F397374

General Info

Members Datasets Scaffolds Average Seq Length
304 176 609 378

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10053982|rootH1_1005398214
Length 413
Sequence MNNTPPKTDTINKLTLRIAVGAMFFMAGLSFSSWASRIATVQQNLGLSDAGLGAVLFALPVGLMCSLPFSGWIITKIGSKKLAIGALLVYAAALVSLGLAQNTFQLIVCLLCFGFSSNSVNIAVNTQAVATEQLYQRPIMAFFHGLWSLAGFVGAGIATFIMIANRISPFHHFTIMLVVIAIGVAVAARYLKDDKVTDAGPVFVMPDKSLITLGIIAFCSMICEGAMFDWSVIYFKKVVLAPVELEGIGFTTFMLTMAGGRFVADWFAHKFGLKRTLQVSGSLTATGLLIAVAFPYVYTAMAGFLLVGAGVSSVVPMVYSAAGKSKTMSPGVALAAVSTIGFMGFLVGPPVIGFIAGIATLRASFILIACMGISVVVVSTMAKINSDNTKEELPGETATVDFSPPVPNPQQQD

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
166 2738541283 Pedobacter sp. OK701 Isolate Unclassified
167 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
168 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
169 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
170 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
171 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
172 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
173 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
174 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
175 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
176 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0
Isolates 3.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 0.66
Rhizosphere 84.87
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10053982 3300003316 Bacteria 24639
2 JGI24737J22298_10002562 3300001990 Bacteria 6450
3 JGI24737J22298_10006475 3300001990 Unclassified 3999
4 JGI24735J21928_10000168 3300002067 Bacteria 23435
5 JGI25162J39368_1000047 3300002737 Viruses 167507
6 JGI25162J39368_1000183 3300002737 Bacteria 67086
7 JGI25165J46597_1003847 3300003214 Bacteria 3496
8 rootH2_10003451 3300003320 Bacteria 25012
9 rootH2_10042549 3300003320 Bacteria 16252
10 rootH2_10174667 3300003320 Bacteria 4303
11 rootL2_10086920 3300003322 Bacteria 2856
12 rootL2_10209987 3300003322 Unclassified 2730
13 rootH1_10025547 3300003316 Bacteria 4527
14 rootH1_10025547 3300003323 Bacteria 21399
15 rootH1_10109774 3300003323 Bacteria 5211
16 rootH1_10166643 3300003323 Bacteria 3530
17 Ga0065714_10077752 3300005288 Bacteria 2659
18 Ga0070658_10000014 3300005327 Bacteria 244978
19 Ga0070658_10000095 3300005327 Bacteria 77839
20 Ga0070658_10106776 3300005327 Bacteria 2317
21 Ga0070658_10187687 3300005327 Bacteria 1742
22 Ga0070676_10000396 3300005328 Bacteria 20227
23 Ga0070676_10000580 3300005328 Bacteria 17716
24 Ga0070666_10000192 3300005335 Bacteria 41657
25 Ga0070680_100001311 3300005336 Bacteria 18023
26 Ga0070680_100017434 3300005336 Bacteria 5663
27 Ga0070682_100000280 3300005337 Bacteria 36356
28 Ga0068868_100038439 3300005338 Bacteria 3715
29 Ga0068868_100070639 3300005338 Bacteria 2784
30 Ga0070660_100244783 3300005339 Bacteria 1461
31 Ga0070691_10000594 3300005341 Bacteria 13884
32 Ga0070668_100000482 3300005347 Bacteria 26431
33 Ga0070674_100061532 3300005356 Unclassified 2620
34 Ga0070673_100000101 3300005364 Bacteria 38481
35 Ga0070667_100000086 3300005367 Bacteria 114861
36 Ga0070678_100001007 3300005456 Bacteria 14641
37 Ga0070662_100000089 3300005457 Bacteria 49998
38 Ga0070662_100009744 3300005457 Bacteria 6290
39 Ga0070681_10003291 3300005458 Bacteria 15080
40 Ga0070681_10046571 3300005458 Bacteria 4335
41 Ga0068867_100003423 3300005459 Bacteria 11158
42 Ga0068867_100005671 3300005459 Bacteria 8846
43 Ga0070679_100001119 3300005530 Bacteria 23386
44 Ga0070679_100015238 3300005530 Bacteria 7385
45 Ga0068853_100014277 3300005539 Bacteria 6502
46 Ga0068853_100017433 3300005539 Bacteria 5928
47 Ga0068853_100033252 3300005539 Bacteria 4374
48 Ga0068853_100155225 3300005539 Bacteria 2062
49 Ga0070672_100000376 3300005543 Bacteria 25873
50 Ga0070693_100002261 3300005547 Bacteria 8830
51 Ga0070665_100000010 3300005548 Bacteria 529545
52 Ga0070665_100000350 3300005548 Bacteria 69455
53 Ga0068855_100000354 3300005563 Bacteria 56753
54 Ga0068855_100000360 3300005563 Bacteria 56448
55 Ga0068855_100036835 3300005563 Bacteria 5820
56 Ga0068855_100083580 3300005563 Bacteria 3698
57 Ga0068855_100089179 3300005563 Bacteria 3561
58 Ga0068855_100095124 3300005563 Bacteria 3434
59 Ga0068855_100208644 3300005563 Bacteria 2196
60 Ga0068856_100003363 3300005614 Bacteria 16203
61 Ga0068856_100040827 3300005614 Bacteria 4558
62 Ga0068856_100248195 3300005614 Bacteria 1795
63 Ga0068852_100000355 3300005616 Bacteria 30820
64 Ga0068851_10008143 3300005834 Bacteria 4839
65 Ga0068863_100001390 3300005841 Bacteria 24001
66 Ga0068858_100005064 3300005842 Bacteria 12920
67 Ga0068860_100000781 3300005843 Bacteria 35833
68 Ga0075366_10000840 3300006195 Bacteria 14785
69 Ga0075366_10002903 3300006195 Bacteria 8904
70 Ga0097621_100000238 3300006237 Bacteria 37008
71 Ga0068871_100000025 3300006358 Bacteria 81390
72 Ga0068865_100000320 3300006881 Bacteria 26590
73 Ga0068865_100003933 3300006881 Bacteria 8920
74 Ga0105240_10000103 3300009093 Bacteria 172981
75 Ga0105240_10001537 3300009093 Bacteria 39153
76 Ga0105240_10005745 3300009093 Bacteria 18403
77 Ga0105240_10019871 3300009093 Bacteria 8971
78 Ga0105240_10034396 3300009093 Bacteria 6536
79 Ga0105240_10070751 3300009093 Bacteria 4315
80 Ga0105240_10158351 3300009093 Bacteria 2691
81 Ga0105240_10225693 3300009093 Bacteria 2179
82 Ga0105245_10211053 3300009098 Bacteria 1869
83 Ga0105243_10253145 3300009148 Unclassified 1573
84 Ga0105241_10000189 3300009174 Bacteria 46170
85 Ga0105241_10000530 3300009174 Bacteria 28739
86 Ga0105241_10004562 3300009174 Bacteria 10247
87 Ga0105241_10043792 3300009174 Bacteria 3390
88 Ga0105242_10002045 3300009176 Bacteria 15902
89 Ga0105242_10012438 3300009176 Bacteria 6551
90 Ga0105248_10029875 3300009177 Bacteria 6082
91 Ga0105237_10000402 3300009545 Bacteria 61603
92 Ga0105237_10001400 3300009545 Bacteria 31860
93 Ga0105237_10001669 3300009545 Bacteria 28718
94 Ga0105237_10002542 3300009545 Bacteria 22567
95 Ga0105237_10002808 3300009545 Bacteria 21150
96 Ga0105237_10031892 3300009545 Bacteria 5337
97 Ga0105237_10062556 3300009545 Bacteria 3721
98 Ga0105238_10004724 3300009551 Bacteria 13472
99 Ga0105249_10012208 3300009553 Bacteria 7566
100 Ga0105239_10000009 3300010375 Bacteria 361182
101 Ga0105239_10000280 3300010375 Bacteria 75222
102 Ga0105239_10001111 3300010375 Bacteria 37117
103 Ga0105239_10001876 3300010375 Bacteria 27527
104 Ga0105239_10007787 3300010375 Bacteria 12257
105 Ga0105239_10109249 3300010375 Bacteria 3065
106 Ga0105239_10257418 3300010375 Bacteria 1961
107 Ga0105239_10568666 3300010375 Bacteria 1292
108 Ga0105246_10004573 3300011119 Bacteria 8422
109 Ga0157373_10046625 3300013100 Bacteria 3093
110 Ga0157371_10009488 3300013102 Bacteria 7654
111 Ga0157370_10000175 3300013104 Bacteria 79713
112 Ga0157370_10002035 3300013104 Bacteria 24844
113 Ga0157370_10068030 3300013104 Unclassified 3366
114 Ga0157369_10001726 3300013105 Bacteria 26600
115 Ga0157369_10083055 3300013105 Bacteria 3427
116 Ga0157369_10111636 3300013105 Unclassified 2905
117 Ga0157374_10000084 3300013296 Bacteria 94138
118 Ga0157374_10000234 3300013296 Bacteria 51419
119 Ga0157374_10000379 3300013296 Bacteria 40932
120 Ga0157374_10033152 3300013296 Unclassified 4710
121 Ga0157374_10063416 3300013296 Bacteria 3466
122 Ga0163162_10000113 3300013306 Bacteria 71491
123 Ga0163162_10000369 3300013306 Bacteria 40837
124 Ga0163162_10005139 3300013306 Bacteria 12611
125 Ga0157372_10000286 3300013307 Bacteria 56140
126 Ga0157372_10002886 3300013307 Bacteria 18573
127 Ga0157372_10035336 3300013307 Bacteria 5501
128 Ga0157372_10070139 3300013307 Unclassified 3943
129 Ga0157375_10002963 3300013308 Bacteria 14741
130 Ga0157375_10004131 3300013308 Bacteria 12600
131 Ga0157375_10032679 3300013308 Bacteria 4936
132 Ga0157375_10093354 3300013308 Bacteria 3075
133 Ga0163163_10001938 3300014325 Bacteria 17517
134 Ga0182008_10001103 3300014497 Bacteria 18616
135 Ga0157377_10071106 3300014745 Bacteria 2011
136 Ga0157379_10000446 3300014968 Bacteria 33441
137 Ga0157379_10041510 3300014968 Bacteria 4107
138 Ga0182006_1000234 3300015261 Bacteria 52437
139 Ga0182007_10044434 3300015262 Bacteria 1474
140 Ga0163161_10092969 3300017792 Unclassified 2234
141 Ga0209563_102102 3300025230 Bacteria 4703
142 Ga0207427_100025 3300025231 Bacteria 433726
143 Ga0209437_100010 3300025233 Bacteria 838447
144 Ga0209437_100089 3300025233 Bacteria 250476
145 Ga0209233_1000017 3300025261 Bacteria 898076
146 Ga0209233_1026470 3300025261 Bacteria 1417
147 Ga0207656_10006638 3300025321 Bacteria 4176
148 Ga0207680_10000332 3300025903 Bacteria 22599
149 Ga0207647_10003045 3300025904 Bacteria 12598
150 Ga0207645_10000150 3300025907 Bacteria 54833
151 Ga0207645_10009063 3300025907 Bacteria 6906
152 Ga0207705_10017066 3300025909 Bacteria 5200
153 Ga0207705_10084454 3300025909 Bacteria 2318
154 Ga0207654_10001181 3300025911 Bacteria 14000
155 Ga0207654_10030634 3300025911 Bacteria 2955
156 Ga0207707_10000297 3300025912 Bacteria 52580
157 Ga0207707_10023415 3300025912 Bacteria 5402
158 Ga0207695_10000019 3300025913 Bacteria 732137
159 Ga0207695_10004168 3300025913 Bacteria 19856
160 Ga0207695_10004745 3300025913 Bacteria 18394
161 Ga0207695_10008033 3300025913 Bacteria 13283
162 Ga0207695_10046587 3300025913 Bacteria 4596
163 Ga0207671_10001553 3300025914 Bacteria 26274
164 Ga0207671_10002497 3300025914 Bacteria 19633
165 Ga0207671_10002854 3300025914 Bacteria 17923
166 Ga0207671_10003229 3300025914 Bacteria 16398
167 Ga0207671_10004541 3300025914 Bacteria 13186
168 Ga0207671_10005642 3300025914 Bacteria 11467
169 Ga0207671_10008981 3300025914 Bacteria 8408
170 Ga0207671_10015286 3300025914 Bacteria 6022
171 Ga0207671_10015934 3300025914 Bacteria 5861
172 Ga0207660_10000959 3300025917 Bacteria 19096
173 Ga0207660_10011969 3300025917 Bacteria 5664
174 Ga0207652_10000864 3300025921 Bacteria 28657
175 Ga0207652_10020600 3300025921 Bacteria 5434
176 Ga0207694_10008632 3300025924 Bacteria 7693
177 Ga0207706_10000115 3300025933 Bacteria 86484
178 Ga0207706_10010539 3300025933 Bacteria 8445
179 Ga0207706_10106519 3300025933 Bacteria 2467
180 Ga0207686_10014626 3300025934 Bacteria 4374
181 Ga0207704_10000210 3300025938 Bacteria 29599
182 Ga0207704_10003927 3300025938 Bacteria 6758
183 Ga0207691_10000037 3300025940 Bacteria 108385
184 Ga0207667_10000430 3300025949 Bacteria 56466
185 Ga0207667_10002952 3300025949 Bacteria 21103
186 Ga0207667_10004453 3300025949 Bacteria 17151
187 Ga0207667_10139329 3300025949 Bacteria 2498
188 Ga0207651_10011524 3300025960 Bacteria 4954
189 Ga0207668_10003291 3300025972 Bacteria 9469
190 Ga0207658_10000559 3300025986 Bacteria 33814
191 Ga0207703_10002980 3300026035 Bacteria 14351
192 Ga0207639_10009373 3300026041 Bacteria 6750
193 Ga0207639_10023617 3300026041 Unclassified 4441
194 Ga0207639_10130999 3300026041 Bacteria 2076
195 Ga0207678_10008863 3300026067 Bacteria 8859
196 Ga0207702_10100573 3300026078 Unclassified 2551
197 Ga0207702_10101829 3300026078 Bacteria 2537
198 Ga0207648_10000903 3300026089 Bacteria 33411
199 Ga0207648_10003586 3300026089 Bacteria 16233
200 Ga0207676_10023051 3300026095 Bacteria 4586
201 Ga0207683_10001103 3300026121 Bacteria 24591
202 Ga0207698_10009008 3300026142 Bacteria 6337
203 Ga0207698_10009490 3300026142 Bacteria 6208
204 Ga0268266_10000032 3300028379 Bacteria 395079
205 Ga0268264_10001833 3300028381 Bacteria 19399
206 Ga0307517_10004073 3300028786 Bacteria 22551
207 Ga0307515_10000376 3300028794 Bacteria 109190
208 Ga0307515_10001287 3300028794 Bacteria 56974
209 Ga0265338_10020708 3300028800 Bacteria 6902
210 Ga0307509_10074702 3300031507 Bacteria 3524
211 Ga0307414_10001513 3300032004 Bacteria 12079
212 Ga0307507_10000894 3300033179 Bacteria 66220
213 Ga0395899_0000002 3300037312 Bacteria 1324310
214 Ga0395899_0000434 3300037312 Bacteria 48146
215 Ga0395899_0029691 3300037312 Bacteria 4113
216 Ga0395900_0000682 3300037418 Bacteria 45242
217 Ga0395900_0014270 3300037418 Bacteria 8110
218 Ga0395900_0096968 3300037418 Bacteria 3030
219 Ga0395898_0066866 3300037466 Bacteria 3481
220 Ga0395905_0023288 3300037471 Bacteria 5855
221 Ga0395901_0018958 3300038443 Bacteria 7035
222 Ga0439448_0038893 3300042005 Bacteria 1532
223 Ga0439449_0013069 3300042007 Bacteria 3123
224 Ga0466966_0028516 3300044684 Bacteria 3635
225 Ga0466959_0065685 3300045049 Bacteria 2633
226 Ga0495629_0117612 3300046459 Bacteria 1852
227 Ga0495650_0000198 3300046471 Bacteria 130455
228 Ga0495580_0020974 3300046472 Bacteria 4825
229 Ga0495582_0120055 3300046473 Bacteria 1481
230 Ga0495585_0000305 3300046492 Bacteria 48998
231 Ga0495585_0000354 3300046492 Bacteria 44420
232 Ga0495607_0045487 3300046501 Bacteria 2581
233 Ga0495583_0021729 3300046506 Bacteria 3294
234 Ga0495606_0000003 3300046507 Bacteria 449402
235 Ga0495606_0008730 3300046507 Bacteria 8722
236 Ga0495606_0021720 3300046507 Bacteria 4695
237 Ga0495606_0033294 3300046507 Bacteria 3556
238 Ga0495606_0115746 3300046507 Bacteria 1611
239 Ga0495610_0000845 3300046512 Bacteria 28519
240 Ga0495616_0006908 3300046513 Bacteria 6835
241 Ga0495616_0120540 3300046513 Bacteria 1211
242 Ga0495643_0006725 3300046522 Bacteria 7524
243 Ga0495648_0086613 3300046524 Bacteria 1766
244 Ga0495609_0011194 3300046538 Bacteria 4280
245 Ga0495633_0000273 3300046558 Bacteria 60402
246 Ga0495633_0000374 3300046558 Bacteria 47750
247 Ga0495668_0000010 3300046616 Bacteria 487308
248 Ga0495625_0000867 3300046660 Bacteria 41148
249 Ga0495625_0000932 3300046660 Bacteria 39330
250 Ga0495625_0002022 3300046660 Bacteria 22834
251 Ga0495625_0045565 3300046660 Bacteria 3169
252 Ga0495625_0054985 3300046660 Bacteria 2840
253 Ga0495625_0096821 3300046660 Bacteria 2032
254 Ga0495625_0134925 3300046660 Bacteria 1669
255 Ga0495625_0178253 3300046660 Unclassified 1415
256 Ga0495661_0003432 3300046665 Bacteria 11697
257 Ga0495661_0004275 3300046665 Bacteria 10378
258 Ga0495658_0007591 3300046683 Bacteria 5376
259 Ga0495669_0068673 3300046684 Bacteria 1613
260 Ga0495649_0000951 3300046694 Bacteria 22848
261 Ga0495687_001329 3300047443 Bacteria 23054
262 Ga0495687_011501 3300047443 Bacteria 4752
263 Ga0495687_044844 3300047443 Bacteria 1918
264 Ga0495685_031600 3300047447 Bacteria 1819
265 Ga0495686_0000283 3300047472 Bacteria 89298
266 Ga0496115_0062457 3300048918 Bacteria 3005
267 Ga0496122_0000219 3300048925 Bacteria 127599
268 Ga0496123_0001044 3300048926 Bacteria 41941
269 Ga0496125_0113994 3300048928 Bacteria 1948
270 Ga0496126_0007097 3300048929 Bacteria 12339
271 Ga0495678_003071 3300049459 Bacteria 10596
272 Ga0501034_0190088 3300049571 Unclassified 2016
273 Ga0501046_0088809 3300049580 Unclassified 2380
274 Ga0501047_0030809 3300049581 Bacteria 5171
275 Ga0501070_0023650 3300049586 Bacteria 5147
276 Ga0501073_0090994 3300049589 Unclassified 2120
277 Ga0501079_0086670 3300049741 Unclassified 2424
278 Ga0501080_0153493 3300049742 Unclassified 2127
279 Ga0501044_0178865 3300049823 Bacteria 2089
280 nmdc:mga0k408_111_c1 3300050493 Bacteria 39614
281 nmdc:mga0k408_201_c1 3300050493 Bacteria 31697
282 nmdc:mga0k408_37052_c1 3300050493 Bacteria 2799
283 Ga0495619_0086560 3300053085 Bacteria 2118
284 Ga0500651_0054179 3300053093 Unclassified 2515
285 Ga0500608_004486 3300053122 Bacteria 5417
286 Ga0500618_000127 3300053125 Bacteria 62903
287 Ga0500616_0055744 3300053153 Bacteria 2066
288 Ga0500622_0000121 3300053156 Bacteria 81831
289 Ga0500622_0000296 3300053156 Bacteria 50980
290 Ga0500624_000407 3300053157 Bacteria 13297
291 Ga0501084_0079603 3300054114 Unclassified 2746
292 Ga0500661_006248 3300055283 Bacteria 2219
293 Ga0501082_0284474 3300060353 Unclassified 1439
294 2599479043 2599185184 Bacteria 6430550
295 2738758928 2738541283 Bacteria 7222293
296 2852626991 2852623160 Bacteria 4376875
297 2884935828 2884933994 Bacteria 4535041
298 2910245793 2910245624 Bacteria 6935613
299 2919442674 2919437846 Bacteria 6199444
300 2928082646 2928078545 Bacteria 6534839
301 2928148771 2928147474 Bacteria 6512076
302 2932086433 2932082852 Bacteria 6563563
303 2958515939 2958512119 Bacteria 4528530
304 2965321626 2965320100 Bacteria 3975600
305 2977233588 2977232053 Bacteria 5485925
306 rootH1_10053982
307 JGI24737J22298_10002562
308 JGI24737J22298_10006475
309 JGI24735J21928_10000168
310 JGI25162J39368_1000047
311 JGI25162J39368_1000183
312 JGI25165J46597_1003847
313 rootH2_10003451
314 rootH2_10042549
315 rootH2_10174667
316 rootL2_10086920
317 rootL2_10209987
318 rootH1_10025547
319 rootH1_10109774
320 rootH1_10166643
321 Ga0065714_10077752
322 Ga0070658_10000014
323 Ga0070658_10000095
324 Ga0070658_10106776
325 Ga0070658_10187687
326 Ga0070676_10000396
327 Ga0070676_10000580
328 Ga0070666_10000192
329 Ga0070680_100001311
330 Ga0070680_100017434
331 Ga0070682_100000280
332 Ga0068868_100038439
333 Ga0068868_100070639
334 Ga0070660_100244783
335 Ga0070691_10000594
336 Ga0070668_100000482
337 Ga0070674_100061532
338 Ga0070673_100000101
339 Ga0070667_100000086
340 Ga0070678_100001007
341 Ga0070662_100000089
342 Ga0070662_100009744
343 Ga0070681_10003291
344 Ga0070681_10046571
345 Ga0068867_100003423
346 Ga0068867_100005671
347 Ga0070679_100001119
348 Ga0070679_100015238
349 Ga0068853_100014277
350 Ga0068853_100017433
351 Ga0068853_100033252
352 Ga0068853_100155225
353 Ga0070672_100000376
354 Ga0070693_100002261
355 Ga0070665_100000010
356 Ga0070665_100000350
357 Ga0068855_100000354
358 Ga0068855_100000360
359 Ga0068855_100036835
360 Ga0068855_100083580
361 Ga0068855_100089179
362 Ga0068855_100095124
363 Ga0068855_100208644
364 Ga0068856_100003363
365 Ga0068856_100040827
366 Ga0068856_100248195
367 Ga0068852_100000355
368 Ga0068851_10008143
369 Ga0068863_100001390
370 Ga0068858_100005064
371 Ga0068860_100000781
372 Ga0075366_10000840
373 Ga0075366_10002903
374 Ga0097621_100000238
375 Ga0068871_100000025
376 Ga0068865_100000320
377 Ga0068865_100003933
378 Ga0105240_10000103
379 Ga0105240_10001537
380 Ga0105240_10005745
381 Ga0105240_10019871
382 Ga0105240_10034396
383 Ga0105240_10070751
384 Ga0105240_10158351
385 Ga0105240_10225693
386 Ga0105245_10211053
387 Ga0105243_10253145
388 Ga0105241_10000189
389 Ga0105241_10000530
390 Ga0105241_10004562
391 Ga0105241_10043792
392 Ga0105242_10002045
393 Ga0105242_10012438
394 Ga0105248_10029875
395 Ga0105237_10000402
396 Ga0105237_10001400
397 Ga0105237_10001669
398 Ga0105237_10002542
399 Ga0105237_10002808
400 Ga0105237_10031892
401 Ga0105237_10062556
402 Ga0105238_10004724
403 Ga0105249_10012208
404 Ga0105239_10000009
405 Ga0105239_10000280
406 Ga0105239_10001111
407 Ga0105239_10001876
408 Ga0105239_10007787
409 Ga0105239_10109249
410 Ga0105239_10257418
411 Ga0105239_10568666
412 Ga0105246_10004573
413 Ga0157373_10046625
414 Ga0157371_10009488
415 Ga0157370_10000175
416 Ga0157370_10002035
417 Ga0157370_10068030
418 Ga0157369_10001726
419 Ga0157369_10083055
420 Ga0157369_10111636
421 Ga0157374_10000084
422 Ga0157374_10000234
423 Ga0157374_10000379
424 Ga0157374_10033152
425 Ga0157374_10063416
426 Ga0163162_10000113
427 Ga0163162_10000369
428 Ga0163162_10005139
429 Ga0157372_10000286
430 Ga0157372_10002886
431 Ga0157372_10035336
432 Ga0157372_10070139
433 Ga0157375_10002963
434 Ga0157375_10004131
435 Ga0157375_10032679
436 Ga0157375_10093354
437 Ga0163163_10001938
438 Ga0182008_10001103
439 Ga0157377_10071106
440 Ga0157379_10000446
441 Ga0157379_10041510
442 Ga0182006_1000234
443 Ga0182007_10044434
444 Ga0163161_10092969
445 Ga0209563_102102
446 Ga0207427_100025
447 Ga0209437_100010
448 Ga0209437_100089
449 Ga0209233_1000017
450 Ga0209233_1026470
451 Ga0207656_10006638
452 Ga0207680_10000332
453 Ga0207647_10003045
454 Ga0207645_10000150
455 Ga0207645_10009063
456 Ga0207705_10017066
457 Ga0207705_10084454
458 Ga0207654_10001181
459 Ga0207654_10030634
460 Ga0207707_10000297
461 Ga0207707_10023415
462 Ga0207695_10000019
463 Ga0207695_10004168
464 Ga0207695_10004745
465 Ga0207695_10008033
466 Ga0207695_10046587
467 Ga0207671_10001553
468 Ga0207671_10002497
469 Ga0207671_10002854
470 Ga0207671_10003229
471 Ga0207671_10004541
472 Ga0207671_10005642
473 Ga0207671_10008981
474 Ga0207671_10015286
475 Ga0207671_10015934
476 Ga0207660_10000959
477 Ga0207660_10011969
478 Ga0207652_10000864
479 Ga0207652_10020600
480 Ga0207694_10008632
481 Ga0207706_10000115
482 Ga0207706_10010539
483 Ga0207706_10106519
484 Ga0207686_10014626
485 Ga0207704_10000210
486 Ga0207704_10003927
487 Ga0207691_10000037
488 Ga0207667_10000430
489 Ga0207667_10002952
490 Ga0207667_10004453
491 Ga0207667_10139329
492 Ga0207651_10011524
493 Ga0207668_10003291
494 Ga0207658_10000559
495 Ga0207703_10002980
496 Ga0207639_10009373
497 Ga0207639_10023617
498 Ga0207639_10130999
499 Ga0207678_10008863
500 Ga0207702_10100573
501 Ga0207702_10101829
502 Ga0207648_10000903
503 Ga0207648_10003586
504 Ga0207676_10023051
505 Ga0207683_10001103
506 Ga0207698_10009008
507 Ga0207698_10009490
508 Ga0268266_10000032
509 Ga0268264_10001833
510 Ga0307517_10004073
511 Ga0307515_10000376
512 Ga0307515_10001287
513 Ga0265338_10020708
514 Ga0307509_10074702
515 Ga0307414_10001513
516 Ga0307507_10000894
517 Ga0395899_0000002
518 Ga0395899_0000434
519 Ga0395899_0029691
520 Ga0395900_0000682
521 Ga0395900_0014270
522 Ga0395900_0096968
523 Ga0395898_0066866
524 Ga0395905_0023288
525 Ga0395901_0018958
526 Ga0439448_0038893
527 Ga0439449_0013069
528 Ga0466966_0028516
529 Ga0466959_0065685
530 Ga0495629_0117612
531 Ga0495650_0000198
532 Ga0495580_0020974
533 Ga0495582_0120055
534 Ga0495585_0000305
535 Ga0495585_0000354
536 Ga0495607_0045487
537 Ga0495583_0021729
538 Ga0495606_0000003
539 Ga0495606_0008730
540 Ga0495606_0021720
541 Ga0495606_0033294
542 Ga0495606_0115746
543 Ga0495610_0000845
544 Ga0495616_0006908
545 Ga0495616_0120540
546 Ga0495643_0006725
547 Ga0495648_0086613
548 Ga0495609_0011194
549 Ga0495633_0000273
550 Ga0495633_0000374
551 Ga0495668_0000010
552 Ga0495625_0000867
553 Ga0495625_0000932
554 Ga0495625_0002022
555 Ga0495625_0045565
556 Ga0495625_0054985
557 Ga0495625_0096821
558 Ga0495625_0134925
559 Ga0495625_0178253
560 Ga0495661_0003432
561 Ga0495661_0004275
562 Ga0495658_0007591
563 Ga0495669_0068673
564 Ga0495649_0000951
565 Ga0495687_001329
566 Ga0495687_011501
567 Ga0495687_044844
568 Ga0495685_031600
569 Ga0495686_0000283
570 Ga0496115_0062457
571 Ga0496122_0000219
572 Ga0496123_0001044
573 Ga0496125_0113994
574 Ga0496126_0007097
575 Ga0495678_003071
576 Ga0501034_0190088
577 Ga0501046_0088809
578 Ga0501047_0030809
579 Ga0501070_0023650
580 Ga0501073_0090994
581 Ga0501079_0086670
582 Ga0501080_0153493
583 Ga0501044_0178865
584 nmdc:mga0k408_111_c1
585 nmdc:mga0k408_201_c1
586 nmdc:mga0k408_37052_c1
587 Ga0495619_0086560
588 Ga0500651_0054179
589 Ga0500608_004486
590 Ga0500618_000127
591 Ga0500616_0055744
592 Ga0500622_0000121
593 Ga0500622_0000296
594 Ga0500624_000407
595 Ga0501084_0079603
596 Ga0500661_006248
597 Ga0501082_0284474
598 2599479043
599 2738758928
600 2852626991
601 2884935828
602 2910245793
603 2919442674
604 2928082646
605 2928148771
606 2932086433
607 2958515939
608 2965321626
609 2977233588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

213

406

0.81

PF07690

MFS_1

Major Facilitator Superfamily

18

241

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.8335 12 383
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8244 16 380
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8194 16 380
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8071 10 382
6e9n-assembly2.cif.gz_B e. coli d-galactonate:proton symporter in the inward open form 0.8026 14 381
ID Description Score Start End Superfamily
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.951 14 191 1.20.1250.20
af_P75810_211_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9299 206 381 1.20.1250.20
af_P75810_10_191_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.926 14 191 1.20.1250.20
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9088 207 382 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9006 207 381 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A291T694-F1-model_v4 deleted 0.9543 13 158
AF-A0A2N2LLB8-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8824 208 372 GO:0016020
GO:0022857
AF-D3QA45-F1-model_v4 Major facilitator superfamily MFS_1 0.8765 19 381 GO:0016020
GO:0022857
AF-A0A448C4T6-F1-model_v4 deleted 0.8702 16 383
AF-C0XND7-F1-model_v4 Drug resistance transporter, EmrB/QacA family 0.8679 208 377 GO:0005886
GO:0022857

Map