F397320

General Info

Members Datasets Scaffolds Average Seq Length
303 234 606 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023228|2524533156
Length 315
Sequence RMPTRTRMVIPGTITLIAMRTIMIIITVMDITTGMVTITMMVITMITRMITTTTITMSIAIMLIITTTTPMLMTANEPDPAAVRGGITEDEAAALYRLMTWLSPSFPVGAFAYSSGIEWAVEAGDITDAASLRGWLAAMLADGSGFCDAVFLAQSHRAASEHNHSGLKETAELAAAFVPSRERQLETTTQGRAFIEIARAAWNSPGLDAMITACDGAIVYPVAVGIVSAAHGIPLAPSLHAFLHAVVSNWISAGSRLIPLGQTDSQRVLADLEQVVAATAARASAASLDDLGSATFRADLASLRHETQYTRLFRS

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
190 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
191 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
192 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
193 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
194 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
195 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
196 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
197 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
198 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
199 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
200 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
201 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
202 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
203 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
204 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
205 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
206 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
207 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
208 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
209 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
210 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
211 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
212 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
213 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
214 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
215 2906610324
216 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
217 2922425934
218 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
219 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
220 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
221 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
222 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
223 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
224 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
225 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
226 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
227 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
228 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
229 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
230 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
231 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
232 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
233 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
234 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.38
Metatranscriptomes 0
Isolates 14.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 8.91
Rhizoplane 4.29
Rhizosphere 69.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000595 3300003215 Bacteria 22097
2 JGI25153J46596_10003091 3300003215 Bacteria 9380
3 Ga0055543_1021741 3300004625 Bacteria 1169
4 Ga0065165_1002217 3300005262 Bacteria 17347
5 Ga0065165_1005486 3300005262 Bacteria 7100
6 Ga0068869_100031925 3300005334 Bacteria 3708
7 Ga0070660_100262496 3300005339 Bacteria 1410
8 Ga0070689_100062872 3300005340 Bacteria 2889
9 Ga0070687_100015580 3300005343 Bacteria 3442
10 Ga0070661_100110454 3300005344 Bacteria 2052
11 Ga0070668_100026802 3300005347 Bacteria 4374
12 Ga0070668_100329962 3300005347 Bacteria 1286
13 Ga0070671_100004439 3300005355 Bacteria 11106
14 Ga0070674_100017841 3300005356 Bacteria 4473
15 Ga0070673_100049677 3300005364 Bacteria 3276
16 Ga0070688_100046591 3300005365 Bacteria 2685
17 Ga0070659_100140013 3300005366 Bacteria 1970
18 Ga0070667_100137400 3300005367 Bacteria 2138
19 Ga0070709_10001499 3300005434 Bacteria 12626
20 Ga0070709_10006569 3300005434 Bacteria 6342
21 Ga0070714_100045142 3300005435 Bacteria 3733
22 Ga0070714_100224865 3300005435 Bacteria 1727
23 Ga0070713_100000667 3300005436 Bacteria 21946
24 Ga0070713_100014247 3300005436 Bacteria 5896
25 Ga0070713_100079791 3300005436 Bacteria 2789
26 Ga0070713_100322140 3300005436 Bacteria 1428
27 Ga0070713_100396588 3300005436 Bacteria 1288
28 Ga0070710_10044761 3300005437 Bacteria 2457
29 Ga0070701_10019025 3300005438 Bacteria 3238
30 Ga0070711_100015684 3300005439 Bacteria 4797
31 Ga0070711_100021152 3300005439 Bacteria 4203
32 Ga0070711_100135162 3300005439 Bacteria 1842
33 Ga0070705_100092486 3300005440 Bacteria 1888
34 Ga0070700_100122366 3300005441 Bacteria 1745
35 Ga0070663_100078495 3300005455 Bacteria 2420
36 Ga0070663_100134172 3300005455 Bacteria 1883
37 Ga0070678_100089854 3300005456 Bacteria 2352
38 Ga0070662_100078118 3300005457 Bacteria 2458
39 Ga0070681_10004041 3300005458 Bacteria 13846
40 Ga0068867_100010759 3300005459 Bacteria 6453
41 Ga0070685_10007789 3300005466 Bacteria 5482
42 Ga0070679_100064262 3300005530 Bacteria 3658
43 Ga0068853_100086413 3300005539 Bacteria 2750
44 Ga0070672_100163285 3300005543 Bacteria 1849
45 Ga0070665_100026319 3300005548 Bacteria 5858
46 Ga0070665_100190754 3300005548 Bacteria 2050
47 Ga0070665_100359081 3300005548 Bacteria 1463
48 Ga0068855_100054242 3300005563 Bacteria 4711
49 Ga0070664_100491226 3300005564 Bacteria 1131
50 Ga0068856_100024482 3300005614 Bacteria 5878
51 Ga0068856_100063133 3300005614 Bacteria 3659
52 Ga0070702_100011355 3300005615 Bacteria 4428
53 Ga0068852_100049076 3300005616 Bacteria 3609
54 Ga0068859_100026100 3300005617 Bacteria 5861
55 Ga0068864_100011024 3300005618 Bacteria 7472
56 Ga0068866_10008126 3300005718 Bacteria 4409
57 Ga0068861_100069129 3300005719 Bacteria 2731
58 Ga0068870_10033866 3300005840 Bacteria 2610
59 Ga0068863_100101392 3300005841 Bacteria 2736
60 Ga0068858_100060056 3300005842 Bacteria 3514
61 Ga0068858_100128458 3300005842 Bacteria 2375
62 Ga0068860_100092883 3300005843 Bacteria 2876
63 Ga0068862_100585396 3300005844 Bacteria 1069
64 Ga0081538_10025451 3300005981 Bacteria 4171
65 Ga0081540_1021864 3300005983 Bacteria 3792
66 Ga0081540_1030759 3300005983 Bacteria 2968
67 Ga0081540_1041038 3300005983 Bacteria 2404
68 Ga0081540_1080934 3300005983 Bacteria 1462
69 Ga0081539_10002647 3300005985 Bacteria 24446
70 Ga0070717_10002358 3300006028 Bacteria 13305
71 Ga0070717_10379178 3300006028 Bacteria 1268
72 Ga0075365_10056708 3300006038 Bacteria 2605
73 Ga0070715_10027824 3300006163 Bacteria 2262
74 Ga0070716_100000809 3300006173 Bacteria 13464
75 Ga0070712_100013415 3300006175 Bacteria 5238
76 Ga0070712_100163336 3300006175 Bacteria 1722
77 Ga0070712_100255433 3300006175 Bacteria 1402
78 Ga0097621_100022175 3300006237 Bacteria 4926
79 Ga0097621_100169746 3300006237 Bacteria 1880
80 Ga0068871_100006915 3300006358 Bacteria 8080
81 Ga0068871_100522859 3300006358 Bacteria 1072
82 Ga0068865_100012761 3300006881 Bacteria 5296
83 Ga0097620_100026100 3300006931 Bacteria 5861
84 Ga0099824_1037546 3300006942 Bacteria 1339
85 Ga0105251_10095990 3300009011 Bacteria 1358
86 Ga0105247_10016187 3300009101 Bacteria 4467
87 Ga0105241_10021983 3300009174 Bacteria 4722
88 Ga0105242_10008786 3300009176 Bacteria 7751
89 Ga0105248_10094306 3300009177 Bacteria 3370
90 Ga0105239_10350854 3300010375 Bacteria 1666
91 Ga0157374_10422021 3300013296 Bacteria 1333
92 Ga0157378_10050600 3300013297 Bacteria 3697
93 Ga0163163_10193906 3300014325 Bacteria 2080
94 Ga0182008_10168036 3300014497 Bacteria 1106
95 Ga0157379_10454054 3300014968 Bacteria 1183
96 Ga0157376_10110253 3300014969 Bacteria 2421
97 Ga0163161_10034366 3300017792 Bacteria 3627
98 Ga0207425_1010911 3300025245 Bacteria 2192
99 Ga0209677_102347 3300025253 Bacteria 7251
100 Ga0209233_1009155 3300025261 Bacteria 3026
101 Ga0209564_1008192 3300025295 Bacteria 5218
102 Ga0209758_1000206 3300025297 Bacteria 130177
103 Ga0209758_1002566 3300025297 Bacteria 18260
104 Ga0209256_1005602 3300025299 Bacteria 7133
105 Ga0207426_1001011 3300025302 Bacteria 27245
106 Ga0209051_1036310 3300025303 Bacteria 1821
107 Ga0209257_1000394 3300025304 Bacteria 86654
108 Ga0207692_10045951 3300025898 Bacteria 2187
109 Ga0207642_10012688 3300025899 Bacteria 3051
110 Ga0207642_10020106 3300025899 Bacteria 2600
111 Ga0207710_10016095 3300025900 Bacteria 3164
112 Ga0207710_10060484 3300025900 Bacteria 1717
113 Ga0207688_10102416 3300025901 Bacteria 1655
114 Ga0207699_10000837 3300025906 Bacteria 14654
115 Ga0207699_10076049 3300025906 Bacteria 2067
116 Ga0207643_10001194 3300025908 Bacteria 15337
117 Ga0207707_10002136 3300025912 Bacteria 17901
118 Ga0207707_10027750 3300025912 Bacteria 4950
119 Ga0207693_10004460 3300025915 Bacteria 11828
120 Ga0207693_10020705 3300025915 Bacteria 5231
121 Ga0207693_10038350 3300025915 Bacteria 3774
122 Ga0207693_10144642 3300025915 Bacteria 1870
123 Ga0207663_10010765 3300025916 Bacteria 4883
124 Ga0207663_10021481 3300025916 Bacteria 3675
125 Ga0207663_10157649 3300025916 Bacteria 1598
126 Ga0207663_10386437 3300025916 Bacteria 1067
127 Ga0207662_10012136 3300025918 Bacteria 4795
128 Ga0207657_10136310 3300025919 Bacteria 2008
129 Ga0207657_10162783 3300025919 Bacteria 1811
130 Ga0207652_10089737 3300025921 Bacteria 2699
131 Ga0207659_10037348 3300025926 Bacteria 3371
132 Ga0207700_10000278 3300025928 Bacteria 30513
133 Ga0207700_10005341 3300025928 Bacteria 7666
134 Ga0207700_10056770 3300025928 Bacteria 2949
135 Ga0207700_10087153 3300025928 Bacteria 2455
136 Ga0207700_10258977 3300025928 Bacteria 1489
137 Ga0207664_10059821 3300025929 Bacteria 3036
138 Ga0207664_10186841 3300025929 Bacteria 1782
139 Ga0207644_10024802 3300025931 Bacteria 4119
140 Ga0207644_10039735 3300025931 Bacteria 3322
141 Ga0207690_10073001 3300025932 Bacteria 2371
142 Ga0207706_10004917 3300025933 Bacteria 12497
143 Ga0207706_10066564 3300025933 Bacteria 3170
144 Ga0207709_10023304 3300025935 Bacteria 3522
145 Ga0207670_10029045 3300025936 Bacteria 3518
146 Ga0207665_10000654 3300025939 Bacteria 23305
147 Ga0207691_10025780 3300025940 Bacteria 5518
148 Ga0207711_10004053 3300025941 Bacteria 12576
149 Ga0207711_10052753 3300025941 Bacteria 3486
150 Ga0207689_10002403 3300025942 Bacteria 17431
151 Ga0207661_10195635 3300025944 Bacteria 1775
152 Ga0207679_10115874 3300025945 Bacteria 2123
153 Ga0207679_10129998 3300025945 Bacteria 2019
154 Ga0207651_10120147 3300025960 Bacteria 1991
155 Ga0207712_10201131 3300025961 Bacteria 1580
156 Ga0207668_10033948 3300025972 Bacteria 3383
157 Ga0207668_10102558 3300025972 Bacteria 2129
158 Ga0207668_10103470 3300025972 Bacteria 2120
159 Ga0207640_10083420 3300025981 Bacteria 2191
160 Ga0207658_10019831 3300025986 Bacteria 4653
161 Ga0207658_10141004 3300025986 Bacteria 1950
162 Ga0207677_10008562 3300026023 Bacteria 5722
163 Ga0207677_10087819 3300026023 Bacteria 2252
164 Ga0207703_10085444 3300026035 Bacteria 2640
165 Ga0207639_10038422 3300026041 Bacteria 3560
166 Ga0207678_10007015 3300026067 Bacteria 10000
167 Ga0207678_10014290 3300026067 Bacteria 6980
168 Ga0207708_10001631 3300026075 Bacteria 16695
169 Ga0207641_10118708 3300026088 Bacteria 2356
170 Ga0207648_10088310 3300026089 Bacteria 2707
171 Ga0207676_10031649 3300026095 Bacteria 3979
172 Ga0207675_100006150 3300026118 Bacteria 11408
173 Ga0207683_10001639 3300026121 Bacteria 20049
174 Ga0207683_10141313 3300026121 Bacteria 2169
175 Ga0207698_10411037 3300026142 Bacteria 1296
176 Ga0268266_10037844 3300028379 Bacteria 4107
177 Ga0268266_10091494 3300028379 Bacteria 2667
178 Ga0268266_10546903 3300028379 Bacteria 1109
179 Ga0268265_10153996 3300028380 Bacteria 1942
180 Ga0268265_10301255 3300028380 Bacteria 1443
181 Ga0268264_10000194 3300028381 Bacteria 125395
182 Ga0268264_10073963 3300028381 Bacteria 2893
183 Ga0265332_10009651 3300031238 Bacteria 4306
184 Ga0307516_10127238 3300031730 Bacteria 2331
185 Ga0315911_1000005 3300033442 Bacteria 426255
186 Ga0373954_0077795 3300035118 Bacteria 1582
187 Ga0373957_0056999 3300035120 Bacteria 1506
188 Ga0373924_0004553 3300035410 Bacteria 4846
189 Ga0373927_0033160 3300035695 Bacteria 3362
190 Ga0373933_0000105 3300035724 Bacteria 53488
191 Ga0373933_0037275 3300035724 Bacteria 2851
192 Ga0373937_0166449 3300036401 Bacteria 2067
193 Ga0373925_0038936 3300037068 Bacteria 3517
194 Ga0395899_0262375 3300037312 Bacteria 1181
195 Ga0436365_0469662 3300039437 Bacteria 1087
196 Ga0436365_0538784 3300039437 Bacteria 957
197 Ga0436365_0681415 3300039437 Bacteria 1520
198 Ga0436363_0118122 3300039450 Bacteria 1333
199 Ga0466972_0000053 3300044658 Bacteria 112876
200 Ga0466972_0021332 3300044658 Bacteria 3230
201 Ga0466957_0149532 3300044842 Bacteria 1509
202 Ga0466967_0110852 3300045976 Bacteria 2521
203 Ga0495592_0058392 3300046454 Bacteria 2846
204 Ga0495629_0023189 3300046459 Bacteria 4423
205 Ga0495651_0005197 3300046462 Bacteria 9926
206 Ga0495653_0054123 3300046463 Bacteria 3068
207 Ga0495653_0224215 3300046463 Bacteria 1262
208 Ga0495664_0011575 3300046477 Bacteria 4976
209 Ga0495664_0068078 3300046477 Bacteria 2124
210 Ga0495585_0180298 3300046492 Bacteria 1086
211 Ga0495608_0061408 3300046511 Bacteria 2471
212 Ga0495620_0044112 3300046515 Bacteria 1939
213 Ga0495628_0034561 3300046516 Bacteria 4065
214 Ga0495630_0029258 3300046517 Bacteria 4095
215 Ga0495666_0093080 3300046526 Bacteria 1422
216 Ga0495652_0006073 3300046529 Bacteria 11296
217 Ga0495640_0078974 3300046533 Bacteria 2191
218 Ga0495621_0041746 3300046539 Bacteria 1612
219 Ga0495645_0016122 3300046543 Bacteria 5326
220 Ga0495667_0054216 3300046559 Bacteria 2639
221 Ga0495667_0055359 3300046559 Bacteria 2609
222 Ga0495635_0224928 3300046663 Bacteria 1268
223 Ga0495657_0019662 3300046675 Bacteria 4869
224 Ga0495599_0042138 3300046678 Bacteria 2865
225 Ga0495599_0119557 3300046678 Bacteria 1638
226 Ga0495600_0000832 3300046809 Bacteria 16425
227 Ga0495581_0012612 3300047315 Bacteria 4897
228 Ga0495674_0006592 3300047319 Bacteria 11136
229 Ga0495677_0083830 3300047445 Bacteria 1197
230 Ga0495684_0149632 3300047471 Bacteria 1746
231 Ga0496101_0015625 3300048904 Bacteria 5120
232 Ga0496103_0015029 3300048906 Bacteria 4602
233 Ga0496103_0026222 3300048906 Bacteria 3528
234 Ga0496104_0254317 3300048907 Bacteria 1669
235 Ga0496106_0484877 3300048909 Bacteria 993
236 Ga0496109_0143087 3300048912 Bacteria 2236
237 Ga0496110_0205118 3300048913 Bacteria 1791
238 Ga0496112_0007586 3300048915 Bacteria 9640
239 Ga0496112_0010264 3300048915 Bacteria 8489
240 Ga0496112_0228782 3300048915 Bacteria 1814
241 Ga0496113_0350920 3300048916 Bacteria 1183
242 Ga0496114_0011416 3300048917 Bacteria 7098
243 Ga0496115_0004735 3300048918 Bacteria 9867
244 Ga0496121_0032031 3300048924 Bacteria 4787
245 Ga0496121_0088949 3300048924 Bacteria 2419
246 Ga0501067_0099842 3300049583 Bacteria 1612
247 nmdc:mga0yw44_108456_c1 3300050492 Bacteria 1777
248 nmdc:mga0yw44_49518_c1 3300050492 Bacteria 2537
249 Ga0495612_0015141 3300053078 Bacteria 3093
250 Ga0495612_0058327 3300053078 Bacteria 1595
251 Ga0500594_0031026 3300053118 Bacteria 1407
252 Ga0500595_008257 3300053119 Bacteria 4262
253 Ga0500642_0004532 3300053130 Bacteria 4363
254 Ga0500622_0038918 3300053156 Bacteria 2480
255 Ga0500627_0094426 3300053158 Bacteria 1340
256 Ga0500636_0064675 3300053177 Bacteria 2130
257 Ga0466962_0084236 3300061719 Bacteria 1521
258 2524533156 2524023228 Bacteria 10118060
259 2511394572 2511231028 Bacteria 8046582
260 2513638280 2513237094 Bacteria 8789602
261 2513877194 2513237139 Bacteria 8737671
262 2524440784 2524023205 Bacteria 8918781
263 2745076025 2744054633 Bacteria 8678936
264 2805916206 2802429603 Bacteria 8777136
265 2818240511 2816332527 Bacteria 8933356
266 2824603682 2824600985 Bacteria 8488197
267 2824685793 2824679649 Bacteria 8248951
268 2824690728 2824687955 Bacteria 8360029
269 2824709145 2824704595 Bacteria 9667483
270 2824760321 2824753945 Bacteria 9787441
271 2824772351 2824763712 Bacteria 9792355
272 2841989459 2841983080 Bacteria 8395090
273 2844316318 2844315083 Bacteria 8138177
274 2849082126 2849076700 Bacteria 7039503
275 2857513395 2857509624 Bacteria 7472071
276 2876763681 2876761206 Bacteria 10111113
277 2885367810 2885366525 Bacteria 8326213
278 2888421233 2888419890 Bacteria 7857137
279 2889036455 2889033259 Bacteria 9099371
280 2903728348 2903727486 Bacteria 8281579
281 2903750065 2903748898 Bacteria 9972761
282 2904719758 2904711408 Bacteria 9771557
283 2906606488 2906602504 Bacteria 8295279
284 2906614654
285 2908777264 2908775508 Bacteria 8092255
286 2922426516
287 2932795993 2932794094 Bacteria 7915132
288 2932807570 2932801729 Bacteria 7987968
289 2935632857 2935630451 Bacteria 8169952
290 2935887262 2935883170 Bacteria 7964738
291 2935965028 2935959822 Bacteria 7869783
292 2941508478 2941507105 Bacteria 8166816
293 2941516309 2941515067 Bacteria 8166720
294 2941524675 2941523033 Bacteria 8169134
295 2941534534 2941531003 Bacteria 7653939
296 3005510967 3005506211 Bacteria 6943378
297 3005595929 3005594810 Bacteria 8716512
298 8006937174 8006933436 Bacteria 10410654
299 8006977184 8006973647 Bacteria 10679141
300 8019561483 8019555841 Bacteria 9642137
301 8019571558 8019565922 Bacteria 9639779
302 8056692969 8056689827 Bacteria 6712655
303 8056974097 8056967851 Bacteria 9038162
304 JGI25153J46596_10000595
305 JGI25153J46596_10003091
306 Ga0055543_1021741
307 Ga0065165_1002217
308 Ga0065165_1005486
309 Ga0068869_100031925
310 Ga0070660_100262496
311 Ga0070689_100062872
312 Ga0070687_100015580
313 Ga0070661_100110454
314 Ga0070668_100026802
315 Ga0070668_100329962
316 Ga0070671_100004439
317 Ga0070674_100017841
318 Ga0070673_100049677
319 Ga0070688_100046591
320 Ga0070659_100140013
321 Ga0070667_100137400
322 Ga0070709_10001499
323 Ga0070709_10006569
324 Ga0070714_100045142
325 Ga0070714_100224865
326 Ga0070713_100000667
327 Ga0070713_100014247
328 Ga0070713_100079791
329 Ga0070713_100322140
330 Ga0070713_100396588
331 Ga0070710_10044761
332 Ga0070701_10019025
333 Ga0070711_100015684
334 Ga0070711_100021152
335 Ga0070711_100135162
336 Ga0070705_100092486
337 Ga0070700_100122366
338 Ga0070663_100078495
339 Ga0070663_100134172
340 Ga0070678_100089854
341 Ga0070662_100078118
342 Ga0070681_10004041
343 Ga0068867_100010759
344 Ga0070685_10007789
345 Ga0070679_100064262
346 Ga0068853_100086413
347 Ga0070672_100163285
348 Ga0070665_100026319
349 Ga0070665_100190754
350 Ga0070665_100359081
351 Ga0068855_100054242
352 Ga0070664_100491226
353 Ga0068856_100024482
354 Ga0068856_100063133
355 Ga0070702_100011355
356 Ga0068852_100049076
357 Ga0068859_100026100
358 Ga0068864_100011024
359 Ga0068866_10008126
360 Ga0068861_100069129
361 Ga0068870_10033866
362 Ga0068863_100101392
363 Ga0068858_100060056
364 Ga0068858_100128458
365 Ga0068860_100092883
366 Ga0068862_100585396
367 Ga0081538_10025451
368 Ga0081540_1021864
369 Ga0081540_1030759
370 Ga0081540_1041038
371 Ga0081540_1080934
372 Ga0081539_10002647
373 Ga0070717_10002358
374 Ga0070717_10379178
375 Ga0075365_10056708
376 Ga0070715_10027824
377 Ga0070716_100000809
378 Ga0070712_100013415
379 Ga0070712_100163336
380 Ga0070712_100255433
381 Ga0097621_100022175
382 Ga0097621_100169746
383 Ga0068871_100006915
384 Ga0068871_100522859
385 Ga0068865_100012761
386 Ga0097620_100026100
387 Ga0099824_1037546
388 Ga0105251_10095990
389 Ga0105247_10016187
390 Ga0105241_10021983
391 Ga0105242_10008786
392 Ga0105248_10094306
393 Ga0105239_10350854
394 Ga0157374_10422021
395 Ga0157378_10050600
396 Ga0163163_10193906
397 Ga0182008_10168036
398 Ga0157379_10454054
399 Ga0157376_10110253
400 Ga0163161_10034366
401 Ga0207425_1010911
402 Ga0209677_102347
403 Ga0209233_1009155
404 Ga0209564_1008192
405 Ga0209758_1000206
406 Ga0209758_1002566
407 Ga0209256_1005602
408 Ga0207426_1001011
409 Ga0209051_1036310
410 Ga0209257_1000394
411 Ga0207692_10045951
412 Ga0207642_10012688
413 Ga0207642_10020106
414 Ga0207710_10016095
415 Ga0207710_10060484
416 Ga0207688_10102416
417 Ga0207699_10000837
418 Ga0207699_10076049
419 Ga0207643_10001194
420 Ga0207707_10002136
421 Ga0207707_10027750
422 Ga0207693_10004460
423 Ga0207693_10020705
424 Ga0207693_10038350
425 Ga0207693_10144642
426 Ga0207663_10010765
427 Ga0207663_10021481
428 Ga0207663_10157649
429 Ga0207663_10386437
430 Ga0207662_10012136
431 Ga0207657_10136310
432 Ga0207657_10162783
433 Ga0207652_10089737
434 Ga0207659_10037348
435 Ga0207700_10000278
436 Ga0207700_10005341
437 Ga0207700_10056770
438 Ga0207700_10087153
439 Ga0207700_10258977
440 Ga0207664_10059821
441 Ga0207664_10186841
442 Ga0207644_10024802
443 Ga0207644_10039735
444 Ga0207690_10073001
445 Ga0207706_10004917
446 Ga0207706_10066564
447 Ga0207709_10023304
448 Ga0207670_10029045
449 Ga0207665_10000654
450 Ga0207691_10025780
451 Ga0207711_10004053
452 Ga0207711_10052753
453 Ga0207689_10002403
454 Ga0207661_10195635
455 Ga0207679_10115874
456 Ga0207679_10129998
457 Ga0207651_10120147
458 Ga0207712_10201131
459 Ga0207668_10033948
460 Ga0207668_10102558
461 Ga0207668_10103470
462 Ga0207640_10083420
463 Ga0207658_10019831
464 Ga0207658_10141004
465 Ga0207677_10008562
466 Ga0207677_10087819
467 Ga0207703_10085444
468 Ga0207639_10038422
469 Ga0207678_10007015
470 Ga0207678_10014290
471 Ga0207708_10001631
472 Ga0207641_10118708
473 Ga0207648_10088310
474 Ga0207676_10031649
475 Ga0207675_100006150
476 Ga0207683_10001639
477 Ga0207683_10141313
478 Ga0207698_10411037
479 Ga0268266_10037844
480 Ga0268266_10091494
481 Ga0268266_10546903
482 Ga0268265_10153996
483 Ga0268265_10301255
484 Ga0268264_10000194
485 Ga0268264_10073963
486 Ga0265332_10009651
487 Ga0307516_10127238
488 Ga0315911_1000005
489 Ga0373954_0077795
490 Ga0373957_0056999
491 Ga0373924_0004553
492 Ga0373927_0033160
493 Ga0373933_0000105
494 Ga0373933_0037275
495 Ga0373937_0166449
496 Ga0373925_0038936
497 Ga0395899_0262375
498 Ga0436365_0469662
499 Ga0436365_0538784
500 Ga0436365_0681415
501 Ga0436363_0118122
502 Ga0466972_0000053
503 Ga0466972_0021332
504 Ga0466957_0149532
505 Ga0466967_0110852
506 Ga0495592_0058392
507 Ga0495629_0023189
508 Ga0495651_0005197
509 Ga0495653_0054123
510 Ga0495653_0224215
511 Ga0495664_0011575
512 Ga0495664_0068078
513 Ga0495585_0180298
514 Ga0495608_0061408
515 Ga0495620_0044112
516 Ga0495628_0034561
517 Ga0495630_0029258
518 Ga0495666_0093080
519 Ga0495652_0006073
520 Ga0495640_0078974
521 Ga0495621_0041746
522 Ga0495645_0016122
523 Ga0495667_0054216
524 Ga0495667_0055359
525 Ga0495635_0224928
526 Ga0495657_0019662
527 Ga0495599_0042138
528 Ga0495599_0119557
529 Ga0495600_0000832
530 Ga0495581_0012612
531 Ga0495674_0006592
532 Ga0495677_0083830
533 Ga0495684_0149632
534 Ga0496101_0015625
535 Ga0496103_0015029
536 Ga0496103_0026222
537 Ga0496104_0254317
538 Ga0496106_0484877
539 Ga0496109_0143087
540 Ga0496110_0205118
541 Ga0496112_0007586
542 Ga0496112_0010264
543 Ga0496112_0228782
544 Ga0496113_0350920
545 Ga0496114_0011416
546 Ga0496115_0004735
547 Ga0496121_0032031
548 Ga0496121_0088949
549 Ga0501067_0099842
550 nmdc:mga0yw44_108456_c1
551 nmdc:mga0yw44_49518_c1
552 Ga0495612_0015141
553 Ga0495612_0058327
554 Ga0500594_0031026
555 Ga0500595_008257
556 Ga0500642_0004532
557 Ga0500622_0038918
558 Ga0500627_0094426
559 Ga0500636_0064675
560 Ga0466962_0084236
561 2524533156
562 2511394572
563 2513638280
564 2513877194
565 2524440784
566 2745076025
567 2805916206
568 2818240511
569 2824603682
570 2824685793
571 2824690728
572 2824709145
573 2824760321
574 2824772351
575 2841989459
576 2844316318
577 2849082126
578 2857513395
579 2876763681
580 2885367810
581 2888421233
582 2889036455
583 2903728348
584 2903750065
585 2904719758
586 2906606488
587 2906614654
588 2908777264
589 2922426516
590 2932795993
591 2932807570
592 2935632857
593 2935887262
594 2935965028
595 2941508478
596 2941516309
597 2941524675
598 2941534534
599 3005510967
600 3005595929
601 8006937174
602 8006977184
603 8019561483
604 8019571558
605 8056692969
606 8056974097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

126

273

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.9085 29 226
3o1q-assembly1.cif.gz_A native crystal structure of helicobacter pylori urease accessory protein uref 0.9028 26 226
3o1q-assembly2.cif.gz_B native crystal structure of helicobacter pylori urease accessory protein uref 0.8906 29 226
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8851 29 227
4hi0-assembly1.cif.gz_C crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8847 33 243
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.928 30 227 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.9012 29 226 1.10.4190.10
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8936 30 227 1.10.4190.10
3sf5C00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8821 33 244 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8457 29 226 1.10.4190.10
ID Description Score Start End GO Terms
AF-A0A4Q3S398-F1-model_v4 Urease accessory protein UreF 0.9458 29 190 GO:0016151
AF-A0A381XV29-F1-model_v4 Uncharacterized protein 0.9423 46 176 GO:0016151
AF-A0A537P1B0-F1-model_v4 Urease accessory protein UreF 0.941 19 231 GO:0016151
AF-A0A529P264-F1-model_v4 Urease accessory protein UreF 0.9372 30 227 GO:0016151
AF-A0A258LC10-F1-model_v4 Urease accessory protein UreF 0.9358 27 227 GO:0016151

Map