F397561

General Info

Members Datasets Scaffolds Average Seq Length
304 188 304 484

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10202638|Ga0105248_102026381
Length 529
Sequence MEKYFAVAMALPILPLRKVWDQMSSNEGKQAVMNRRDLFRNSLTMSTLAIGAGSMSAAPXPAAEFPKAPGLTKSVAEFIVNAKYSDIPPDVIDLGKKSILDGFGLALAGSASNMGPLVRQYVKSFGSAEEKASIIGTGMKSHLRFAAFANGVSIHADDFDDTQLAVAKDRIYGLLTHPTVSVLPPAFAICEMSRRTGRDLMLAYHVGVEVESKIAEAISPRHYDEGFHTTGTCGSLGSGAACAKLRGLNALQTAYTLAIAAAQGGGFRDNFGSMTKPFHAGHAAENGTVAADLASHGWTAAEDILEAPLGFFQAAGGSFDPGSIVGKLGRPWTFTSPGVSIKPHPSGSLSHPAMGEMLRLIRQNDIKPADVEKIDLGANHAMVTSLLHHQPTTGLQGKFSMEYCLSILLLERKAGLPEFQDAVVRRADVQEMMKHVNFYIDPEAENAGLDKMTSILRIHLKSGKVLSGRAEFAKGSPSNPMTYDEVADKFRGCAEFAKWPAAKTESVIASVKSLDNLSDVTKLAAALTS

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
181 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
182 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 0.99
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10197991 3300003323 Bacteria 7712
2 Ga0070658_10137621 3300005327 Bacteria 2038
3 Ga0070676_10086499 3300005328 Bacteria 1912
4 Ga0070683_100020205 3300005329 Bacteria 5925
5 Ga0070690_100026732 3300005330 Bacteria 3563
6 Ga0070670_100001958 3300005331 Bacteria 16864
7 Ga0070666_10011333 3300005335 Bacteria 5594
8 Ga0070680_100109643 3300005336 Bacteria 2297
9 Ga0068868_100001201 3300005338 Bacteria 17794
10 Ga0070689_100015285 3300005340 Bacteria 5594
11 Ga0070661_100022709 3300005344 Bacteria 4493
12 Ga0070661_100033102 3300005344 Bacteria 3744
13 Ga0070675_100002103 3300005354 Bacteria 14725
14 Ga0070675_100011981 3300005354 Bacteria 6795
15 Ga0070675_100016718 3300005354 Bacteria 5824
16 Ga0070671_100007166 3300005355 Bacteria 8914
17 Ga0070671_100016443 3300005355 Bacteria 5983
18 Ga0070671_100031169 3300005355 Bacteria 4404
19 Ga0070673_100059846 3300005364 Bacteria 3016
20 Ga0070659_100024367 3300005366 Bacteria 4639
21 Ga0070659_100034295 3300005366 Bacteria 3947
22 Ga0070667_100006082 3300005367 Bacteria 10020
23 Ga0070667_100066513 3300005367 Bacteria 3062
24 Ga0070709_10019407 3300005434 Bacteria 3930
25 Ga0070709_10025550 3300005434 Bacteria 3491
26 Ga0070713_100000426 3300005436 Bacteria 26948
27 Ga0070713_100078044 3300005436 Bacteria 2818
28 Ga0070713_100133800 3300005436 Bacteria 2189
29 Ga0070711_100124028 3300005439 Bacteria 1915
30 Ga0070708_100046411 3300005445 Bacteria 3833
31 Ga0070708_100060073 3300005445 Bacteria 3392
32 Ga0070708_100080843 3300005445 Bacteria 2941
33 Ga0070708_100085885 3300005445 Bacteria 2857
34 Ga0070681_10065133 3300005458 Bacteria 3613
35 Ga0070685_10039948 3300005466 Bacteria 2668
36 Ga0070685_10048595 3300005466 Bacteria 2444
37 Ga0070706_100065976 3300005467 Bacteria 3348
38 Ga0070707_100012031 3300005468 Bacteria 8077
39 Ga0070707_100064567 3300005468 Bacteria 3515
40 Ga0070707_100122094 3300005468 Bacteria 2529
41 Ga0070698_100074046 3300005471 Bacteria 3411
42 Ga0070699_100010563 3300005518 Bacteria 7992
43 Ga0070699_100068194 3300005518 Bacteria 3088
44 Ga0070679_100150511 3300005530 Bacteria 2304
45 Ga0068853_100126209 3300005539 Bacteria 2286
46 Ga0070672_100022743 3300005543 Bacteria 4611
47 Ga0070672_100032632 3300005543 Bacteria 3932
48 Ga0070686_100028468 3300005544 Bacteria 3389
49 Ga0070693_100000333 3300005547 Bacteria 21602
50 Ga0068855_100021861 3300005563 Bacteria 7669
51 Ga0068855_100099275 3300005563 Bacteria 3354
52 Ga0068855_100310196 3300005563 Bacteria 1746
53 Ga0070664_100002466 3300005564 Bacteria 14902
54 Ga0068857_100079126 3300005577 Bacteria 2935
55 Ga0068856_100005376 3300005614 Bacteria 12623
56 Ga0068856_100160685 3300005614 Bacteria 2257
57 Ga0068852_100000428 3300005616 Bacteria 27960
58 Ga0068852_100006584 3300005616 Bacteria 8410
59 Ga0068859_100004949 3300005617 Bacteria 13537
60 Ga0068859_100014578 3300005617 Bacteria 7895
61 Ga0068864_100030080 3300005618 Bacteria 4603
62 Ga0068864_100085059 3300005618 Bacteria 2780
63 Ga0068864_100142825 3300005618 Bacteria 2161
64 Ga0068864_100207552 3300005618 Bacteria 1802
65 Ga0068864_100252652 3300005618 Bacteria 1637
66 Ga0068851_10004535 3300005834 Bacteria 6267
67 Ga0068851_10038547 3300005834 Bacteria 2398
68 Ga0068863_100002393 3300005841 Bacteria 18652
69 Ga0068863_100014123 3300005841 Bacteria 7692
70 Ga0068858_100004764 3300005842 Bacteria 13286
71 Ga0068858_100185142 3300005842 Bacteria 1967
72 Ga0068860_100008827 3300005843 Bacteria 10042
73 Ga0081539_10023511 3300005985 Bacteria 4036
74 Ga0070717_10002030 3300006028 Bacteria 14173
75 Ga0070717_10050397 3300006028 Bacteria 3422
76 Ga0070717_10096802 3300006028 Bacteria 2500
77 Ga0070717_10118918 3300006028 Unclassified 2262
78 Ga0070716_100001995 3300006173 Bacteria 9306
79 Ga0070716_100064578 3300006173 Bacteria 2129
80 Ga0070712_100034185 3300006175 Bacteria 3444
81 Ga0097621_100013246 3300006237 Bacteria 6139
82 Ga0097621_100083939 3300006237 Bacteria 2655
83 Ga0068871_100008909 3300006358 Bacteria 7240
84 Ga0068871_100010858 3300006358 Bacteria 6667
85 Ga0068871_100059792 3300006358 Bacteria 3106
86 Ga0075434_100045898 3300006871 Bacteria 4335
87 Ga0075434_100212435 3300006871 Bacteria 1955
88 Ga0097620_100004949 3300006931 Bacteria 13537
89 Ga0097620_100014578 3300006931 Bacteria 7895
90 Ga0097620_100181164 3300006931 Bacteria 2189
91 Ga0105240_10023465 3300009093 Bacteria 8156
92 Ga0105240_10060414 3300009093 Bacteria 4725
93 Ga0105240_10075454 3300009093 Bacteria 4158
94 Ga0105240_10088770 3300009093 Unclassified 3782
95 Ga0105240_10096267 3300009093 Bacteria 3607
96 Ga0105240_10137804 3300009093 Bacteria 2920
97 Ga0105240_10185880 3300009093 Unclassified 2448
98 Ga0114129_10018927 3300009147 Bacteria 9812
99 Ga0114129_10086117 3300009147 Bacteria 4358
100 Ga0114129_10295428 3300009147 Bacteria 2161
101 Ga0105241_10013008 3300009174 Bacteria 6103
102 Ga0105248_10010481 3300009177 Bacteria 10208
103 Ga0105248_10037397 3300009177 Bacteria 5431
104 Ga0105248_10062449 3300009177 Bacteria 4183
105 Ga0105248_10202638 3300009177 Bacteria 2236
106 Ga0105237_10147740 3300009545 Unclassified 2346
107 Ga0105237_10162518 3300009545 Bacteria 2232
108 Ga0105238_10341302 3300009551 Bacteria 1486
109 Ga0105249_10042939 3300009553 Bacteria 4112
110 Ga0105249_10085577 3300009553 Bacteria 2938
111 Ga0105239_10265957 3300010375 Bacteria 1928
112 Ga0105246_10051399 3300011119 Bacteria 2830
113 Ga0157373_10008668 3300013100 Bacteria 7546
114 Ga0157371_10056331 3300013102 Bacteria 2788
115 Ga0157370_10009300 3300013104 Bacteria 10522
116 Ga0157369_10002817 3300013105 Bacteria 20750
117 Ga0157374_10132578 3300013296 Bacteria 2412
118 Ga0157378_10094850 3300013297 Bacteria 2717
119 Ga0163162_10003700 3300013306 Bacteria 14652
120 Ga0163162_10086079 3300013306 Bacteria 3220
121 Ga0163162_10116538 3300013306 Bacteria 2772
122 Ga0157372_10004028 3300013307 Bacteria 15756
123 Ga0157372_10012465 3300013307 Bacteria 9062
124 Ga0157372_10349200 3300013307 Bacteria 1723
125 Ga0157375_10001019 3300013308 Bacteria 24232
126 Ga0157375_10134705 3300013308 Bacteria 2593
127 Ga0163163_10008721 3300014325 Bacteria 9019
128 Ga0163163_10018141 3300014325 Bacteria 6579
129 Ga0163163_10025581 3300014325 Bacteria 5627
130 Ga0163163_10044452 3300014325 Bacteria 4357
131 Ga0157377_10026309 3300014745 Bacteria 3112
132 Ga0157379_10000497 3300014968 Bacteria 31919
133 Ga0157379_10005203 3300014968 Bacteria 11175
134 Ga0157379_10210225 3300014968 Bacteria 1761
135 Ga0157376_10011260 3300014969 Bacteria 6585
136 Ga0157376_10045622 3300014969 Unclassified 3610
137 Ga0157376_10083624 3300014969 Bacteria 2746
138 Ga0207656_10000827 3300025321 Bacteria 10093
139 Ga0207692_10020754 3300025898 Bacteria 2994
140 Ga0207699_10041991 3300025906 Bacteria 2646
141 Ga0207705_10026237 3300025909 Bacteria 4156
142 Ga0207705_10084368 3300025909 Bacteria 2319
143 Ga0207684_10069821 3300025910 Bacteria 2985
144 Ga0207707_10001150 3300025912 Bacteria 25088
145 Ga0207695_10033563 3300025913 Bacteria 5595
146 Ga0207695_10055698 3300025913 Bacteria 4118
147 Ga0207663_10053184 3300025916 Bacteria 2529
148 Ga0207657_10000213 3300025919 Bacteria 60310
149 Ga0207652_10047461 3300025921 Bacteria 3668
150 Ga0207652_10079419 3300025921 Bacteria 2866
151 Ga0207646_10014761 3300025922 Bacteria 7402
152 Ga0207694_10014532 3300025924 Bacteria 5936
153 Ga0207650_10009805 3300025925 Bacteria 6548
154 Ga0207659_10001692 3300025926 Bacteria 13090
155 Ga0207659_10003162 3300025926 Bacteria 9845
156 Ga0207659_10004197 3300025926 Bacteria 8705
157 Ga0207659_10011468 3300025926 Bacteria 5600
158 Ga0207700_10000035 3300025928 Bacteria 119648
159 Ga0207644_10012523 3300025931 Bacteria 5637
160 Ga0207690_10044669 3300025932 Bacteria 2922
161 Ga0207670_10013349 3300025936 Bacteria 4839
162 Ga0207670_10043283 3300025936 Bacteria 2972
163 Ga0207665_10010774 3300025939 Bacteria 6002
164 Ga0207691_10002695 3300025940 Bacteria 17372
165 Ga0207691_10035707 3300025940 Bacteria 4611
166 Ga0207711_10006777 3300025941 Bacteria 9625
167 Ga0207711_10044979 3300025941 Bacteria 3772
168 Ga0207667_10031154 3300025949 Bacteria 5760
169 Ga0207667_10066621 3300025949 Bacteria 3753
170 Ga0207667_10285856 3300025949 Bacteria 1685
171 Ga0207651_10149031 3300025960 Bacteria 1818
172 Ga0207712_10088423 3300025961 Bacteria 2275
173 Ga0207658_10022716 3300025986 Bacteria 4369
174 Ga0207702_10051998 3300026078 Bacteria 3464
175 Ga0207641_10001278 3300026088 Bacteria 25052
176 Ga0207641_10062731 3300026088 Unclassified 3173
177 Ga0207676_10071495 3300026095 Bacteria 2786
178 Ga0207674_10000045 3300026116 Bacteria 122251
179 Ga0207674_10016012 3300026116 Bacteria 8215
180 Ga0207675_100340541 3300026118 Bacteria 1468
181 Ga0207698_10001727 3300026142 Bacteria 12735
182 Ga0207698_10018294 3300026142 Bacteria 4771
183 Ga0207698_10050599 3300026142 Bacteria 3171
184 Ga0268264_10011172 3300028381 Bacteria 7416
185 Ga0307517_10076555 3300028786 Bacteria 2920
186 Ga0307515_10001245 3300028794 Bacteria 58063
187 Ga0265325_10040996 3300031241 Bacteria 2429
188 Ga0265331_10024892 3300031250 Bacteria 3024
189 Ga0265313_10022359 3300031595 Unclassified 3432
190 Ga0307516_10016892 3300031730 Bacteria 7616
191 Ga0373926_0007793 3300035083 Unclassified 3566
192 Ga0373949_0000098 3300035090 Bacteria 32170
193 Ga0373936_0000003 3300035113 Bacteria 401675
194 Ga0373953_0041252 3300035117 Bacteria 1836
195 Ga0373954_0010186 3300035118 Bacteria 4144
196 Ga0373954_0013872 3300035118 Bacteria 3591
197 Ga0373961_0000008 3300035241 Bacteria 139095
198 Ga0373935_0009365 3300035692 Bacteria 5861
199 Ga0373927_0022351 3300035695 Bacteria 4143
200 Ga0373933_0041932 3300035724 Bacteria 2704
201 Ga0373937_0045605 3300036401 Bacteria 4006
202 Ga0436365_1671807 3300039437 Bacteria 2052
203 Ga0466966_0085857 3300044684 Bacteria 1957
204 Ga0466958_0031374 3300045836 Bacteria 3158
205 Ga0495592_0003093 3300046454 Bacteria 11880
206 Ga0495592_0011314 3300046454 Bacteria 6749
207 Ga0495592_0016166 3300046454 Bacteria 5662
208 Ga0495592_0096820 3300046454 Unclassified 2109
209 Ga0495651_0003062 3300046462 Bacteria 12908
210 Ga0495651_0014672 3300046462 Bacteria 6059
211 Ga0495653_0012604 3300046463 Bacteria 6905
212 Ga0495653_0026764 3300046463 Bacteria 4621
213 Ga0495580_0006274 3300046472 Bacteria 9718
214 Ga0495580_0033860 3300046472 Bacteria 3679
215 Ga0495580_0087931 3300046472 Bacteria 2164
216 Ga0495664_0008583 3300046477 Bacteria 5700
217 Ga0495664_0012010 3300046477 Bacteria 4896
218 Ga0495664_0016748 3300046477 Bacteria 4182
219 Ga0495608_0009050 3300046511 Bacteria 6966
220 Ga0495608_0040268 3300046511 Unclassified 3131
221 Ga0495618_0029706 3300046514 Bacteria 3410
222 Ga0495618_0069389 3300046514 Unclassified 2241
223 Ga0495628_0000744 3300046516 Bacteria 30195
224 Ga0495628_0066519 3300046516 Unclassified 2817
225 Ga0495630_0030780 3300046517 Unclassified 3994
226 Ga0495652_0000313 3300046529 Bacteria 57537
227 Ga0495652_0021875 3300046529 Bacteria 5684
228 Ga0495665_0016177 3300046531 Bacteria 4020
229 Ga0495640_0041865 3300046533 Unclassified 3199
230 Ga0495586_0000358 3300046535 Bacteria 28407
231 Ga0495587_0003695 3300046536 Bacteria 10182
232 Ga0495587_0019835 3300046536 Bacteria 4156
233 Ga0495645_0002358 3300046543 Bacteria 12809
234 Ga0495645_0003925 3300046543 Bacteria 10137
235 Ga0495667_0000931 3300046559 Bacteria 18897
236 Ga0495667_0003902 3300046559 Bacteria 10006
237 Ga0495634_0066985 3300046642 Unclassified 2376
238 Ga0495635_0004724 3300046663 Bacteria 9467
239 Ga0495635_0055538 3300046663 Unclassified 2728
240 Ga0495635_0061397 3300046663 Bacteria 2582
241 Ga0495657_0024097 3300046675 Bacteria 4339
242 Ga0495657_0032281 3300046675 Bacteria 3656
243 Ga0495657_0046566 3300046675 Bacteria 2935
244 Ga0495599_0009712 3300046678 Bacteria 5887
245 Ga0495623_0017445 3300046679 Bacteria 4638
246 Ga0495623_0033364 3300046679 Bacteria 3303
247 Ga0495646_0020073 3300046680 Bacteria 4224
248 Ga0495646_0080545 3300046680 Bacteria 1899
249 Ga0495613_0016224 3300046689 Bacteria 5549
250 Ga0495600_0010457 3300046809 Bacteria 5761
251 Ga0495600_0029327 3300046809 Bacteria 3562
252 Ga0495604_0014614 3300047317 Bacteria 6258
253 Ga0495604_0017613 3300047317 Bacteria 5719
254 Ga0495604_0032378 3300047317 Bacteria 4144
255 Ga0495674_0001215 3300047319 Bacteria 24964
256 Ga0495674_0061085 3300047319 Bacteria 3286
257 Ga0495680_0000182 3300047322 Bacteria 66757
258 Ga0495680_0016505 3300047322 Bacteria 6339
259 Ga0495675_0001698 3300047444 Bacteria 13197
260 Ga0495675_0004038 3300047444 Bacteria 8897
261 Ga0495675_0011265 3300047444 Bacteria 5609
262 Ga0495684_0005573 3300047471 Bacteria 9805
263 Ga0495684_0006470 3300047471 Bacteria 9096
264 Ga0495684_0016227 3300047471 Bacteria 5735
265 Ga0495684_0022588 3300047471 Bacteria 4837
266 Ga0495593_0006549 3300047673 Bacteria 6817
267 Ga0495602_0014120 3300048088 Bacteria 8123
268 Ga0495602_0017202 3300048088 Bacteria 7250
269 Ga0495614_0008731 3300048089 Bacteria 4502
270 Ga0496104_0010958 3300048907 Bacteria 8112
271 Ga0496105_0087307 3300048908 Bacteria 2577
272 Ga0496110_0035672 3300048913 Bacteria 4316
273 Ga0501036_0074709 3300049572 Bacteria 2867
274 Ga0501037_0022023 3300049573 Bacteria 4718
275 Ga0501039_0006458 3300049575 Bacteria 8912
276 Ga0501040_0092372 3300049576 Bacteria 2104
277 Ga0501041_0078751 3300049577 Bacteria 2028
278 Ga0501042_0119991 3300049578 Bacteria 1893
279 Ga0501075_0027210 3300049591 Bacteria 4213
280 Ga0501076_0018710 3300049592 Bacteria 5287
281 Ga0501079_0099539 3300049741 Bacteria 2253
282 Ga0501080_0013889 3300049742 Bacteria 7413
283 Ga0501081_0029797 3300049743 Bacteria 3690
284 Ga0501083_0094978 3300049744 Bacteria 1968
285 Ga0501045_0106506 3300049824 Bacteria 2077
286 nmdc:mga05p37_15405_c1 3300050507 Bacteria 9186
287 nmdc:mga05p37_240423_c1 3300050507 Bacteria 2177
288 nmdc:mga05p37_316482_c1 3300050507 Bacteria 1848
289 nmdc:mga09592_325939_c1 3300050508 Bacteria 1330
290 nmdc:mga0n895_190241_c1 3300050512 Bacteria 2083
291 nmdc:mga0rr50_34569_c1 3300050513 Bacteria 3620
292 nmdc:mga0a205_22585_c2 3300050515 Bacteria 4325
293 Ga0495612_0021599 3300053078 Unclassified 2581
294 Ga0495595_0012965 3300053084 Bacteria 3517
295 Ga0495619_0017398 3300053085 Bacteria 4551
296 Ga0500566_0010490 3300053094 Bacteria 5463
297 Ga0500640_009277 3300053095 Bacteria 3926
298 Ga0500554_000671 3300053102 Bacteria 6930
299 Ga0500595_001681 3300053119 Bacteria 11631
300 Ga0500597_004677 3300053120 Bacteria 4289
301 Ga0500614_000671 3300053123 Bacteria 8749
302 Ga0500642_0009277 3300053130 Bacteria 3407
303 Ga0500559_0011412 3300053136 Bacteria 3795
304 Ga0500603_007520 3300053150 Bacteria 2395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100014578 Ga0068859_1000145785 394
2 3300006931 Ga0097620_100014578 Ga0097620_1000145785 394
3 3300026118 Ga0207675_100340541 Ga0207675_1003405412 394
4 3300049573 Ga0501037_0022023 Ga0501037_0022023_16_1206 396
5 3300049577 Ga0501041_0078751 Ga0501041_0078751_17_1207 396
6 3300050508 nmdc:mga09592_325939_c1 nmdc:mga09592_325939_c1_29_1279 396
7 3300009147 Ga0114129_10086117 Ga0114129_100861172 397
8 3300005530 Ga0070679_100150511 Ga0070679_1001505112 421
9 3300049741 Ga0501079_0099539 Ga0501079_0099539_876_2216 425
10 3300009147 Ga0114129_10018927 Ga0114129_100189277 429
11 3300050507 nmdc:mga05p37_15405_c1 nmdc:mga05p37_15405_c1_3301_4698 429
12 3300005354 Ga0070675_100002103 Ga0070675_1000021039 430
13 3300025926 Ga0207659_10001692 Ga0207659_100016924 430
14 3300009093 Ga0105240_10060414 Ga0105240_100604142 432
15 3300025913 Ga0207695_10055698 Ga0207695_100556983 432
16 3300009093 Ga0105240_10096267 Ga0105240_100962672 433
17 3300009093 Ga0105240_10185880 Ga0105240_101858802 433
18 3300009147 Ga0114129_10295428 Ga0114129_102954282 433
19 3300014969 Ga0157376_10045622 Ga0157376_100456223 433
20 3300031241 Ga0265325_10040996 Ga0265325_100409961 433
21 3300031595 Ga0265313_10022359 Ga0265313_100223592 433
22 3300050507 nmdc:mga05p37_240423_c1 nmdc:mga05p37_240423_c1_378_1862 433
23 3300050513 nmdc:mga0rr50_34569_c1 nmdc:mga0rr50_34569_c1_1585_3069 433
24 3300005344 Ga0070661_100033102 Ga0070661_1000331024 434
25 3300005458 Ga0070681_10065133 Ga0070681_100651332 434
26 3300005518 Ga0070699_100010563 Ga0070699_1000105637 434
27 3300009545 Ga0105237_10162518 Ga0105237_101625182 434
28 3300013307 Ga0157372_10012465 Ga0157372_100124657 434
29 3300025898 Ga0207692_10020754 Ga0207692_100207542 434
30 3300005329 Ga0070683_100020205 Ga0070683_1000202052 435
31 3300005366 Ga0070659_100034295 Ga0070659_1000342953 435
32 3300005614 Ga0068856_100005376 Ga0068856_1000053767 435
33 3300009174 Ga0105241_10013008 Ga0105241_100130084 435
34 3300010375 Ga0105239_10265957 Ga0105239_102659571 435
35 3300013100 Ga0157373_10008668 Ga0157373_100086685 435
36 3300013102 Ga0157371_10056331 Ga0157371_100563312 435
37 3300025909 Ga0207705_10084368 Ga0207705_100843682 435
38 3300025912 Ga0207707_10001150 Ga0207707_1000115021 435
39 3300025919 Ga0207657_10000213 Ga0207657_1000021354 435
40 3300025921 Ga0207652_10079419 Ga0207652_100794193 435
41 3300025924 Ga0207694_10014532 Ga0207694_100145324 435
42 3300025949 Ga0207667_10031154 Ga0207667_100311543 435
43 3300026116 Ga0207674_10000045 Ga0207674_100000453 435
44 3300026142 Ga0207698_10018294 Ga0207698_100182941 435
45 3300005616 Ga0068852_100000428 Ga0068852_10000042825 436
46 3300005834 Ga0068851_10004535 Ga0068851_100045353 436
47 3300006237 Ga0097621_100083939 Ga0097621_1000839392 436
48 3300006358 Ga0068871_100008909 Ga0068871_1000089096 436
49 3300009177 Ga0105248_10037397 Ga0105248_100373972 436
50 3300013296 Ga0157374_10132578 Ga0157374_101325781 436
51 3300025321 Ga0207656_10000827 Ga0207656_100008274 436
52 3300025941 Ga0207711_10044979 Ga0207711_100449794 436
53 3300026142 Ga0207698_10001727 Ga0207698_100017276 436
54 3300048907 Ga0496104_0010958 Ga0496104_0010958_267_1688 436
55 3300048908 Ga0496105_0087307 Ga0496105_0087307_23_1444 436
56 3300048913 Ga0496110_0035672 Ga0496110_0035672_1483_2904 436
57 3300006871 Ga0075434_100045898 Ga0075434_1000458981 437
58 3300050512 nmdc:mga0n895_190241_c1 nmdc:mga0n895_190241_c1_115_1563 437
59 3300014745 Ga0157377_10026309 Ga0157377_100263092 439
60 3300005471 Ga0070698_100074046 Ga0070698_1000740462 440
61 3300005327 Ga0070658_10137621 Ga0070658_101376211 441
62 3300005354 Ga0070675_100011981 Ga0070675_1000119812 441
63 3300005355 Ga0070671_100031169 Ga0070671_1000311693 441
64 3300005434 Ga0070709_10019407 Ga0070709_100194072 441
65 3300005543 Ga0070672_100032632 Ga0070672_1000326323 441
66 3300005547 Ga0070693_100000333 Ga0070693_10000033317 441
67 3300005563 Ga0068855_100021861 Ga0068855_1000218614 441
68 3300005577 Ga0068857_100079126 Ga0068857_1000791263 441
69 3300006358 Ga0068871_100059792 Ga0068871_1000597923 441
70 3300006931 Ga0097620_100181164 Ga0097620_1001811642 441
71 3300009551 Ga0105238_10341302 Ga0105238_103413021 441
72 3300013297 Ga0157378_10094850 Ga0157378_100948502 441
73 3300025906 Ga0207699_10041991 Ga0207699_100419912 441
74 3300025926 Ga0207659_10011468 Ga0207659_100114682 441
75 3300025940 Ga0207691_10002695 Ga0207691_100026956 441
76 3300025949 Ga0207667_10285856 Ga0207667_102858562 441
77 3300026116 Ga0207674_10016012 Ga0207674_100160122 441
78 3300039437 Ga0436365_1671807 Ga0436365_1671807_47_1447 441
79 3300046454 Ga0495592_0016166 Ga0495592_0016166_2923_4344 441
80 3300046477 Ga0495664_0016748 Ga0495664_0016748_1098_2519 441
81 3300046536 Ga0495587_0003695 Ga0495587_0003695_6282_7703 441
82 3300046543 Ga0495645_0002358 Ga0495645_0002358_772_2193 441
83 3300046663 Ga0495635_0061397 Ga0495635_0061397_391_1812 441
84 3300046675 Ga0495657_0032281 Ga0495657_0032281_742_2163 441
85 3300046679 Ga0495623_0017445 Ga0495623_0017445_181_1602 441
86 3300046809 Ga0495600_0029327 Ga0495600_0029327_650_2071 441
87 3300047317 Ga0495604_0017613 Ga0495604_0017613_1870_3291 441
88 3300047471 Ga0495684_0016227 Ga0495684_0016227_1584_3005 441
89 3300053084 Ga0495595_0012965 Ga0495595_0012965_1867_3288 441
90 3300053085 Ga0495619_0017398 Ga0495619_0017398_2185_3606 441
91 3300005330 Ga0070690_100026732 Ga0070690_1000267323 442
92 3300005335 Ga0070666_10011333 Ga0070666_100113333 442
93 3300005364 Ga0070673_100059846 Ga0070673_1000598462 442
94 3300005367 Ga0070667_100006082 Ga0070667_1000060824 442
95 3300005564 Ga0070664_100002466 Ga0070664_1000024663 442
96 3300005841 Ga0068863_100014123 Ga0068863_1000141237 442
97 3300009177 Ga0105248_10062449 Ga0105248_100624492 442
98 3300013306 Ga0163162_10116538 Ga0163162_101165381 442
99 3300013307 Ga0157372_10349200 Ga0157372_103492002 442
100 3300013308 Ga0157375_10134705 Ga0157375_101347052 442
101 3300014325 Ga0163163_10025581 Ga0163163_100255812 442
102 3300014325 Ga0163163_10044452 Ga0163163_100444522 442
103 3300025909 Ga0207705_10026237 Ga0207705_100262374 442
104 3300025921 Ga0207652_10047461 Ga0207652_100474613 442
105 3300025925 Ga0207650_10009805 Ga0207650_100098052 442
106 3300028786 Ga0307517_10076555 Ga0307517_100765552 442
107 3300005331 Ga0070670_100001958 Ga0070670_10000195814 443
108 3300005338 Ga0068868_100001201 Ga0068868_1000012016 443
109 3300005340 Ga0070689_100015285 Ga0070689_1000152854 443
110 3300005344 Ga0070661_100022709 Ga0070661_1000227094 443
111 3300005354 Ga0070675_100016718 Ga0070675_1000167183 443
112 3300005355 Ga0070671_100007166 Ga0070671_1000071661 443
113 3300005355 Ga0070671_100016443 Ga0070671_1000164434 443
114 3300005366 Ga0070659_100024367 Ga0070659_1000243672 443
115 3300005367 Ga0070667_100066513 Ga0070667_1000665132 443
116 3300005439 Ga0070711_100124028 Ga0070711_1001240282 443
117 3300005445 Ga0070708_100060073 Ga0070708_1000600732 443
118 3300005466 Ga0070685_10039948 Ga0070685_100399482 443
119 3300005468 Ga0070707_100012031 Ga0070707_1000120315 443
120 3300005539 Ga0068853_100126209 Ga0068853_1001262091 443
121 3300005543 Ga0070672_100022743 Ga0070672_1000227434 443
122 3300005544 Ga0070686_100028468 Ga0070686_1000284683 443
123 3300005563 Ga0068855_100099275 Ga0068855_1000992752 443
124 3300005616 Ga0068852_100006584 Ga0068852_1000065843 443
125 3300005618 Ga0068864_100085059 Ga0068864_1000850593 443
126 3300005618 Ga0068864_100252652 Ga0068864_1002526521 443
127 3300005834 Ga0068851_10038547 Ga0068851_100385472 443
128 3300005841 Ga0068863_100002393 Ga0068863_10000239312 443
129 3300005843 Ga0068860_100008827 Ga0068860_1000088275 443
130 3300005985 Ga0081539_10023511 Ga0081539_100235113 443
131 3300006173 Ga0070716_100001995 Ga0070716_1000019952 443
132 3300006175 Ga0070712_100034185 Ga0070712_1000341852 443
133 3300006237 Ga0097621_100013246 Ga0097621_1000132461 443
134 3300006358 Ga0068871_100010858 Ga0068871_1000108583 443
135 3300006871 Ga0075434_100212435 Ga0075434_1002124352 443
136 3300009093 Ga0105240_10023465 Ga0105240_100234654 443
137 3300009093 Ga0105240_10075454 Ga0105240_100754544 443
138 3300009093 Ga0105240_10088770 Ga0105240_100887703 443
139 3300009177 Ga0105248_10202638 Ga0105248_102026381 443
140 3300009545 Ga0105237_10147740 Ga0105237_101477402 443
141 3300009553 Ga0105249_10042939 Ga0105249_100429392 443
142 3300011119 Ga0105246_10051399 Ga0105246_100513992 443
143 3300013105 Ga0157369_10002817 Ga0157369_100028174 443
144 3300013306 Ga0163162_10003700 Ga0163162_100037003 443
145 3300013307 Ga0157372_10004028 Ga0157372_100040282 443
146 3300013308 Ga0157375_10001019 Ga0157375_100010193 443
147 3300014325 Ga0163163_10008721 Ga0163163_100087213 443
148 3300014968 Ga0157379_10000497 Ga0157379_1000049721 443
149 3300014969 Ga0157376_10083624 Ga0157376_100836242 443
150 3300025913 Ga0207695_10033563 Ga0207695_100335635 443
151 3300025916 Ga0207663_10053184 Ga0207663_100531842 443
152 3300025926 Ga0207659_10003162 Ga0207659_100031623 443
153 3300025931 Ga0207644_10012523 Ga0207644_100125234 443
154 3300025932 Ga0207690_10044669 Ga0207690_100446693 443
155 3300025936 Ga0207670_10013349 Ga0207670_100133495 443
156 3300025936 Ga0207670_10043283 Ga0207670_100432832 443
157 3300025939 Ga0207665_10010774 Ga0207665_100107744 443
158 3300025940 Ga0207691_10035707 Ga0207691_100357072 443
159 3300025949 Ga0207667_10066621 Ga0207667_100666213 443
160 3300025960 Ga0207651_10149031 Ga0207651_101490311 443
161 3300025986 Ga0207658_10022716 Ga0207658_100227163 443
162 3300026088 Ga0207641_10001278 Ga0207641_100012783 443
163 3300026088 Ga0207641_10062731 Ga0207641_100627313 443
164 3300026095 Ga0207676_10071495 Ga0207676_100714953 443
165 3300026142 Ga0207698_10050599 Ga0207698_100505993 443
166 3300028381 Ga0268264_10011172 Ga0268264_100111725 443
167 3300028794 Ga0307515_10001245 Ga0307515_1000124543 443
168 3300031250 Ga0265331_10024892 Ga0265331_100248922 443
169 3300031730 Ga0307516_10016892 Ga0307516_100168924 443
170 3300035083 Ga0373926_0007793 Ga0373926_0007793_511_2004 443
171 3300035090 Ga0373949_0000098 Ga0373949_0000098_3552_5084 443
172 3300035113 Ga0373936_0000003 Ga0373936_0000003_171778_173295 443
173 3300035117 Ga0373953_0041252 Ga0373953_0041252_20_1582 443
174 3300035118 Ga0373954_0010186 Ga0373954_0010186_651_2150 443
175 3300035118 Ga0373954_0013872 Ga0373954_0013872_1074_2567 443
176 3300035241 Ga0373961_0000008 Ga0373961_0000008_99815_101326 443
177 3300035692 Ga0373935_0009365 Ga0373935_0009365_2213_3706 443
178 3300035695 Ga0373927_0022351 Ga0373927_0022351_1872_3365 443
179 3300035724 Ga0373933_0041932 Ga0373933_0041932_819_2312 443
180 3300036401 Ga0373937_0045605 Ga0373937_0045605_2012_3505 443
181 3300046454 Ga0495592_0003093 Ga0495592_0003093_3099_4592 443
182 3300046454 Ga0495592_0011314 Ga0495592_0011314_3927_5420 443
183 3300046454 Ga0495592_0096820 Ga0495592_0096820_356_1849 443
184 3300046462 Ga0495651_0003062 Ga0495651_0003062_5918_7411 443
185 3300046462 Ga0495651_0014672 Ga0495651_0014672_2674_4167 443
186 3300046463 Ga0495653_0012604 Ga0495653_0012604_3910_5403 443
187 3300046463 Ga0495653_0026764 Ga0495653_0026764_1258_2751 443
188 3300046472 Ga0495580_0006274 Ga0495580_0006274_985_2478 443
189 3300046472 Ga0495580_0087931 Ga0495580_0087931_414_1907 443
190 3300046477 Ga0495664_0008583 Ga0495664_0008583_3860_5353 443
191 3300046477 Ga0495664_0012010 Ga0495664_0012010_499_1992 443
192 3300046511 Ga0495608_0009050 Ga0495608_0009050_629_2122 443
193 3300046511 Ga0495608_0040268 Ga0495608_0040268_764_2257 443
194 3300046514 Ga0495618_0029706 Ga0495618_0029706_1833_3326 443
195 3300046514 Ga0495618_0069389 Ga0495618_0069389_731_2224 443
196 3300046516 Ga0495628_0000744 Ga0495628_0000744_9413_10906 443
197 3300046516 Ga0495628_0066519 Ga0495628_0066519_88_1587 443
198 3300046517 Ga0495630_0030780 Ga0495630_0030780_1454_2947 443
199 3300046529 Ga0495652_0000313 Ga0495652_0000313_26085_27578 443
200 3300046529 Ga0495652_0021875 Ga0495652_0021875_1627_3120 443
201 3300046531 Ga0495665_0016177 Ga0495665_0016177_836_2329 443
202 3300046533 Ga0495640_0041865 Ga0495640_0041865_679_2172 443
203 3300046535 Ga0495586_0000358 Ga0495586_0000358_10599_12092 443
204 3300046536 Ga0495587_0019835 Ga0495587_0019835_2375_3868 443
205 3300046543 Ga0495645_0003925 Ga0495645_0003925_1725_3218 443
206 3300046559 Ga0495667_0000931 Ga0495667_0000931_50_1543 443
207 3300046559 Ga0495667_0003902 Ga0495667_0003902_4429_5922 443
208 3300046642 Ga0495634_0066985 Ga0495634_0066985_55_1548 443
209 3300046663 Ga0495635_0004724 Ga0495635_0004724_433_1926 443
210 3300046663 Ga0495635_0055538 Ga0495635_0055538_42_1535 443
211 3300046675 Ga0495657_0024097 Ga0495657_0024097_1140_2633 443
212 3300046675 Ga0495657_0046566 Ga0495657_0046566_270_1763 443
213 3300046678 Ga0495599_0009712 Ga0495599_0009712_3676_5169 443
214 3300046679 Ga0495623_0033364 Ga0495623_0033364_1701_3194 443
215 3300046680 Ga0495646_0020073 Ga0495646_0020073_2103_3596 443
216 3300046680 Ga0495646_0080545 Ga0495646_0080545_289_1782 443
217 3300046689 Ga0495613_0016224 Ga0495613_0016224_1593_3086 443
218 3300046809 Ga0495600_0010457 Ga0495600_0010457_1540_3033 443
219 3300047317 Ga0495604_0014614 Ga0495604_0014614_2812_4311 443
220 3300047317 Ga0495604_0032378 Ga0495604_0032378_1387_2880 443
221 3300047319 Ga0495674_0001215 Ga0495674_0001215_18933_20426 443
222 3300047319 Ga0495674_0061085 Ga0495674_0061085_1050_2543 443
223 3300047322 Ga0495680_0000182 Ga0495680_0000182_21_1514 443
224 3300047322 Ga0495680_0016505 Ga0495680_0016505_3124_4617 443
225 3300047444 Ga0495675_0001698 Ga0495675_0001698_7382_8875 443
226 3300047444 Ga0495675_0004038 Ga0495675_0004038_5214_6707 443
227 3300047444 Ga0495675_0011265 Ga0495675_0011265_2440_3939 443
228 3300047471 Ga0495684_0005573 Ga0495684_0005573_989_2560 443
229 3300047471 Ga0495684_0006470 Ga0495684_0006470_2329_3822 443
230 3300047471 Ga0495684_0022588 Ga0495684_0022588_484_1977 443
231 3300047673 Ga0495593_0006549 Ga0495593_0006549_1338_2831 443
232 3300048088 Ga0495602_0014120 Ga0495602_0014120_4372_5865 443
233 3300048088 Ga0495602_0017202 Ga0495602_0017202_1872_3365 443
234 3300048089 Ga0495614_0008731 Ga0495614_0008731_1527_3020 443
235 3300050515 nmdc:mga0a205_22585_c2 nmdc:mga0a205_22585_c2_2429_3913 443
236 3300053078 Ga0495612_0021599 Ga0495612_0021599_460_1953 443
237 3300053094 Ga0500566_0010490 Ga0500566_0010490_74_1597 443
238 3300053095 Ga0500640_009277 Ga0500640_009277_1449_2972 443
239 3300053102 Ga0500554_000671 Ga0500554_000671_1812_3335 443
240 3300053119 Ga0500595_001681 Ga0500595_001681_8730_10253 443
241 3300053120 Ga0500597_004677 Ga0500597_004677_237_1763 443
242 3300053123 Ga0500614_000671 Ga0500614_000671_7037_8560 443
243 3300053130 Ga0500642_0009277 Ga0500642_0009277_838_2346 443
244 3300053136 Ga0500559_0011412 Ga0500559_0011412_1040_2563 443
245 3300053150 Ga0500603_007520 Ga0500603_007520_735_2261 443
246 3300005436 Ga0070713_100078044 Ga0070713_1000780443 444
247 3300005842 Ga0068858_100004764 Ga0068858_1000047644 444
248 3300014968 Ga0157379_10005203 Ga0157379_100052036 444
249 3300005466 Ga0070685_10048595 Ga0070685_100485952 445
250 3300005467 Ga0070706_100065976 Ga0070706_1000659762 445
251 3300005468 Ga0070707_100064567 Ga0070707_1000645672 445
252 3300005617 Ga0068859_100004949 Ga0068859_1000049499 445
253 3300005618 Ga0068864_100142825 Ga0068864_1001428252 445
254 3300006028 Ga0070717_10050397 Ga0070717_100503972 445
255 3300006931 Ga0097620_100004949 Ga0097620_1000049499 445
256 3300009553 Ga0105249_10085577 Ga0105249_100855772 445
257 3300025910 Ga0207684_10069821 Ga0207684_100698212 445
258 3300025926 Ga0207659_10004197 Ga0207659_100041973 445
259 3300025961 Ga0207712_10088423 Ga0207712_100884232 445
260 3300005434 Ga0070709_10025550 Ga0070709_100255502 446
261 3300005436 Ga0070713_100000426 Ga0070713_10000042622 446
262 3300005436 Ga0070713_100133800 Ga0070713_1001338002 446
263 3300005445 Ga0070708_100046411 Ga0070708_1000464113 446
264 3300005445 Ga0070708_100080843 Ga0070708_1000808432 446
265 3300005445 Ga0070708_100085885 Ga0070708_1000858853 446
266 3300005468 Ga0070707_100122094 Ga0070707_1001220941 446
267 3300005518 Ga0070699_100068194 Ga0070699_1000681942 446
268 3300005618 Ga0068864_100207552 Ga0068864_1002075521 446
269 3300006028 Ga0070717_10002030 Ga0070717_100020303 446
270 3300006028 Ga0070717_10096802 Ga0070717_100968022 446
271 3300006028 Ga0070717_10118918 Ga0070717_101189182 446
272 3300009177 Ga0105248_10010481 Ga0105248_100104812 446
273 3300014325 Ga0163163_10018141 Ga0163163_100181412 446
274 3300014968 Ga0157379_10210225 Ga0157379_102102252 446
275 3300014969 Ga0157376_10011260 Ga0157376_100112603 446
276 3300025922 Ga0207646_10014761 Ga0207646_100147614 446
277 3300025928 Ga0207700_10000035 Ga0207700_1000003518 446
278 3300025941 Ga0207711_10006777 Ga0207711_100067774 446
279 3300044684 Ga0466966_0085857 Ga0466966_0085857_429_1886 446
280 3300046472 Ga0495580_0033860 Ga0495580_0033860_975_2414 446
281 3300050507 nmdc:mga05p37_316482_c1 nmdc:mga05p37_316482_c1_118_1566 446
282 3300005328 Ga0070676_10086499 Ga0070676_100864992 447
283 3300005336 Ga0070680_100109643 Ga0070680_1001096431 447
284 3300005618 Ga0068864_100030080 Ga0068864_1000300801 447
285 3300005842 Ga0068858_100185142 Ga0068858_1001851421 447
286 3300006173 Ga0070716_100064578 Ga0070716_1000645782 447
287 3300009093 Ga0105240_10137804 Ga0105240_101378043 447
288 3300013104 Ga0157370_10009300 Ga0157370_100093005 447
289 3300013306 Ga0163162_10086079 Ga0163162_100860792 447
290 3300005563 Ga0068855_100310196 Ga0068855_1003101962 448
291 3300045836 Ga0466958_0031374 Ga0466958_0031374_721_2187 448
292 3300005614 Ga0068856_100160685 Ga0068856_1001606852 449
293 3300026078 Ga0207702_10051998 Ga0207702_100519983 449
294 3300049572 Ga0501036_0074709 Ga0501036_0074709_1126_2550 449
295 3300049575 Ga0501039_0006458 Ga0501039_0006458_2465_3889 449
296 3300049576 Ga0501040_0092372 Ga0501040_0092372_575_1999 449
297 3300049578 Ga0501042_0119991 Ga0501042_0119991_407_1831 449
298 3300049591 Ga0501075_0027210 Ga0501075_0027210_1150_2574 449
299 3300049592 Ga0501076_0018710 Ga0501076_0018710_1874_3298 449
300 3300049742 Ga0501080_0013889 Ga0501080_0013889_1513_2937 449
301 3300049743 Ga0501081_0029797 Ga0501081_0029797_417_1841 449
302 3300049744 Ga0501083_0094978 Ga0501083_0094978_278_1702 449
303 3300049824 Ga0501045_0106506 Ga0501045_0106506_503_1927 449
304 3300003323 rootH1_10197991 rootH1_101979913 450

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03972

MmgE_PrpD_N

MmgE/PrpD N-terminal domain

73

323

0.94

PF19305

MmgE_PrpD_C

MmgE/PrpD C-terminal domain

344

514

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8836 6 438
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.856 6 438
6r6t-assembly1.cif.gz_A crystal structure of mouse cis-aconitate decarboxylase 0.8455 5 442
6r6t-assembly1.cif.gz_B crystal structure of mouse cis-aconitate decarboxylase 0.8399 1 441
5mvi-assembly3.cif.gz_B crystal structure of 2-methylcitrate dehydratase (prpd) from salmonella enterica 0.83 5 228
ID Description Score Start End Superfamily
af_Q9BZW8_18_127_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8912 367 384 2.60.40.10
3gyxB02 Special;Other non-globular;Signal recognition particle alu RNA binding heterodimer, srp9/1;Adenylylsulphate reductase, beta subunit, C-terminal domain 0.8793 367 383 6.20.260.10
af_Q9VS89_1464_1536_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8763 367 383 2.60.40.10
af_Q9ET39_36_143_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8724 367 383 2.60.40.10
2hp3B01 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.8685 6 256 1.10.4100.10
ID Description Score Start End GO Terms
AF-A0A535FVC4-F1-model_v4 MmgE/PrpD family protein 0.9445 2 441 GO:0016829
AF-A0A7V3H6K3-F1-model_v4 MmgE/PrpD family protein 0.9395 6 175 GO:0016829
AF-A0A410HXG9-F1-model_v4 Copper-containing nitrite reductase 0.9384 103 250 GO:0016829
AF-A0A523WYH3-F1-model_v4 MmgE/PrpD family protein 0.933 4 443 GO:0016829
AF-A0A448J798-F1-model_v4 MmgE/PrpD family protein 0.9296 86 215 GO:0016829

Feature Viewer

pLDDT pTM Quality
81.71 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map