3300047319 Unclassified 1019
249 Ga0495680_0602384 3300047322 Unclassified 735
250 Ga0495675_0160208 3300047444 Bacteria 1386
251 Ga0495675_0226051 3300047444 Bacteria 1131
252 Ga0495675_0402312 3300047444 Bacteria 798
253 Ga0495684_0001648 3300047471 Bacteria 17929
254 Ga0495684_0047754 3300047471 Bacteria 3274
255 Ga0495684_0052360 3300047471 Bacteria 3115
256 Ga0495684_0259975 3300047471 Bacteria 1260
257 Ga0495684_0327158 3300047471 Bacteria 1094
258 Ga0495684_0733059 3300047471 Bacteria 652
259 Ga0495593_0550725 3300047673 Bacteria 579
260 Ga0495602_0016180 3300048088 Bacteria 7506
261 Ga0495602_0367464 3300048088 Unclassified 1034
262 Ga0495602_0448427 3300048088 Bacteria 911
263 Ga0495614_0184399 3300048089 Bacteria 940
264 Ga0496104_0560048 3300048907 Bacteria 1054
265 Ga0496104_0977551 3300048907 Unclassified 751
266 Ga0496115_0002427 3300048918 Bacteria 13379
267 Ga0501031_0003474 3300049568 Bacteria 10114
268 Ga0501032_0001308 3300049569 Bacteria 19955
269 Ga0501033_0151250 3300049570 Bacteria 1674
270 Ga0501034_0029282 3300049571 Bacteria 5596
271 Ga0501036_0004730 3300049572 Bacteria 10986
272 Ga0501037_0005419 3300049573 Bacteria 9289
273 Ga0501038_0003677 3300049574 Bacteria 14282
274 Ga0501039_0003518 3300049575 Bacteria 11731
275 Ga0501043_0085835 3300049579 Unclassified 2473
276 Ga0501046_0002457 3300049580 Bacteria 17380
277 Ga0501047_0044344 3300049581 Bacteria 4296
278 Ga0501048_0008199 3300049582 Bacteria 7901
279 Ga0501067_0003658 3300049583 Bacteria 8467
280 Ga0501068_0001803 3300049584 Bacteria 11385
281 Ga0501069_0001919 3300049585 Bacteria 10383
282 Ga0501070_0002998 3300049586 Bacteria 14696
283 Ga0501072_0007322 3300049588 Bacteria 8371
284 Ga0501073_0000250 3300049589 Bacteria 35494
285 Ga0501073_0006459 3300049589 Bacteria 8723
286 Ga0501074_0014904 3300049590 Bacteria 5654
287 Ga0501074_0315273 3300049590 Unclassified 1111
288 Ga0501075_0279931 3300049591 Unclassified 1271
289 Ga0501076_0014491 3300049592 Bacteria 5941
290 Ga0501077_0004723 3300049593 Bacteria 8282
291 Ga0501079_0007794 3300049741 Bacteria 8106
292 Ga0501080_0005565 3300049742 Bacteria 11251
293 Ga0501083_0012054 3300049744 Bacteria 6053
294 Ga0501044_0012962 3300049823 Bacteria 9025
295 nmdc:mga06r32_1628841_c1 3300050510 Unclassified 583
296 nmdc:mga06r32_464564_c1 3300050510 Bacteria 1244
297 nmdc:mga08y16_51702_c1 3300050511 Bacteria 4300
298 nmdc:mga08y16_886907_c1 3300050511 Bacteria 879
299 nmdc:mga08y16_994726_c1 3300050511 Unclassified 819
300 nmdc:mga08x19_1133552_c1 3300050514 Unclassified 555
301 Ga0495619_0086977 3300053085 Bacteria 2113
302 Ga0500555_089112 3300053103 Unclassified 794
303 Ga0501084_0001209 3300054114 Bacteria 20255
304 Ga0530510_0664762 3300061734 Unclassified 793
305 Ga0373936_0339589
306 Ga0065707_10579967
307 Ga0070683_100152630
308 Ga0070683_101379288
309 Ga0070683_101555163
310 Ga0068869_101755010
311 Ga0070680_101130474
312 Ga0070689_100319173
313 Ga0070691_10275230
314 Ga0070669_100066127
315 Ga0070669_101639077
316 Ga0070673_100915321
317 Ga0070688_101083519
318 Ga0070709_10234952
319 Ga0070709_10771079
320 Ga0070710_10565084
321 Ga0070711_100555803
322 Ga0070711_100848883
323 Ga0070700_100701136
324 Ga0070694_101315959
325 Ga0070663_100157944
326 Ga0070678_100599146
327 Ga0070681_11455355
328 Ga0070685_10176027
329 Ga0070684_100092432
330 Ga0070686_100233936
331 Ga0070695_101200910
332 Ga0070665_100711630
333 Ga0070704_100281220
334 Ga0070704_102067661
335 Ga0070664_100099799
336 Ga0068857_100380146
337 Ga0068852_102070248
338 Ga0068859_100447084
339 Ga0068859_100733151
340 Ga0068859_102022980
341 Ga0068864_100014251
342 Ga0068870_10533713
343 Ga0068863_100108925
344 Ga0068858_101578456
345 Ga0068858_102042861
346 Ga0068862_100116346
347 Ga0068862_101676365
348 Ga0068862_102433047
349 Ga0081455_10045612
350 Ga0070717_10077520
351 Ga0070712_100650410
352 Ga0070712_101501720
353 Ga0097621_100014261
354 Ga0097621_100505589
355 Ga0097621_101396170
356 Ga0068871_100395393
357 Ga0068871_102181604
358 Ga0075428_100068085
359 Ga0075431_100241633
360 Ga0075431_100907870
361 Ga0068865_100303194
362 Ga0075436_101386555
363 Ga0097620_100152534
364 Ga0097620_100447106
365 Ga0097620_100733169
366 Ga0097620_102022843
367 Ga0075435_100560188
368 Ga0105240_10012343
369 Ga0111539_10067872
370 Ga0111539_11269347
371 Ga0105245_11423880
372 Ga0114129_10211017
373 Ga0105241_10644901
374 Ga0105242_10636248
375 Ga0105248_10033906
376 Ga0105248_10832870
377 Ga0105248_11189281
378 Ga0105238_10278355
379 Ga0157373_10026522
380 Ga0157370_10699482
381 Ga0157369_10003559
382 Ga0157369_10226134
383 Ga0157369_10821471
384 Ga0157369_11431862
385 Ga0157374_10082376
386 Ga0157374_10553749
387 Ga0157374_10834807
388 Ga0157378_11153338
389 Ga0157378_11758029
390 Ga0157372_11763137
391 Ga0157375_10115888
392 Ga0157375_10230507
393 Ga0157375_12256225
394 Ga0157375_12810853
395 Ga0163163_10006220
396 Ga0163163_10010992
397 Ga0163163_12706486
398 Ga0163163_13178472
399 Ga0157380_10000121
400 Ga0157380_11154168
401 Ga0157380_11242443
402 Ga0157380_12200316
403 Ga0157379_10866879
404 Ga0157376_11095625
405 Ga0213876_10021639
406 Ga0207682_10211157
407 Ga0207699_10804408
408 Ga0207695_10007685
409 Ga0207693_10709657
410 Ga0207663_11001998
411 Ga0207663_11265894
412 Ga0207663_11355580
413 Ga0207660_10940330
414 Ga0207694_10260436
415 Ga0207650_10641736
416 Ga0207659_11295457
417 Ga0207686_10669117
418 Ga0207709_11070151
419 Ga0207670_11631185
420 Ga0207711_10033016
421 Ga0207711_10140168
422 Ga0207661_10010527
423 Ga0207661_10046487
424 Ga0207661_10553484
425 Ga0207679_10122427
426 Ga0207677_10816877
427 Ga0207677_11723948
428 Ga0207703_11620677
429 Ga0207678_10124025
430 Ga0207678_10832828
431 Ga0207708_10144211
432 Ga0207641_10245031
433 Ga0207676_10003973
434 Ga0207676_10258879
435 Ga0207676_12270861
436 Ga0207674_10395103
437 Ga0207428_10041988
438 Ga0207428_10235154
439 Ga0268266_10936264
440 Ga0268265_10360323
441 Ga0268265_11286250
442 Ga0268264_11571617
443 Ga0265316_10124332
444 Ga0265316_10309523
445 Ga0265342_10555726
446 Ga0316577_10088914
447 Ga0373926_0021202
448 Ga0373944_0098822
449 Ga0373923_0196321
450 Ga0373953_0030651
451 Ga0373953_0142378
452 Ga0373954_0003071
453 Ga0373954_0118037
454 Ga0373956_0070037
455 Ga0373957_0295586
456 Ga0373946_0647594
457 Ga0373955_0191265
458 Ga0373924_0527045
459 Ga0373935_0159562
460 Ga0373935_1004416
461 Ga0373935_1379991
462 Ga0373927_0000958
463 Ga0373927_0007882
464 Ga0373927_0260186
465 Ga0373927_0261257
466 Ga0373933_0137130
467 Ga0373933_0446525
468 Ga0373947_0000524
469 Ga0373947_0041070
470 Ga0373947_0061064
471 Ga0373937_0051331
472 Ga0373937_0160136
473 Ga0373937_0175268
474 Ga0373937_0219170
475 Ga0373937_1378255
476 Ga0373937_1382559
477 Ga0373925_0001782
478 Ga0373925_0162946
479 Ga0373925_1028785
480 Ga0436365_0226867
481 Ga0436365_0641258
482 Ga0436362_1085597
483 Ga0451841_1084198
484 Ga0466963_0313559
485 Ga0466964_0337371
486 Ga0451576_0038210
487 Ga0451576_0473910
488 Ga0451576_0509788
489 Ga0466967_0358309
490 Ga0495592_0307003
491 Ga0495651_0022530
492 Ga0495651_0036449
493 Ga0495651_0360134
494 Ga0495653_0513788
495 Ga0495580_0007994
496 Ga0495580_0013663
497 Ga0495580_0071824
498 Ga0495580_0119271
499 Ga0495580_0314596
500 Ga0495580_0570192
501 Ga0495582_0142101
502 Ga0495582_0380202
503 Ga0495639_0518388
504 Ga0495662_0245876
505 Ga0495664_0071695
506 Ga0495664_0595191
507 Ga0495594_0635257
508 Ga0495608_0241554
509 Ga0495628_0217206
510 Ga0495630_1255324
511 Ga0495630_1346852
512 Ga0495652_0212133
513 Ga0495652_0349349
514 Ga0495665_0123093
515 Ga0495640_0477866
516 Ga0495586_0340334
517 Ga0495586_0485337
518 Ga0495587_0085272
519 Ga0495645_0013151
520 Ga0495645_0134041
521 Ga0495645_0252016
522 Ga0495667_0000507
523 Ga0495667_0052911
524 Ga0495667_0138611
525 Ga0495667_0163461
526 Ga0495611_0078561
527 Ga0495635_0422683
528 Ga0495635_0424464
529 Ga0495635_0631067
530 Ga0495657_0000221
531 Ga0495657_0151677
532 Ga0495599_0074478
533 Ga0495599_0095352
534 Ga0495623_0009526
535 Ga0495623_0278780
536 Ga0495646_0207098
537 Ga0495647_0052998
538 Ga0495669_0299284
539 Ga0495669_0412254
540 Ga0495613_0044968
541 Ga0495613_0210687
542 Ga0495613_0533393
543 Ga0495624_0799341
544 Ga0495600_0197419
545 Ga0495600_0267272
546 Ga0495581_0153151
547 Ga0495604_0213065
548 Ga0495604_0221621
549 Ga0495604_0323881
550 Ga0495604_0394294
551 Ga0495674_0038136
552 Ga0495674_0461758
553 Ga0495680_0602384
554 Ga0495675_0160208
555 Ga0495675_0226051
556 Ga0495675_0402312
557 Ga0495684_0001648
558 Ga0495684_0047754
559 Ga0495684_0052360
560 Ga0495684_0259975
561 Ga0495684_0327158
562 Ga0495684_0733059
563 Ga0495593_0550725
564 Ga0495602_0016180
565 Ga0495602_0367464
566 Ga0495602_0448427
567 Ga0495614_0184399
568 Ga0496104_0560048
569 Ga0496104_0977551
570 Ga0496115_0002427
571 Ga0501031_0003474
572 Ga0501032_0001308
573 Ga0501033_0151250
574 Ga0501034_0029282
575 Ga0501036_0004730
576 Ga0501037_0005419
577 Ga0501038_0003677
578 Ga0501039_0003518
579 Ga0501043_0085835
580 Ga0501046_0002457
581 Ga0501047_0044344
582 Ga0501048_0008199
583 Ga0501067_0003658
584 Ga0501068_0001803
585 Ga0501069_0001919
586 Ga0501070_0002998
587 Ga0501072_0007322
588 Ga0501073_0000250
589 Ga0501073_0006459
590 Ga0501074_0014904
591 Ga0501074_0315273
592 Ga0501075_0279931
593 Ga0501076_0014491
594 Ga0501077_0004723
595 Ga0501079_0007794
596 Ga0501080_0005565
597 Ga0501083_0012054
598 Ga0501044_0012962
599 nmdc:mga06r32_1628841_c1
600 nmdc:mga06r32_464564_c1
601 nmdc:mga08y16_51702_c1
602 nmdc:mga08y16_886907_c1
603 nmdc:mga08y16_994726_c1
604 nmdc:mga08x19_1133552_c1
605 Ga0495619_0086977
606 Ga0500555_089112
607 Ga0501084_0001209
608 Ga0530510_0664762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

24

138

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.904 8 70
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8807 8 70
5icg-assembly1.cif.gz_A-2 crystal structure of apo (s)-norcoclaurine 6-o-methyltransferase 0.8758 15 70
1w7p-assembly1.cif.gz_A the crystal structure of endosomal complex escrt-ii (vps22/vps25/vps36) 0.8582 8 71
1u5t-assembly1.cif.gz_A structure of the escrt-ii endosomal trafficking complex 0.8461 8 71
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 9 69 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9056 9 69 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 10 70 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8999 10 70 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8993 25 71 3.30.230.130
ID Description Score Start End GO Terms
AF-A0A0F8YYR6-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9598 9 77 GO:0003677
GO:0045892
AF-D5VN90-F1-model_v4 Transcriptional repressor, CopY family 0.9544 8 71 GO:0003677
GO:0045892
AF-A0A3C0VF54-F1-model_v4 Transcriptional regulator 0.9444 7 70
AF-A0A3N5SU18-F1-model_v4 deleted 0.942 1 72
AF-A0A0K8NV68-F1-model_v4 Uncharacterized protein 0.9374 9 73

Map