F397463

General Info

Members Datasets Scaffolds Average Seq Length
304 200 608 133

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_102159697|Ga0070699_1021596971
Length 149
Sequence MGDWPQLAVWGQSPYRRGMTKRLRGSCLCGEVQYTVADEFQYALICHCSQCRRATGSAFKPFGGIERAKLEVAQGTIRIYGDVMTHDAHCKNCGSLLYSIVQEGTRAHVTYGTLIDPPTLHPQAHICVASKAPWDPILDDLPQHAELPA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
196 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
197 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
198 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
199 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
200 643692032 Sinorhizobium fredii NGR234 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.99
Rhizoplane 15.46
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_102159697 3300005518 Bacteria 508
2 rootH2_10051632 3300003320 Bacteria 3480
3 rootL2_10019404 3300003322 Bacteria 4927
4 Ga0070676_10642964 3300005328 Bacteria 769
5 Ga0070683_100083105 3300005329 Bacteria 2999
6 Ga0070690_100303811 3300005330 Bacteria 1145
7 Ga0070677_10176847 3300005333 Bacteria 1013
8 Ga0068869_100187597 3300005334 Bacteria 1624
9 Ga0068869_100572844 3300005334 Bacteria 951
10 Ga0068869_101385596 3300005334 Bacteria 622
11 Ga0070680_100101310 3300005336 Bacteria 2391
12 Ga0070680_100318511 3300005336 Bacteria 1320
13 Ga0070682_100712889 3300005337 Bacteria 806
14 Ga0068868_100939798 3300005338 Bacteria 788
15 Ga0070691_10112040 3300005341 Bacteria 1366
16 Ga0070691_10413564 3300005341 Unclassified 762
17 Ga0070675_100170233 3300005354 Bacteria 1878
18 Ga0070675_101228526 3300005354 Unclassified 690
19 Ga0070673_100290639 3300005364 Bacteria 1436
20 Ga0070673_101095498 3300005364 Bacteria 744
21 Ga0070713_101052881 3300005436 Bacteria 786
22 Ga0070701_10576283 3300005438 Bacteria 742
23 Ga0070711_100109023 3300005439 Bacteria 2029
24 Ga0070705_101378419 3300005440 Bacteria 587
25 Ga0070700_100146642 3300005441 Bacteria 1609
26 Ga0070700_100230451 3300005441 Bacteria 1318
27 Ga0070700_100241917 3300005441 Bacteria 1290
28 Ga0070694_101440124 3300005444 Bacteria 582
29 Ga0070663_100431576 3300005455 Bacteria 1083
30 Ga0070663_100872492 3300005455 Bacteria 776
31 Ga0070681_10415198 3300005458 Bacteria 1257
32 Ga0068867_100622158 3300005459 Bacteria 944
33 Ga0068867_100724409 3300005459 Bacteria 880
34 Ga0070685_10014043 3300005466 Bacteria 4237
35 Ga0070685_10970260 3300005466 Bacteria 636
36 Ga0070698_101882265 3300005471 Bacteria 551
37 Ga0070679_100075639 3300005530 Unclassified 3357
38 Ga0070684_100093405 3300005535 Bacteria 2678
39 Ga0070684_100431748 3300005535 Bacteria 1216
40 Ga0068853_101692682 3300005539 Bacteria 613
41 Ga0070672_100005906 3300005543 Bacteria 8165
42 Ga0070696_100287270 3300005546 Bacteria 1255
43 Ga0070693_100063997 3300005547 Bacteria 2145
44 Ga0070665_100905420 3300005548 Bacteria 895
45 Ga0070665_101068824 3300005548 Bacteria 819
46 Ga0070704_100542776 3300005549 Bacteria 1015
47 Ga0070704_100583982 3300005549 Unclassified 980
48 Ga0068855_100175062 3300005563 Bacteria 2428
49 Ga0068857_101688382 3300005577 Unclassified 619
50 Ga0068854_100197645 3300005578 Bacteria 1579
51 Ga0068854_100492288 3300005578 Bacteria 1031
52 Ga0068856_100508589 3300005614 Bacteria 1226
53 Ga0068856_102008443 3300005614 Bacteria 588
54 Ga0070702_101088746 3300005615 Bacteria 638
55 Ga0068852_101097875 3300005616 Bacteria 816
56 Ga0068859_100932694 3300005617 Bacteria 952
57 Ga0068859_102000105 3300005617 Unclassified 640
58 Ga0068864_100653189 3300005618 Bacteria 1024
59 Ga0068861_100174264 3300005719 Bacteria 1785
60 Ga0068861_100338491 3300005719 Bacteria 1316
61 Ga0068861_100996290 3300005719 Bacteria 800
62 Ga0068863_100100811 3300005841 Bacteria 2745
63 Ga0068863_101005139 3300005841 Bacteria 837
64 Ga0068860_100094482 3300005843 Bacteria 2850
65 Ga0068862_100051104 3300005844 Unclassified 3535
66 Ga0068862_100470346 3300005844 Bacteria 1188
67 Ga0081538_10003050 3300005981 Bacteria 15958
68 Ga0081540_1002976 3300005983 Bacteria 13581
69 Ga0081540_1014913 3300005983 Bacteria 4944
70 Ga0081540_1294006 3300005983 Bacteria 559
71 Ga0070717_10029790 3300006028 Bacteria 4383
72 Ga0075432_10016495 3300006058 Bacteria 2520
73 Ga0097621_101774078 3300006237 Bacteria 588
74 Ga0068871_101273975 3300006358 Bacteria 691
75 Ga0075428_100036860 3300006844 Bacteria 5385
76 Ga0075428_101270139 3300006844 Bacteria 775
77 Ga0075428_102359020 3300006844 Bacteria 547
78 Ga0075430_100029250 3300006846 Bacteria 4676
79 Ga0075430_100271899 3300006846 Unclassified 1402
80 Ga0075431_100171547 3300006847 Bacteria 2228
81 Ga0075431_100212322 3300006847 Bacteria 1977
82 Ga0075433_10135806 3300006852 Bacteria 2186
83 Ga0075434_100173317 3300006871 Bacteria 2177
84 Ga0075429_100061958 3300006880 Bacteria 3259
85 Ga0068865_100143559 3300006881 Bacteria 1802
86 Ga0068865_100148425 3300006881 Bacteria 1776
87 Ga0068865_100304888 3300006881 Bacteria 1276
88 Ga0075436_100019269 3300006914 Bacteria 4675
89 Ga0097620_100932803 3300006931 Bacteria 952
90 Ga0097620_102000180 3300006931 Unclassified 640
91 Ga0111539_10063976 3300009094 Bacteria 4353
92 Ga0111539_10092279 3300009094 Bacteria 3558
93 Ga0111539_10601023 3300009094 Bacteria 1281
94 Ga0105245_10035325 3300009098 Bacteria 4435
95 Ga0105245_10141850 3300009098 Bacteria 2264
96 Ga0105245_10713682 3300009098 Bacteria 1037
97 Ga0114129_10004963 3300009147 Bacteria 18757
98 Ga0114129_10555962 3300009147 Unclassified 1492
99 Ga0105243_10184438 3300009148 Bacteria 1817
100 Ga0105243_10557272 3300009148 Bacteria 1096
101 Ga0105242_10613187 3300009176 Bacteria 1053
102 Ga0105242_11125911 3300009176 Bacteria 800
103 Ga0105248_10961094 3300009177 Bacteria 965
104 Ga0105248_12728047 3300009177 Bacteria 563
105 Ga0105238_10229706 3300009551 Bacteria 1832
106 Ga0105238_13048846 3300009551 Bacteria 503
107 Ga0105239_10042388 3300010375 Bacteria 4988
108 Ga0105239_11605728 3300010375 Bacteria 752
109 Ga0105246_10469258 3300011119 Bacteria 1062
110 Ga0105246_11731506 3300011119 Bacteria 595
111 Ga0157369_10177627 3300013105 Bacteria 2241
112 Ga0157372_10260957 3300013307 Bacteria 2012
113 Ga0157375_10014223 3300013308 Bacteria 7093
114 Ga0157375_10029035 3300013308 Bacteria 5195
115 Ga0157375_10277684 3300013308 Bacteria 1838
116 Ga0157375_11628356 3300013308 Bacteria 763
117 Ga0163163_10068150 3300014325 Bacteria 3540
118 Ga0157380_10059554 3300014326 Unclassified 3048
119 Ga0157377_10250741 3300014745 Bacteria 1147
120 Ga0157376_11200246 3300014969 Bacteria 787
121 Ga0207699_10489450 3300025906 Unclassified 887
122 Ga0207645_10818891 3300025907 Bacteria 633
123 Ga0207707_10120135 3300025912 Bacteria 2297
124 Ga0207693_10069195 3300025915 Unclassified 2762
125 Ga0207660_11689985 3300025917 Bacteria 509
126 Ga0207652_10272229 3300025921 Bacteria 1527
127 Ga0207681_11122208 3300025923 Unclassified 660
128 Ga0207659_10061646 3300025926 Bacteria 2704
129 Ga0207659_10620696 3300025926 Bacteria 922
130 Ga0207687_10113986 3300025927 Bacteria 2011
131 Ga0207687_10432757 3300025927 Bacteria 1088
132 Ga0207687_11492459 3300025927 Bacteria 581
133 Ga0207700_10127043 3300025928 Bacteria 2076
134 Ga0207644_10222168 3300025931 Bacteria 1498
135 Ga0207686_10583710 3300025934 Bacteria 878
136 Ga0207686_10690509 3300025934 Bacteria 811
137 Ga0207709_10148338 3300025935 Bacteria 1621
138 Ga0207709_10206831 3300025935 Bacteria 1406
139 Ga0207709_11025644 3300025935 Bacteria 675
140 Ga0207704_10906889 3300025938 Bacteria 741
141 Ga0207704_11232827 3300025938 Bacteria 638
142 Ga0207665_10844553 3300025939 Bacteria 725
143 Ga0207691_10004139 3300025940 Bacteria 14093
144 Ga0207711_11645285 3300025941 Bacteria 585
145 Ga0207689_10507475 3300025942 Bacteria 1011
146 Ga0207661_11050291 3300025944 Bacteria 750
147 Ga0207667_10266704 3300025949 Bacteria 1751
148 Ga0207712_11466026 3300025961 Unclassified 611
149 Ga0207668_10449789 3300025972 Bacteria 1099
150 Ga0207640_10243522 3300025981 Bacteria 1391
151 Ga0207640_12103872 3300025981 Bacteria 512
152 Ga0207677_10889390 3300026023 Bacteria 802
153 Ga0207677_11110620 3300026023 Bacteria 721
154 Ga0207678_10246143 3300026067 Bacteria 1531
155 Ga0207678_10416892 3300026067 Bacteria 1164
156 Ga0207708_10115592 3300026075 Unclassified 2087
157 Ga0207708_10128978 3300026075 Bacteria 1976
158 Ga0207708_10256016 3300026075 Bacteria 1412
159 Ga0207702_10752302 3300026078 Bacteria 962
160 Ga0207641_11503687 3300026088 Bacteria 675
161 Ga0207648_10145356 3300026089 Bacteria 2091
162 Ga0207648_10190111 3300026089 Unclassified 1819
163 Ga0207648_12233698 3300026089 Bacteria 508
164 Ga0207676_11027679 3300026095 Bacteria 813
165 Ga0207674_11464033 3300026116 Unclassified 652
166 Ga0207675_100220681 3300026118 Bacteria 1826
167 Ga0207683_10061161 3300026121 Bacteria 3314
168 Ga0207683_11441803 3300026121 Bacteria 636
169 Ga0207698_10793930 3300026142 Bacteria 948
170 Ga0209966_1039808 3300027695 Bacteria 977
171 Ga0209998_10003172 3300027717 Bacteria 3635
172 Ga0207428_10003050 3300027907 Bacteria 16488
173 Ga0268266_10315848 3300028379 Bacteria 1461
174 Ga0268265_10009877 3300028380 Bacteria 6447
175 Ga0268265_10735206 3300028380 Bacteria 956
176 Ga0268265_12148815 3300028380 Bacteria 565
177 Ga0268264_10286053 3300028381 Bacteria 1546
178 Ga0307509_10167824 3300031507 Unclassified 2080
179 Ga0307413_10518184 3300031824 Unclassified 961
180 Ga0307406_10398008 3300031901 Bacteria 1091
181 Ga0307407_10436367 3300031903 Bacteria 947
182 Ga0307415_101412055 3300032126 Bacteria 663
183 Ga0373939_0333516 3300035114 Bacteria 613
184 Ga0373941_0158251 3300035115 Bacteria 836
185 Ga0373961_0179780 3300035241 Bacteria 736
186 Ga0395899_0031717 3300037312 Bacteria 3970
187 Ga0395900_0000049 3300037418 Bacteria 226847
188 Ga0395900_0065389 3300037418 Bacteria 3736
189 Ga0395900_0099352 3300037418 Bacteria 2989
190 Ga0395898_0097601 3300037466 Bacteria 2822
191 Ga0395898_0126308 3300037466 Bacteria 2450
192 Ga0395905_0038231 3300037471 Bacteria 4502
193 Ga0395905_1086428 3300037471 Bacteria 703
194 Ga0395901_0009750 3300038443 Bacteria 9737
195 Ga0395901_0152448 3300038443 Bacteria 2428
196 Ga0395901_0188520 3300038443 Bacteria 2163
197 Ga0395901_0264884 3300038443 Bacteria 1788
198 Ga0451789_1276466 3300041443 Bacteria 700
199 Ga0451791_0961301 3300041451 Bacteria 665
200 Ga0451800_0811635 3300041459 Bacteria 960
201 Ga0451807_0108655 3300041486 Bacteria 543
202 Ga0451851_0380819 3300041507 Bacteria 708
203 Ga0451853_0270073 3300041512 Bacteria 537
204 Ga0439464_0281477 3300042439 Bacteria 541
205 Ga0451576_0344627 3300045051 Unclassified 1560
206 Ga0495603_0187614 3300046455 Unclassified 1196
207 Ga0495590_0007183 3300046457 Bacteria 4308
208 Ga0495638_0038550 3300046460 Bacteria 3036
209 Ga0495638_0120134 3300046460 Bacteria 1554
210 Ga0495584_0026647 3300046491 Bacteria 2929
211 Ga0495596_0041902 3300046500 Bacteria 1805
212 Ga0495616_0004822 3300046513 Bacteria 8452
213 Ga0495616_0047962 3300046513 Bacteria 2148
214 Ga0495630_0534946 3300046517 Bacteria 899
215 Ga0495632_0154818 3300046519 Bacteria 1058
216 Ga0495663_0062786 3300046525 Bacteria 1171
217 Ga0495668_0147624 3300046616 Bacteria 1287
218 Ga0495625_0043789 3300046660 Bacteria 3244
219 Ga0495649_0371432 3300046694 Bacteria 721
220 Ga0495676_0634025 3300047321 Bacteria 694
221 Ga0495686_0333791 3300047472 Unclassified 828
222 Ga0496100_0041099 3300048903 Bacteria 2945
223 Ga0496101_0066617 3300048904 Bacteria 2627
224 Ga0496101_0664113 3300048904 Bacteria 823
225 Ga0496102_0061570 3300048905 Bacteria 3435
226 Ga0496102_0099794 3300048905 Bacteria 2695
227 Ga0496103_0235393 3300048906 Bacteria 1178
228 Ga0496103_0266528 3300048906 Bacteria 1102
229 Ga0496104_0002537 3300048907 Bacteria 15723
230 Ga0496104_0028465 3300048907 Bacteria 5179
231 Ga0496104_0059793 3300048907 Bacteria 3608
232 Ga0496104_0138283 3300048907 Bacteria 2340
233 Ga0496104_1560048 3300048907 Bacteria 563
234 Ga0496105_0000750 3300048908 Bacteria 22004
235 Ga0496105_0016969 3300048908 Bacteria 5826
236 Ga0496105_0029641 3300048908 Bacteria 4480
237 Ga0496105_0180574 3300048908 Bacteria 1728
238 Ga0496106_0011442 3300048909 Bacteria 6563
239 Ga0496106_0306725 3300048909 Bacteria 1273
240 Ga0496107_0055564 3300048910 Bacteria 2859
241 Ga0496107_0098634 3300048910 Bacteria 2140
242 Ga0496108_0001283 3300048911 Bacteria 19684
243 Ga0496108_0306953 3300048911 Bacteria 1382
244 Ga0496108_0997212 3300048911 Bacteria 715
245 Ga0496109_0002052 3300048912 Bacteria 16700
246 Ga0496109_0064244 3300048912 Bacteria 3359
247 Ga0496109_0162855 3300048912 Bacteria 2090
248 Ga0496109_1173800 3300048912 Bacteria 704
249 Ga0496109_1349011 3300048912 Bacteria 649
250 Ga0496110_0000810 3300048913 Bacteria 21899
251 Ga0496110_0161151 3300048913 Bacteria 2033
252 Ga0496110_0716024 3300048913 Bacteria 903
253 Ga0496111_0052140 3300048914 Bacteria 2954
254 Ga0496111_0115792 3300048914 Bacteria 1976
255 Ga0496112_0041193 3300048915 Bacteria 4517
256 Ga0496112_0055521 3300048915 Bacteria 3895
257 Ga0496112_0092405 3300048915 Bacteria 2995
258 Ga0496112_1494802 3300048915 Bacteria 589
259 Ga0496113_0000543 3300048916 Bacteria 18656
260 Ga0496113_0006864 3300048916 Bacteria 7262
261 Ga0496114_0010315 3300048917 Bacteria 7434
262 Ga0496114_0014315 3300048917 Bacteria 6364
263 Ga0496114_0789366 3300048917 Bacteria 828
264 Ga0496115_0131746 3300048918 Bacteria 2061
265 Ga0495678_022988 3300049459 Bacteria 2718
266 Ga0495682_0058604 3300049460 Bacteria 1393
267 Ga0501033_1111455 3300049570 Bacteria 525
268 Ga0501039_0753536 3300049575 Bacteria 760
269 Ga0501067_0043856 3300049583 Bacteria 2485
270 Ga0501068_0002767 3300049584 Bacteria 9318
271 Ga0501071_0172881 3300049587 Bacteria 1617
272 Ga0501072_1101741 3300049588 Unclassified 618
273 Ga0501073_0000244 3300049589 Bacteria 35817
274 Ga0501073_0155982 3300049589 Unclassified 1582
275 Ga0501074_0004032 3300049590 Bacteria 10474
276 Ga0501076_0078949 3300049592 Bacteria 2641
277 Ga0501077_0008187 3300049593 Bacteria 6465
278 Ga0501079_0016449 3300049741 Bacteria 5647
279 Ga0501080_0001045 3300049742 Bacteria 22768
280 Ga0501083_0057430 3300049744 Bacteria 2605
281 Ga0501044_0885948 3300049823 Bacteria 768
282 nmdc:mga05p37_7995_c1 3300050507 Bacteria 12483
283 nmdc:mga05p37_927717_c1 3300050507 Bacteria 935
284 nmdc:mga09592_483742_c1 3300050508 Bacteria 1066
285 nmdc:mga09592_90007_c1 3300050508 Bacteria 2622
286 nmdc:mga0qj67_10226_c1 3300050509 Bacteria 7005
287 nmdc:mga0qj67_155631_c1 3300050509 Bacteria 1855
288 nmdc:mga06r32_369888_c1 3300050510 Bacteria 1417
289 nmdc:mga08y16_164003_c1 3300050511 Bacteria 2309
290 nmdc:mga08y16_54531_c1 3300050511 Bacteria 4177
291 nmdc:mga08y16_676116_c1 3300050511 Bacteria 1034
292 nmdc:mga0n895_7341_c1 3300050512 Bacteria 9454
293 nmdc:mga0rr50_30453_c1 3300050513 Bacteria 3821
294 nmdc:mga0rr50_721245_c1 3300050513 Bacteria 851
295 nmdc:mga08x19_32640_c1 3300050514 Bacteria 3283
296 nmdc:mga0a205_42422_c1 3300050515 Bacteria 4385
297 Ga0501082_0015317 3300060353 Bacteria 6601
298 Ga0530510_0729645 3300061734 Bacteria 755
299 2753461782 2751185821 Bacteria 6189929
300 2792619738 2791355091 Bacteria 6135441
301 2792627513 2791355092 Bacteria 6248105
302 2856288384 2856287931 Bacteria 7223934
303 2857367187 2857357740 Bacteria 9937880
304 643823385 643692032 Bacteria 6891900
305 Ga0070699_102159697
306 rootH2_10051632
307 rootL2_10019404
308 Ga0070676_10642964
309 Ga0070683_100083105
310 Ga0070690_100303811
311 Ga0070677_10176847
312 Ga0068869_100187597
313 Ga0068869_100572844
314 Ga0068869_101385596
315 Ga0070680_100101310
316 Ga0070680_100318511
317 Ga0070682_100712889
318 Ga0068868_100939798
319 Ga0070691_10112040
320 Ga0070691_10413564
321 Ga0070675_100170233
322 Ga0070675_101228526
323 Ga0070673_100290639
324 Ga0070673_101095498
325 Ga0070713_101052881
326 Ga0070701_10576283
327 Ga0070711_100109023
328 Ga0070705_101378419
329 Ga0070700_100146642
330 Ga0070700_100230451
331 Ga0070700_100241917
332 Ga0070694_101440124
333 Ga0070663_100431576
334 Ga0070663_100872492
335 Ga0070681_10415198
336 Ga0068867_100622158
337 Ga0068867_100724409
338 Ga0070685_10014043
339 Ga0070685_10970260
340 Ga0070698_101882265
341 Ga0070679_100075639
342 Ga0070684_100093405
343 Ga0070684_100431748
344 Ga0068853_101692682
345 Ga0070672_100005906
346 Ga0070696_100287270
347 Ga0070693_100063997
348 Ga0070665_100905420
349 Ga0070665_101068824
350 Ga0070704_100542776
351 Ga0070704_100583982
352 Ga0068855_100175062
353 Ga0068857_101688382
354 Ga0068854_100197645
355 Ga0068854_100492288
356 Ga0068856_100508589
357 Ga0068856_102008443
358 Ga0070702_101088746
359 Ga0068852_101097875
360 Ga0068859_100932694
361 Ga0068859_102000105
362 Ga0068864_100653189
363 Ga0068861_100174264
364 Ga0068861_100338491
365 Ga0068861_100996290
366 Ga0068863_100100811
367 Ga0068863_101005139
368 Ga0068860_100094482
369 Ga0068862_100051104
370 Ga0068862_100470346
371 Ga0081538_10003050
372 Ga0081540_1002976
373 Ga0081540_1014913
374 Ga0081540_1294006
375 Ga0070717_10029790
376 Ga0075432_10016495
377 Ga0097621_101774078
378 Ga0068871_101273975
379 Ga0075428_100036860
380 Ga0075428_101270139
381 Ga0075428_102359020
382 Ga0075430_100029250
383 Ga0075430_100271899
384 Ga0075431_100171547
385 Ga0075431_100212322
386 Ga0075433_10135806
387 Ga0075434_100173317
388 Ga0075429_100061958
389 Ga0068865_100143559
390 Ga0068865_100148425
391 Ga0068865_100304888
392 Ga0075436_100019269
393 Ga0097620_100932803
394 Ga0097620_102000180
395 Ga0111539_10063976
396 Ga0111539_10092279
397 Ga0111539_10601023
398 Ga0105245_10035325
399 Ga0105245_10141850
400 Ga0105245_10713682
401 Ga0114129_10004963
402 Ga0114129_10555962
403 Ga0105243_10184438
404 Ga0105243_10557272
405 Ga0105242_10613187
406 Ga0105242_11125911
407 Ga0105248_10961094
408 Ga0105248_12728047
409 Ga0105238_10229706
410 Ga0105238_13048846
411 Ga0105239_10042388
412 Ga0105239_11605728
413 Ga0105246_10469258
414 Ga0105246_11731506
415 Ga0157369_10177627
416 Ga0157372_10260957
417 Ga0157375_10014223
418 Ga0157375_10029035
419 Ga0157375_10277684
420 Ga0157375_11628356
421 Ga0163163_10068150
422 Ga0157380_10059554
423 Ga0157377_10250741
424 Ga0157376_11200246
425 Ga0207699_10489450
426 Ga0207645_10818891
427 Ga0207707_10120135
428 Ga0207693_10069195
429 Ga0207660_11689985
430 Ga0207652_10272229
431 Ga0207681_11122208
432 Ga0207659_10061646
433 Ga0207659_10620696
434 Ga0207687_10113986
435 Ga0207687_10432757
436 Ga0207687_11492459
437 Ga0207700_10127043
438 Ga0207644_10222168
439 Ga0207686_10583710
440 Ga0207686_10690509
441 Ga0207709_10148338
442 Ga0207709_10206831
443 Ga0207709_11025644
444 Ga0207704_10906889
445 Ga0207704_11232827
446 Ga0207665_10844553
447 Ga0207691_10004139
448 Ga0207711_11645285
449 Ga0207689_10507475
450 Ga0207661_11050291
451 Ga0207667_10266704
452 Ga0207712_11466026
453 Ga0207668_10449789
454 Ga0207640_10243522
455 Ga0207640_12103872
456 Ga0207677_10889390
457 Ga0207677_11110620
458 Ga0207678_10246143
459 Ga0207678_10416892
460 Ga0207708_10115592
461 Ga0207708_10128978
462 Ga0207708_10256016
463 Ga0207702_10752302
464 Ga0207641_11503687
465 Ga0207648_10145356
466 Ga0207648_10190111
467 Ga0207648_12233698
468 Ga0207676_11027679
469 Ga0207674_11464033
470 Ga0207675_100220681
471 Ga0207683_10061161
472 Ga0207683_11441803
473 Ga0207698_10793930
474 Ga0209966_1039808
475 Ga0209998_10003172
476 Ga0207428_10003050
477 Ga0268266_10315848
478 Ga0268265_10009877
479 Ga0268265_10735206
480 Ga0268265_12148815
481 Ga0268264_10286053
482 Ga0307509_10167824
483 Ga0307413_10518184
484 Ga0307406_10398008
485 Ga0307407_10436367
486 Ga0307415_101412055
487 Ga0373939_0333516
488 Ga0373941_0158251
489 Ga0373961_0179780
490 Ga0395899_0031717
491 Ga0395900_0000049
492 Ga0395900_0065389
493 Ga0395900_0099352
494 Ga0395898_0097601
495 Ga0395898_0126308
496 Ga0395905_0038231
497 Ga0395905_1086428
498 Ga0395901_0009750
499 Ga0395901_0152448
500 Ga0395901_0188520
501 Ga0395901_0264884
502 Ga0451789_1276466
503 Ga0451791_0961301
504 Ga0451800_0811635
505 Ga0451807_0108655
506 Ga0451851_0380819
507 Ga0451853_0270073
508 Ga0439464_0281477
509 Ga0451576_0344627
510 Ga0495603_0187614
511 Ga0495590_0007183
512 Ga0495638_0038550
513 Ga0495638_0120134
514 Ga0495584_0026647
515 Ga0495596_0041902
516 Ga0495616_0004822
517 Ga0495616_0047962
518 Ga0495630_0534946
519 Ga0495632_0154818
520 Ga0495663_0062786
521 Ga0495668_0147624
522 Ga0495625_0043789
523 Ga0495649_0371432
524 Ga0495676_0634025
525 Ga0495686_0333791
526 Ga0496100_0041099
527 Ga0496101_0066617
528 Ga0496101_0664113
529 Ga0496102_0061570
530 Ga0496102_0099794
531 Ga0496103_0235393
532 Ga0496103_0266528
533 Ga0496104_0002537
534 Ga0496104_0028465
535 Ga0496104_0059793
536 Ga0496104_0138283
537 Ga0496104_1560048
538 Ga0496105_0000750
539 Ga0496105_0016969
540 Ga0496105_0029641
541 Ga0496105_0180574
542 Ga0496106_0011442
543 Ga0496106_0306725
544 Ga0496107_0055564
545 Ga0496107_0098634
546 Ga0496108_0001283
547 Ga0496108_0306953
548 Ga0496108_0997212
549 Ga0496109_0002052
550 Ga0496109_0064244
551 Ga0496109_0162855
552 Ga0496109_1173800
553 Ga0496109_1349011
554 Ga0496110_0000810
555 Ga0496110_0161151
556 Ga0496110_0716024
557 Ga0496111_0052140
558 Ga0496111_0115792
559 Ga0496112_0041193
560 Ga0496112_0055521
561 Ga0496112_0092405
562 Ga0496112_1494802
563 Ga0496113_0000543
564 Ga0496113_0006864
565 Ga0496114_0010315
566 Ga0496114_0014315
567 Ga0496114_0789366
568 Ga0496115_0131746
569 Ga0495678_022988
570 Ga0495682_0058604
571 Ga0501033_1111455
572 Ga0501039_0753536
573 Ga0501067_0043856
574 Ga0501068_0002767
575 Ga0501071_0172881
576 Ga0501072_1101741
577 Ga0501073_0000244
578 Ga0501073_0155982
579 Ga0501074_0004032
580 Ga0501076_0078949
581 Ga0501077_0008187
582 Ga0501079_0016449
583 Ga0501080_0001045
584 Ga0501083_0057430
585 Ga0501044_0885948
586 nmdc:mga05p37_7995_c1
587 nmdc:mga05p37_927717_c1
588 nmdc:mga09592_483742_c1
589 nmdc:mga09592_90007_c1
590 nmdc:mga0qj67_10226_c1
591 nmdc:mga0qj67_155631_c1
592 nmdc:mga06r32_369888_c1
593 nmdc:mga08y16_164003_c1
594 nmdc:mga08y16_54531_c1
595 nmdc:mga08y16_676116_c1
596 nmdc:mga0n895_7341_c1
597 nmdc:mga0rr50_30453_c1
598 nmdc:mga0rr50_721245_c1
599 nmdc:mga08x19_32640_c1
600 nmdc:mga0a205_42422_c1
601 Ga0501082_0015317
602 Ga0530510_0729645
603 2753461782
604 2792619738
605 2792627513
606 2856288384
607 2857367187
608 643823385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

44

130

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8626 7 132
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7999 10 110
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.797 1 119
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7534 7 132
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7249 10 110
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8503 7 132 3.90.1590.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7991 11 104 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7985 10 110 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7976 7 132 3.90.1590.10
af_P36104_203_328_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7971 64 91 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A538EJL9-F1-model_v4 GFA family protein 0.994 9 136 GO:0016846
GO:0046872
AF-A0A538GST4-F1-model_v4 GFA family protein 0.9912 9 136 GO:0016846
GO:0046872
AF-A0A3A5KTB7-F1-model_v4 GFA family protein 0.9887 2 136 GO:0016846
GO:0046872
AF-A0A660L9J7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9873 6 136 GO:0016846
GO:0046872
AF-A0A7W9BG56-F1-model_v4 CENP-V/GFA domain-containing protein 0.9869 2 137 GO:0016846
GO:0046872

Map