F397277

General Info

Members Datasets Scaffolds Average Seq Length
303 178 606 88

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0139602|Ga0501047_0139602_615_947
Length 86
Sequence MPNIKQQEKRVRTAARQRLENLRYRSGIKTLTRRLREATETGTEVDAAYKALVRMVDKAAAKGAIHKNAAARKKSQAARLLATPVA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 10.23
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 22.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0139602 3300049581 Bacteria 2302
2 rootL2_10228306 3300003322 Bacteria 1256
3 Ga0070658_10702595 3300005327 Bacteria 878
4 Ga0070683_100288211 3300005329 Unclassified 1562
5 Ga0070683_100516273 3300005329 Bacteria 1142
6 Ga0070682_101286911 3300005337 Bacteria 621
7 Ga0070660_100010364 3300005339 Bacteria 6586
8 Ga0070661_100068665 3300005344 Bacteria 2605
9 Ga0070659_100026342 3300005366 Bacteria 4474
10 Ga0070711_100886584 3300005439 Bacteria 761
11 Ga0070708_100246449 3300005445 Bacteria 1678
12 Ga0070706_100796481 3300005467 Bacteria 875
13 Ga0070707_100299754 3300005468 Bacteria 1562
14 Ga0070699_100093716 3300005518 Bacteria 2628
15 Ga0070684_101885999 3300005535 Bacteria 564
16 Ga0068853_100327471 3300005539 Bacteria 1421
17 Ga0070665_100936229 3300005548 Bacteria 879
18 Ga0070664_102048732 3300005564 Unclassified 543
19 Ga0068852_100121656 3300005616 Bacteria 2391
20 Ga0068859_101589031 3300005617 Bacteria 722
21 Ga0068870_11182169 3300005840 Bacteria 553
22 Ga0081538_10080920 3300005981 Bacteria 1730
23 Ga0081539_10044934 3300005985 Bacteria 2545
24 Ga0081539_10220760 3300005985 Bacteria 862
25 Ga0070712_100621366 3300006175 Bacteria 916
26 Ga0097621_100896258 3300006237 Bacteria 826
27 Ga0075433_10052936 3300006852 Bacteria 3538
28 Ga0075434_100246543 3300006871 Bacteria 1806
29 Ga0097620_101588975 3300006931 Bacteria 722
30 Ga0075435_101969055 3300007076 Bacteria 513
31 Ga0099794_10432915 3300007265 Bacteria 689
32 Ga0111539_11514230 3300009094 Bacteria 778
33 Ga0105247_11593695 3300009101 Bacteria 536
34 Ga0114129_10087254 3300009147 Bacteria 4327
35 Ga0114129_10560822 3300009147 Bacteria 1484
36 Ga0114129_11380763 3300009147 Bacteria 870
37 Ga0105243_11783912 3300009148 Unclassified 646
38 Ga0105241_11990262 3300009174 Bacteria 572
39 Ga0105248_10484930 3300009177 Unclassified 1393
40 Ga0105248_11109660 3300009177 Unclassified 894
41 Ga0105237_12470454 3300009545 Bacteria 530
42 Ga0105249_11777825 3300009553 Bacteria 689
43 Ga0105030_118033 3300009987 Bacteria 634
44 Ga0157371_11584661 3300013102 Bacteria 512
45 Ga0157369_10224354 3300013105 Bacteria 1966
46 Ga0157378_11619569 3300013297 Unclassified 693
47 Ga0157372_10505615 3300013307 Bacteria 1409
48 Ga0157375_10425106 3300013308 Unclassified 1494
49 Ga0157376_11762034 3300014969 Unclassified 655
50 Ga0206356_11691416 3300020070 Bacteria 1886
51 Ga0206354_10007320 3300020081 Bacteria 2149
52 Ga0206353_12066276 3300020082 Bacteria 4651
53 Ga0207692_11129279 3300025898 Unclassified 519
54 Ga0207705_10306933 3300025909 Bacteria 1218
55 Ga0207707_10038770 3300025912 Bacteria 4164
56 Ga0207693_10754863 3300025915 Bacteria 751
57 Ga0207660_10027190 3300025917 Bacteria 3901
58 Ga0207657_10019424 3300025919 Bacteria 6453
59 Ga0207649_10111473 3300025920 Bacteria 1829
60 Ga0207652_10013380 3300025921 Bacteria 6643
61 Ga0207650_11423315 3300025925 Unclassified 590
62 Ga0207659_10996305 3300025926 Unclassified 721
63 Ga0207690_10941775 3300025932 Bacteria 717
64 Ga0207709_10805593 3300025935 Unclassified 758
65 Ga0207689_10113871 3300025942 Unclassified 2223
66 Ga0207661_10358337 3300025944 Bacteria 1317
67 Ga0207703_11372002 3300026035 Unclassified 680
68 Ga0207639_10200171 3300026041 Bacteria 1712
69 Ga0207674_10744757 3300026116 Bacteria 946
70 Ga0207674_11293921 3300026116 Unclassified 699
71 Ga0207683_11328800 3300026121 Unclassified 665
72 Ga0207698_10038135 3300026142 Bacteria 3547
73 Ga0265337_1090586 3300028556 Bacteria 834
74 Ga0265318_10004807 3300028577 Bacteria 6468
75 Ga0265338_10024413 3300028800 Bacteria 6176
76 Ga0265338_10055511 3300028800 Bacteria 3522
77 Ga0265324_10190898 3300029957 Bacteria 696
78 Ga0265330_10017673 3300031235 Bacteria 3282
79 Ga0265330_10057746 3300031235 Bacteria 1692
80 Ga0265332_10158386 3300031238 Bacteria 946
81 Ga0265320_10008301 3300031240 Bacteria 6360
82 Ga0265325_10048021 3300031241 Bacteria 2208
83 Ga0265329_10185820 3300031242 Bacteria 681
84 Ga0265339_10003801 3300031249 Bacteria 10498
85 Ga0265331_10099731 3300031250 Bacteria 1337
86 Ga0265327_10022960 3300031251 Bacteria 3710
87 Ga0265316_10029203 3300031344 Bacteria 4537
88 Ga0265316_10076553 3300031344 Bacteria 2570
89 Ga0265314_10003240 3300031711 Bacteria 15912
90 Ga0265314_10005935 3300031711 Bacteria 10916
91 Ga0265342_10034388 3300031712 Bacteria 3109
92 Ga0265342_10419407 3300031712 Bacteria 689
93 Ga0373945_0281383 3300035116 Unclassified 709
94 Ga0373962_0235627 3300035242 Unclassified 631
95 Ga0373931_0523368 3300035691 Bacteria 768
96 Ga0395900_0081821 3300037418 Bacteria 3317
97 Ga0395900_0134023 3300037418 Unclassified 2538
98 Ga0395900_1205572 3300037418 Unclassified 672
99 Ga0395905_0168688 3300037471 Bacteria 2056
100 Ga0395905_1140732 3300037471 Unclassified 683
101 Ga0395905_1654353 3300037471 Bacteria 545
102 Ga0395901_0013039 3300038443 Bacteria 8435
103 Ga0395901_0356542 3300038443 Bacteria 1509
104 Ga0395901_0392286 3300038443 Bacteria 1427
105 Ga0439453_0087899 3300041408 Unclassified 679
106 Ga0451807_1627899 3300041486 Unclassified 1317
107 Ga0466961_0289688 3300044693 Bacteria 1001
108 Ga0466963_0088391 3300044694 Bacteria 2108
109 Ga0466963_0164417 3300044694 Unclassified 1546
110 Ga0466970_0461570 3300044765 Bacteria 729
111 Ga0466957_0363404 3300044842 Bacteria 984
112 Ga0466967_0046746 3300045976 Bacteria 3770
113 Ga0466967_0074274 3300045976 Bacteria 3053
114 Ga0466967_0101887 3300045976 Unclassified 2625
115 Ga0466967_1739313 3300045976 Bacteria 621
116 Ga0495592_0098471 3300046454 Bacteria 2087
117 Ga0495629_0003253 3300046459 Bacteria 12304
118 Ga0495629_0058834 3300046459 Bacteria 2687
119 Ga0495629_0506844 3300046459 Bacteria 813
120 Ga0495641_0469421 3300046461 Unclassified 573
121 Ga0495651_0602355 3300046462 Unclassified 693
122 Ga0495653_0257185 3300046463 Unclassified 1156
123 Ga0495582_0405482 3300046473 Unclassified 786
124 Ga0495664_0575797 3300046477 Bacteria 670
125 Ga0495594_0388024 3300046499 Bacteria 795
126 Ga0495594_0612903 3300046499 Bacteria 617
127 Ga0495607_0107143 3300046501 Bacteria 1487
128 Ga0495608_0236997 3300046511 Unclassified 1141
129 Ga0495628_0217481 3300046516 Bacteria 1436
130 Ga0495628_0664696 3300046516 Unclassified 739
131 Ga0495630_0066669 3300046517 Bacteria 2706
132 Ga0495630_0595367 3300046517 Bacteria 848
133 Ga0495652_0255970 3300046529 Bacteria 1295
134 Ga0495652_0628068 3300046529 Bacteria 730
135 Ga0495652_0889604 3300046529 Unclassified 588
136 Ga0495665_0263010 3300046531 Bacteria 887
137 Ga0495667_0077133 3300046559 Unclassified 2168
138 Ga0495634_0091462 3300046642 Bacteria 1975
139 Ga0495634_0341963 3300046642 Bacteria 897
140 Ga0495634_0787266 3300046642 Bacteria 543
141 Ga0495635_0123522 3300046663 Unclassified 1765
142 Ga0495657_0296276 3300046675 Unclassified 965
143 Ga0495657_0827259 3300046675 Unclassified 528
144 Ga0495599_0738563 3300046678 Bacteria 565
145 Ga0495623_0588530 3300046679 Unclassified 579
146 Ga0495658_0031422 3300046683 Bacteria 2892
147 Ga0495613_0408268 3300046689 Bacteria 926
148 Ga0495613_1049661 3300046689 Unclassified 522
149 Ga0495600_0526655 3300046809 Unclassified 724
150 Ga0495581_0734963 3300047315 Unclassified 568
151 Ga0495674_0136363 3300047319 Unclassified 2065
152 Ga0495680_0238538 3300047322 Unclassified 1292
153 Ga0495680_0278850 3300047322 Unclassified 1178
154 Ga0495680_0371276 3300047322 Bacteria 992
155 Ga0495593_0188321 3300047673 Unclassified 1038
156 Ga0495615_0064529 3300048090 Archaea 974
157 Ga0496100_0110303 3300048903 Unclassified 1910
158 Ga0496100_0357360 3300048903 Unclassified 1104
159 Ga0496101_0201895 3300048904 Unclassified 1537
160 Ga0496102_0110534 3300048905 Bacteria 2562
161 Ga0496104_0052071 3300048907 Bacteria 3866
162 Ga0496104_0351037 3300048907 Unclassified 1388
163 Ga0496104_1006197 3300048907 Unclassified 737
164 Ga0496105_0125115 3300048908 Bacteria 2119
165 Ga0496105_0410595 3300048908 Unclassified 1073
166 Ga0496105_1260773 3300048908 Bacteria 541
167 Ga0496106_0222167 3300048909 Bacteria 1507
168 Ga0496107_0318079 3300048910 Bacteria 1158
169 Ga0496107_0326755 3300048910 Bacteria 1141
170 Ga0496108_0019351 3300048911 Bacteria 5590
171 Ga0496108_1259325 3300048911 Unclassified 623
172 Ga0496109_0001518 3300048912 Bacteria 19311
173 Ga0496109_0138118 3300048912 Bacteria 2279
174 Ga0496109_0945611 3300048912 Bacteria 800
175 Ga0496110_0002108 3300048913 Bacteria 14845
176 Ga0496110_0360331 3300048913 Unclassified 1325
177 Ga0496110_0755202 3300048913 Bacteria 876
178 Ga0496111_0000359 3300048914 Bacteria 22584
179 Ga0496112_0021506 3300048915 Bacteria 6137
180 Ga0496112_0558149 3300048915 Unclassified 1079
181 Ga0496113_0033516 3300048916 Bacteria 3740
182 Ga0496113_0275882 3300048916 Unclassified 1344
183 Ga0496113_0374418 3300048916 Unclassified 1143
184 Ga0496114_0042627 3300048917 Bacteria 3762
185 Ga0496114_1408106 3300048917 Unclassified 585
186 Ga0496115_0722284 3300048918 Bacteria 781
187 Ga0501031_0002854 3300049568 Bacteria 11035
188 Ga0501031_0065461 3300049568 Bacteria 2368
189 Ga0501031_0125107 3300049568 Bacteria 1679
190 Ga0501032_0005053 3300049569 Bacteria 9863
191 Ga0501032_0030124 3300049569 Bacteria 3722
192 Ga0501033_0001995 3300049570 Bacteria 17792
193 Ga0501033_0016378 3300049570 Bacteria 5614
194 Ga0501034_0025185 3300049571 Bacteria 6055
195 Ga0501034_0217704 3300049571 Bacteria 1863
196 Ga0501036_0019039 3300049572 Bacteria 5760
197 Ga0501036_0027573 3300049572 Bacteria 4799
198 Ga0501037_0001952 3300049573 Bacteria 14896
199 Ga0501037_0002931 3300049573 Bacteria 12376
200 Ga0501038_0003618 3300049574 Bacteria 14395
201 Ga0501038_0008725 3300049574 Bacteria 9303
202 Ga0501039_0013453 3300049575 Bacteria 6258
203 Ga0501039_0023430 3300049575 Bacteria 4738
204 Ga0501039_0457652 3300049575 Unclassified 1002
205 Ga0501040_0009343 3300049576 Bacteria 6387
206 Ga0501040_0061202 3300049576 Bacteria 2588
207 Ga0501040_0086741 3300049576 Bacteria 2173
208 Ga0501041_0003228 3300049577 Bacteria 9372
209 Ga0501041_0088046 3300049577 Bacteria 1916
210 Ga0501041_0202757 3300049577 Bacteria 1244
211 Ga0501042_0005628 3300049578 Bacteria 8080
212 Ga0501042_0016780 3300049578 Bacteria 5035
213 Ga0501042_0164646 3300049578 Bacteria 1600
214 Ga0501043_0003253 3300049579 Bacteria 13391
215 Ga0501043_0117007 3300049579 Bacteria 2091
216 Ga0501043_0248787 3300049579 Bacteria 1370
217 Ga0501046_0003201 3300049580 Bacteria 15064
218 Ga0501046_0003649 3300049580 Bacteria 14103
219 Ga0501047_0023621 3300049581 Bacteria 5902
220 Ga0501047_0304649 3300049581 Bacteria 1435
221 Ga0501048_0003186 3300049582 Bacteria 12510
222 Ga0501048_0008629 3300049582 Bacteria 7694
223 Ga0501048_0096927 3300049582 Bacteria 2080
224 Ga0501048_1311712 3300049582 Bacteria 520
225 Ga0501067_0000751 3300049583 Bacteria 17412
226 Ga0501067_0050346 3300049583 Bacteria 2308
227 Ga0501067_0094127 3300049583 Bacteria 1663
228 Ga0501067_0364607 3300049583 Bacteria 805
229 Ga0501068_0007217 3300049584 Bacteria 6151
230 Ga0501068_0010443 3300049584 Bacteria 5218
231 Ga0501068_0018019 3300049584 Bacteria 4088
232 Ga0501068_0060778 3300049584 Bacteria 2295
233 Ga0501068_0166840 3300049584 Bacteria 1389
234 Ga0501068_0648027 3300049584 Unclassified 689
235 Ga0501069_0000767 3300049585 Bacteria 15020
236 Ga0501069_0001923 3300049585 Bacteria 10374
237 Ga0501069_0020262 3300049585 Bacteria 3602
238 Ga0501069_0085467 3300049585 Unclassified 1780
239 Ga0501069_0174990 3300049585 Bacteria 1239
240 Ga0501070_0009310 3300049586 Bacteria 8308
241 Ga0501070_0017852 3300049586 Bacteria 5958
242 Ga0501070_0244323 3300049586 Bacteria 1469
243 Ga0501071_0022222 3300049587 Bacteria 4421
244 Ga0501071_0028997 3300049587 Bacteria 3903
245 Ga0501071_0032069 3300049587 Bacteria 3729
246 Ga0501071_0198513 3300049587 Bacteria 1506
247 Ga0501072_0021175 3300049588 Bacteria 5043
248 Ga0501072_0026133 3300049588 Bacteria 4549
249 Ga0501073_0000754 3300049589 Bacteria 22923
250 Ga0501073_0001630 3300049589 Bacteria 16651
251 Ga0501073_0989149 3300049589 Bacteria 579
252 Ga0501074_0020490 3300049590 Bacteria 4805
253 Ga0501074_0021614 3300049590 Bacteria 4671
254 Ga0501074_0435357 3300049590 Bacteria 930
255 Ga0501075_0009353 3300049591 Bacteria 6854
256 Ga0501075_0031730 3300049591 Bacteria 3923
257 Ga0501075_0555136 3300049591 Bacteria 876
258 Ga0501075_1480021 3300049591 Bacteria 514
259 Ga0501076_0009818 3300049592 Bacteria 7073
260 Ga0501076_0050150 3300049592 Bacteria 3301
261 Ga0501076_0088815 3300049592 Bacteria 2484
262 Ga0501077_0010528 3300049593 Bacteria 5757
263 Ga0501077_0032879 3300049593 Bacteria 3303
264 Ga0501077_0106688 3300049593 Bacteria 1775
265 Ga0501079_0005555 3300049741 Bacteria 9404
266 Ga0501079_0027173 3300049741 Bacteria 4386
267 Ga0501080_0004395 3300049742 Bacteria 12527
268 Ga0501080_0012337 3300049742 Bacteria 7831
269 Ga0501080_0111344 3300049742 Bacteria 2537
270 Ga0501080_0268638 3300049742 Unclassified 1553
271 Ga0501081_0016660 3300049743 Bacteria 4859
272 Ga0501081_0036654 3300049743 Bacteria 3344
273 Ga0501081_0091518 3300049743 Bacteria 2139
274 Ga0501083_0001667 3300049744 Bacteria 15162
275 Ga0501083_0040018 3300049744 Bacteria 3182
276 Ga0501083_0118766 3300049744 Unclassified 1735
277 Ga0501035_0012786 3300049822 Bacteria 7753
278 Ga0501035_0027996 3300049822 Bacteria 5148
279 Ga0501035_0096941 3300049822 Bacteria 2591
280 Ga0501044_0006171 3300049823 Bacteria 13245
281 Ga0501044_0110242 3300049823 Bacteria 2761
282 Ga0501045_0003408 3300049824 Bacteria 10876
283 Ga0501045_0020305 3300049824 Bacteria 4745
284 Ga0501045_0639795 3300049824 Unclassified 786
285 nmdc:mga0n895_234158_c1 3300050512 Bacteria 1864
286 nmdc:mga0a205_44851_c1 3300050515 Bacteria 4263
287 Ga0495601_0429716 3300053077 Unclassified 855
288 Ga0495601_0938794 3300053077 Unclassified 545
289 Ga0495595_0246092 3300053084 Bacteria 895
290 Ga0495619_0047678 3300053085 Unclassified 2822
291 Ga0495619_0138501 3300053085 Bacteria 1675
292 Ga0500566_0415581 3300053094 Bacteria 598
293 Ga0501084_0015804 3300054114 Bacteria 6259
294 Ga0501084_0061911 3300054114 Bacteria 3133
295 Ga0501082_0033644 3300060353 Bacteria 4421
296 Ga0501082_0085365 3300060353 Bacteria 2722
297 Ga0501082_0591442 3300060353 Bacteria 971
298 Ga0501082_0605607 3300060353 Bacteria 959
299 Ga0530510_0019617 3300061734 Bacteria 4799
300 Ga0530510_0029992 3300061734 Bacteria 3905
301 Ga0530510_0090115 3300061734 Bacteria 2236
302 Ga0530510_0184807 3300061734 Unclassified 1546
303 Ga0530510_0622840 3300061734 Unclassified 821
304 Ga0501047_0139602
305 rootL2_10228306
306 Ga0070658_10702595
307 Ga0070683_100288211
308 Ga0070683_100516273
309 Ga0070682_101286911
310 Ga0070660_100010364
311 Ga0070661_100068665
312 Ga0070659_100026342
313 Ga0070711_100886584
314 Ga0070708_100246449
315 Ga0070706_100796481
316 Ga0070707_100299754
317 Ga0070699_100093716
318 Ga0070684_101885999
319 Ga0068853_100327471
320 Ga0070665_100936229
321 Ga0070664_102048732
322 Ga0068852_100121656
323 Ga0068859_101589031
324 Ga0068870_11182169
325 Ga0081538_10080920
326 Ga0081539_10044934
327 Ga0081539_10220760
328 Ga0070712_100621366
329 Ga0097621_100896258
330 Ga0075433_10052936
331 Ga0075434_100246543
332 Ga0097620_101588975
333 Ga0075435_101969055
334 Ga0099794_10432915
335 Ga0111539_11514230
336 Ga0105247_11593695
337 Ga0114129_10087254
338 Ga0114129_10560822
339 Ga0114129_11380763
340 Ga0105243_11783912
341 Ga0105241_11990262
342 Ga0105248_10484930
343 Ga0105248_11109660
344 Ga0105237_12470454
345 Ga0105249_11777825
346 Ga0105030_118033
347 Ga0157371_11584661
348 Ga0157369_10224354
349 Ga0157378_11619569
350 Ga0157372_10505615
351 Ga0157375_10425106
352 Ga0157376_11762034
353 Ga0206356_11691416
354 Ga0206354_10007320
355 Ga0206353_12066276
356 Ga0207692_11129279
357 Ga0207705_10306933
358 Ga0207707_10038770
359 Ga0207693_10754863
360 Ga0207660_10027190
361 Ga0207657_10019424
362 Ga0207649_10111473
363 Ga0207652_10013380
364 Ga0207650_11423315
365 Ga0207659_10996305
366 Ga0207690_10941775
367 Ga0207709_10805593
368 Ga0207689_10113871
369 Ga0207661_10358337
370 Ga0207703_11372002
371 Ga0207639_10200171
372 Ga0207674_10744757
373 Ga0207674_11293921
374 Ga0207683_11328800
375 Ga0207698_10038135
376 Ga0265337_1090586
377 Ga0265318_10004807
378 Ga0265338_10024413
379 Ga0265338_10055511
380 Ga0265324_10190898
381 Ga0265330_10017673
382 Ga0265330_10057746
383 Ga0265332_10158386
384 Ga0265320_10008301
385 Ga0265325_10048021
386 Ga0265329_10185820
387 Ga0265339_10003801
388 Ga0265331_10099731
389 Ga0265327_10022960
390 Ga0265316_10029203
391 Ga0265316_10076553
392 Ga0265314_10003240
393 Ga0265314_10005935
394 Ga0265342_10034388
395 Ga0265342_10419407
396 Ga0373945_0281383
397 Ga0373962_0235627
398 Ga0373931_0523368
399 Ga0395900_0081821
400 Ga0395900_0134023
401 Ga0395900_1205572
402 Ga0395905_0168688
403 Ga0395905_1140732
404 Ga0395905_1654353
405 Ga0395901_0013039
406 Ga0395901_0356542
407 Ga0395901_0392286
408 Ga0439453_0087899
409 Ga0451807_1627899
410 Ga0466961_0289688
411 Ga0466963_0088391
412 Ga0466963_0164417
413 Ga0466970_0461570
414 Ga0466957_0363404
415 Ga0466967_0046746
416 Ga0466967_0074274
417 Ga0466967_0101887
418 Ga0466967_1739313
419 Ga0495592_0098471
420 Ga0495629_0003253
421 Ga0495629_0058834
422 Ga0495629_0506844
423 Ga0495641_0469421
424 Ga0495651_0602355
425 Ga0495653_0257185
426 Ga0495582_0405482
427 Ga0495664_0575797
428 Ga0495594_0388024
429 Ga0495594_0612903
430 Ga0495607_0107143
431 Ga0495608_0236997
432 Ga0495628_0217481
433 Ga0495628_0664696
434 Ga0495630_0066669
435 Ga0495630_0595367
436 Ga0495652_0255970
437 Ga0495652_0628068
438 Ga0495652_0889604
439 Ga0495665_0263010
440 Ga0495667_0077133
441 Ga0495634_0091462
442 Ga0495634_0341963
443 Ga0495634_0787266
444 Ga0495635_0123522
445 Ga0495657_0296276
446 Ga0495657_0827259
447 Ga0495599_0738563
448 Ga0495623_0588530
449 Ga0495658_0031422
450 Ga0495613_0408268
451 Ga0495613_1049661
452 Ga0495600_0526655
453 Ga0495581_0734963
454 Ga0495674_0136363
455 Ga0495680_0238538
456 Ga0495680_0278850
457 Ga0495680_0371276
458 Ga0495593_0188321
459 Ga0495615_0064529
460 Ga0496100_0110303
461 Ga0496100_0357360
462 Ga0496101_0201895
463 Ga0496102_0110534
464 Ga0496104_0052071
465 Ga0496104_0351037
466 Ga0496104_1006197
467 Ga0496105_0125115
468 Ga0496105_0410595
469 Ga0496105_1260773
470 Ga0496106_0222167
471 Ga0496107_0318079
472 Ga0496107_0326755
473 Ga0496108_0019351
474 Ga0496108_1259325
475 Ga0496109_0001518
476 Ga0496109_0138118
477 Ga0496109_0945611
478 Ga0496110_0002108
479 Ga0496110_0360331
480 Ga0496110_0755202
481 Ga0496111_0000359
482 Ga0496112_0021506
483 Ga0496112_0558149
484 Ga0496113_0033516
485 Ga0496113_0275882
486 Ga0496113_0374418
487 Ga0496114_0042627
488 Ga0496114_1408106
489 Ga0496115_0722284
490 Ga0501031_0002854
491 Ga0501031_0065461
492 Ga0501031_0125107
493 Ga0501032_0005053
494 Ga0501032_0030124
495 Ga0501033_0001995
496 Ga0501033_0016378
497 Ga0501034_0025185
498 Ga0501034_0217704
499 Ga0501036_0019039
500 Ga0501036_0027573
501 Ga0501037_0001952
502 Ga0501037_0002931
503 Ga0501038_0003618
504 Ga0501038_0008725
505 Ga0501039_0013453
506 Ga0501039_0023430
507 Ga0501039_0457652
508 Ga0501040_0009343
509 Ga0501040_0061202
510 Ga0501040_0086741
511 Ga0501041_0003228
512 Ga0501041_0088046
513 Ga0501041_0202757
514 Ga0501042_0005628
515 Ga0501042_0016780
516 Ga0501042_0164646
517 Ga0501043_0003253
518 Ga0501043_0117007
519 Ga0501043_0248787
520 Ga0501046_0003201
521 Ga0501046_0003649
522 Ga0501047_0023621
523 Ga0501047_0304649
524 Ga0501048_0003186
525 Ga0501048_0008629
526 Ga0501048_0096927
527 Ga0501048_1311712
528 Ga0501067_0000751
529 Ga0501067_0050346
530 Ga0501067_0094127
531 Ga0501067_0364607
532 Ga0501068_0007217
533 Ga0501068_0010443
534 Ga0501068_0018019
535 Ga0501068_0060778
536 Ga0501068_0166840
537 Ga0501068_0648027
538 Ga0501069_0000767
539 Ga0501069_0001923
540 Ga0501069_0020262
541 Ga0501069_0085467
542 Ga0501069_0174990
543 Ga0501070_0009310
544 Ga0501070_0017852
545 Ga0501070_0244323
546 Ga0501071_0022222
547 Ga0501071_0028997
548 Ga0501071_0032069
549 Ga0501071_0198513
550 Ga0501072_0021175
551 Ga0501072_0026133
552 Ga0501073_0000754
553 Ga0501073_0001630
554 Ga0501073_0989149
555 Ga0501074_0020490
556 Ga0501074_0021614
557 Ga0501074_0435357
558 Ga0501075_0009353
559 Ga0501075_0031730
560 Ga0501075_0555136
561 Ga0501075_1480021
562 Ga0501076_0009818
563 Ga0501076_0050150
564 Ga0501076_0088815
565 Ga0501077_0010528
566 Ga0501077_0032879
567 Ga0501077_0106688
568 Ga0501079_0005555
569 Ga0501079_0027173
570 Ga0501080_0004395
571 Ga0501080_0012337
572 Ga0501080_0111344
573 Ga0501080_0268638
574 Ga0501081_0016660
575 Ga0501081_0036654
576 Ga0501081_0091518
577 Ga0501083_0001667
578 Ga0501083_0040018
579 Ga0501083_0118766
580 Ga0501035_0012786
581 Ga0501035_0027996
582 Ga0501035_0096941
583 Ga0501044_0006171
584 Ga0501044_0110242
585 Ga0501045_0003408
586 Ga0501045_0020305
587 Ga0501045_0639795
588 nmdc:mga0n895_234158_c1
589 nmdc:mga0a205_44851_c1
590 Ga0495601_0429716
591 Ga0495601_0938794
592 Ga0495595_0246092
593 Ga0495619_0047678
594 Ga0495619_0138501
595 Ga0500566_0415581
596 Ga0501084_0015804
597 Ga0501084_0061911
598 Ga0501082_0033644
599 Ga0501082_0085365
600 Ga0501082_0591442
601 Ga0501082_0605607
602 Ga0530510_0019617
603 Ga0530510_0029992
604 Ga0530510_0090115
605 Ga0530510_0184807
606 Ga0530510_0622840

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

2

82

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b4v-assembly2.cif.gz_GD antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome 0.9477 9 83
4v8g-assembly1.cif.gz_AT crystal structure of rmf bound to the 70s ribosome. 0.9467 9 86
4dv5-assembly1.cif.gz_T crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin 0.9466 9 83
4v47-assembly1.cif.gz_BT real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.9448 8 87
7v2p-assembly1.cif.gz_T t.thermophilus 30s ribosome with ksga, class k5 0.9434 9 86
ID Description Score Start End Superfamily
af_O14338_103_408_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9633 26 59 1.25.40.10
af_A0A0R0JQH9_25_317_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9512 21 59 1.20.120.670
4jyaT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9482 9 83 1.20.58.110
4qjtt00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9456 9 85 1.20.58.110
6caqT00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 0.9445 9 83 1.20.58.110
ID Description Score Start End GO Terms
AF-A0A7W0LMQ1-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9928 24 83 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0W0G2-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9685 9 83 GO:0003735
GO:0006412
GO:0015935
GO:0070181
AF-A0A7W0PKM4-F1-model_v4 Small ribosomal subunit protein bS20 0.9529 3 88 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A1F8QQ69-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9492 12 86 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A6L6B8C7-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9489 19 86 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181

Map