F397277
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 178 | 606 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0139602|Ga0501047_0139602_615_947 |
| Length | 86 |
| Sequence | MPNIKQQEKRVRTAARQRLENLRYRSGIKTLTRRLREATETGTEVDAAYKALVRMVDKAAAKGAIHKNAAARKKSQAARLLATPVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 21 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 26 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 27 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 29 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 69 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 70 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 73 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 74 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 75 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 77 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 80 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 82 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 83 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 84 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 87 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 88 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 89 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 90 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 91 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 92 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 93 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 94 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 95 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 127 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 128 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 129 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 133 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 137 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 138 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 176 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 10.23 |
| Rhizosphere | 89.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501047_0139602 | 3300049581 | Bacteria | 2302 |
| 2 | rootL2_10228306 | 3300003322 | Bacteria | 1256 |
| 3 | Ga0070658_10702595 | 3300005327 | Bacteria | 878 |
| 4 | Ga0070683_100288211 | 3300005329 | Unclassified | 1562 |
| 5 | Ga0070683_100516273 | 3300005329 | Bacteria | 1142 |
| 6 | Ga0070682_101286911 | 3300005337 | Bacteria | 621 |
| 7 | Ga0070660_100010364 | 3300005339 | Bacteria | 6586 |
| 8 | Ga0070661_100068665 | 3300005344 | Bacteria | 2605 |
| 9 | Ga0070659_100026342 | 3300005366 | Bacteria | 4474 |
| 10 | Ga0070711_100886584 | 3300005439 | Bacteria | 761 |
| 11 | Ga0070708_100246449 | 3300005445 | Bacteria | 1678 |
| 12 | Ga0070706_100796481 | 3300005467 | Bacteria | 875 |
| 13 | Ga0070707_100299754 | 3300005468 | Bacteria | 1562 |
| 14 | Ga0070699_100093716 | 3300005518 | Bacteria | 2628 |
| 15 | Ga0070684_101885999 | 3300005535 | Bacteria | 564 |
| 16 | Ga0068853_100327471 | 3300005539 | Bacteria | 1421 |
| 17 | Ga0070665_100936229 | 3300005548 | Bacteria | 879 |
| 18 | Ga0070664_102048732 | 3300005564 | Unclassified | 543 |
| 19 | Ga0068852_100121656 | 3300005616 | Bacteria | 2391 |
| 20 | Ga0068859_101589031 | 3300005617 | Bacteria | 722 |
| 21 | Ga0068870_11182169 | 3300005840 | Bacteria | 553 |
| 22 | Ga0081538_10080920 | 3300005981 | Bacteria | 1730 |
| 23 | Ga0081539_10044934 | 3300005985 | Bacteria | 2545 |
| 24 | Ga0081539_10220760 | 3300005985 | Bacteria | 862 |
| 25 | Ga0070712_100621366 | 3300006175 | Bacteria | 916 |
| 26 | Ga0097621_100896258 | 3300006237 | Bacteria | 826 |
| 27 | Ga0075433_10052936 | 3300006852 | Bacteria | 3538 |
| 28 | Ga0075434_100246543 | 3300006871 | Bacteria | 1806 |
| 29 | Ga0097620_101588975 | 3300006931 | Bacteria | 722 |
| 30 | Ga0075435_101969055 | 3300007076 | Bacteria | 513 |
| 31 | Ga0099794_10432915 | 3300007265 | Bacteria | 689 |
| 32 | Ga0111539_11514230 | 3300009094 | Bacteria | 778 |
| 33 | Ga0105247_11593695 | 3300009101 | Bacteria | 536 |
| 34 | Ga0114129_10087254 | 3300009147 | Bacteria | 4327 |
| 35 | Ga0114129_10560822 | 3300009147 | Bacteria | 1484 |
| 36 | Ga0114129_11380763 | 3300009147 | Bacteria | 870 |
| 37 | Ga0105243_11783912 | 3300009148 | Unclassified | 646 |
| 38 | Ga0105241_11990262 | 3300009174 | Bacteria | 572 |
| 39 | Ga0105248_10484930 | 3300009177 | Unclassified | 1393 |
| 40 | Ga0105248_11109660 | 3300009177 | Unclassified | 894 |
| 41 | Ga0105237_12470454 | 3300009545 | Bacteria | 530 |
| 42 | Ga0105249_11777825 | 3300009553 | Bacteria | 689 |
| 43 | Ga0105030_118033 | 3300009987 | Bacteria | 634 |
| 44 | Ga0157371_11584661 | 3300013102 | Bacteria | 512 |
| 45 | Ga0157369_10224354 | 3300013105 | Bacteria | 1966 |
| 46 | Ga0157378_11619569 | 3300013297 | Unclassified | 693 |
| 47 | Ga0157372_10505615 | 3300013307 | Bacteria | 1409 |
| 48 | Ga0157375_10425106 | 3300013308 | Unclassified | 1494 |
| 49 | Ga0157376_11762034 | 3300014969 | Unclassified | 655 |
| 50 | Ga0206356_11691416 | 3300020070 | Bacteria | 1886 |
| 51 | Ga0206354_10007320 | 3300020081 | Bacteria | 2149 |
| 52 | Ga0206353_12066276 | 3300020082 | Bacteria | 4651 |
| 53 | Ga0207692_11129279 | 3300025898 | Unclassified | 519 |
| 54 | Ga0207705_10306933 | 3300025909 | Bacteria | 1218 |
| 55 | Ga0207707_10038770 | 3300025912 | Bacteria | 4164 |
| 56 | Ga0207693_10754863 | 3300025915 | Bacteria | 751 |
| 57 | Ga0207660_10027190 | 3300025917 | Bacteria | 3901 |
| 58 | Ga0207657_10019424 | 3300025919 | Bacteria | 6453 |
| 59 | Ga0207649_10111473 | 3300025920 | Bacteria | 1829 |
| 60 | Ga0207652_10013380 | 3300025921 | Bacteria | 6643 |
| 61 | Ga0207650_11423315 | 3300025925 | Unclassified | 590 |
| 62 | Ga0207659_10996305 | 3300025926 | Unclassified | 721 |
| 63 | Ga0207690_10941775 | 3300025932 | Bacteria | 717 |
| 64 | Ga0207709_10805593 | 3300025935 | Unclassified | 758 |
| 65 | Ga0207689_10113871 | 3300025942 | Unclassified | 2223 |
| 66 | Ga0207661_10358337 | 3300025944 | Bacteria | 1317 |
| 67 | Ga0207703_11372002 | 3300026035 | Unclassified | 680 |
| 68 | Ga0207639_10200171 | 3300026041 | Bacteria | 1712 |
| 69 | Ga0207674_10744757 | 3300026116 | Bacteria | 946 |
| 70 | Ga0207674_11293921 | 3300026116 | Unclassified | 699 |
| 71 | Ga0207683_11328800 | 3300026121 | Unclassified | 665 |
| 72 | Ga0207698_10038135 | 3300026142 | Bacteria | 3547 |
| 73 | Ga0265337_1090586 | 3300028556 | Bacteria | 834 |
| 74 | Ga0265318_10004807 | 3300028577 | Bacteria | 6468 |
| 75 | Ga0265338_10024413 | 3300028800 | Bacteria | 6176 |
| 76 | Ga0265338_10055511 | 3300028800 | Bacteria | 3522 |
| 77 | Ga0265324_10190898 | 3300029957 | Bacteria | 696 |
| 78 | Ga0265330_10017673 | 3300031235 | Bacteria | 3282 |
| 79 | Ga0265330_10057746 | 3300031235 | Bacteria | 1692 |
| 80 | Ga0265332_10158386 | 3300031238 | Bacteria | 946 |
| 81 | Ga0265320_10008301 | 3300031240 | Bacteria | 6360 |
| 82 | Ga0265325_10048021 | 3300031241 | Bacteria | 2208 |
| 83 | Ga0265329_10185820 | 3300031242 | Bacteria | 681 |
| 84 | Ga0265339_10003801 | 3300031249 | Bacteria | 10498 |
| 85 | Ga0265331_10099731 | 3300031250 | Bacteria | 1337 |
| 86 | Ga0265327_10022960 | 3300031251 | Bacteria | 3710 |
| 87 | Ga0265316_10029203 | 3300031344 | Bacteria | 4537 |
| 88 | Ga0265316_10076553 | 3300031344 | Bacteria | 2570 |
| 89 | Ga0265314_10003240 | 3300031711 | Bacteria | 15912 |
| 90 | Ga0265314_10005935 | 3300031711 | Bacteria | 10916 |
| 91 | Ga0265342_10034388 | 3300031712 | Bacteria | 3109 |
| 92 | Ga0265342_10419407 | 3300031712 | Bacteria | 689 |
| 93 | Ga0373945_0281383 | 3300035116 | Unclassified | 709 |
| 94 | Ga0373962_0235627 | 3300035242 | Unclassified | 631 |
| 95 | Ga0373931_0523368 | 3300035691 | Bacteria | 768 |
| 96 | Ga0395900_0081821 | 3300037418 | Bacteria | 3317 |
| 97 | Ga0395900_0134023 | 3300037418 | Unclassified | 2538 |
| 98 | Ga0395900_1205572 | 3300037418 | Unclassified | 672 |
| 99 | Ga0395905_0168688 | 3300037471 | Bacteria | 2056 |
| 100 | Ga0395905_1140732 | 3300037471 | Unclassified | 683 |
| 101 | Ga0395905_1654353 | 3300037471 | Bacteria | 545 |
| 102 | Ga0395901_0013039 | 3300038443 | Bacteria | 8435 |
| 103 | Ga0395901_0356542 | 3300038443 | Bacteria | 1509 |
| 104 | Ga0395901_0392286 | 3300038443 | Bacteria | 1427 |
| 105 | Ga0439453_0087899 | 3300041408 | Unclassified | 679 |
| 106 | Ga0451807_1627899 | 3300041486 | Unclassified | 1317 |
| 107 | Ga0466961_0289688 | 3300044693 | Bacteria | 1001 |
| 108 | Ga0466963_0088391 | 3300044694 | Bacteria | 2108 |
| 109 | Ga0466963_0164417 | 3300044694 | Unclassified | 1546 |
| 110 | Ga0466970_0461570 | 3300044765 | Bacteria | 729 |
| 111 | Ga0466957_0363404 | 3300044842 | Bacteria | 984 |
| 112 | Ga0466967_0046746 | 3300045976 | Bacteria | 3770 |
| 113 | Ga0466967_0074274 | 3300045976 | Bacteria | 3053 |
| 114 | Ga0466967_0101887 | 3300045976 | Unclassified | 2625 |
| 115 | Ga0466967_1739313 | 3300045976 | Bacteria | 621 |
| 116 | Ga0495592_0098471 | 3300046454 | Bacteria | 2087 |
| 117 | Ga0495629_0003253 | 3300046459 | Bacteria | 12304 |
| 118 | Ga0495629_0058834 | 3300046459 | Bacteria | 2687 |
| 119 | Ga0495629_0506844 | 3300046459 | Bacteria | 813 |
| 120 | Ga0495641_0469421 | 3300046461 | Unclassified | 573 |
| 121 | Ga0495651_0602355 | 3300046462 | Unclassified | 693 |
| 122 | Ga0495653_0257185 | 3300046463 | Unclassified | 1156 |
| 123 | Ga0495582_0405482 | 3300046473 | Unclassified | 786 |
| 124 | Ga0495664_0575797 | 3300046477 | Bacteria | 670 |
| 125 | Ga0495594_0388024 | 3300046499 | Bacteria | 795 |
| 126 | Ga0495594_0612903 | 3300046499 | Bacteria | 617 |
| 127 | Ga0495607_0107143 | 3300046501 | Bacteria | 1487 |
| 128 | Ga0495608_0236997 | 3300046511 | Unclassified | 1141 |
| 129 | Ga0495628_0217481 | 3300046516 | Bacteria | 1436 |
| 130 | Ga0495628_0664696 | 3300046516 | Unclassified | 739 |
| 131 | Ga0495630_0066669 | 3300046517 | Bacteria | 2706 |
| 132 | Ga0495630_0595367 | 3300046517 | Bacteria | 848 |
| 133 | Ga0495652_0255970 | 3300046529 | Bacteria | 1295 |
| 134 | Ga0495652_0628068 | 3300046529 | Bacteria | 730 |
| 135 | Ga0495652_0889604 | 3300046529 | Unclassified | 588 |
| 136 | Ga0495665_0263010 | 3300046531 | Bacteria | 887 |
| 137 | Ga0495667_0077133 | 3300046559 | Unclassified | 2168 |
| 138 | Ga0495634_0091462 | 3300046642 | Bacteria | 1975 |
| 139 | Ga0495634_0341963 | 3300046642 | Bacteria | 897 |
| 140 | Ga0495634_0787266 | 3300046642 | Bacteria | 543 |
| 141 | Ga0495635_0123522 | 3300046663 | Unclassified | 1765 |
| 142 | Ga0495657_0296276 | 3300046675 | Unclassified | 965 |
| 143 | Ga0495657_0827259 | 3300046675 | Unclassified | 528 |
| 144 | Ga0495599_0738563 | 3300046678 | Bacteria | 565 |
| 145 | Ga0495623_0588530 | 3300046679 | Unclassified | 579 |
| 146 | Ga0495658_0031422 | 3300046683 | Bacteria | 2892 |
| 147 | Ga0495613_0408268 | 3300046689 | Bacteria | 926 |
| 148 | Ga0495613_1049661 | 3300046689 | Unclassified | 522 |
| 149 | Ga0495600_0526655 | 3300046809 | Unclassified | 724 |
| 150 | Ga0495581_0734963 | 3300047315 | Unclassified | 568 |
| 151 | Ga0495674_0136363 | 3300047319 | Unclassified | 2065 |
| 152 | Ga0495680_0238538 | 3300047322 | Unclassified | 1292 |
| 153 | Ga0495680_0278850 | 3300047322 | Unclassified | 1178 |
| 154 | Ga0495680_0371276 | 3300047322 | Bacteria | 992 |
| 155 | Ga0495593_0188321 | 3300047673 | Unclassified | 1038 |
| 156 | Ga0495615_0064529 | 3300048090 | Archaea | 974 |
| 157 | Ga0496100_0110303 | 3300048903 | Unclassified | 1910 |
| 158 | Ga0496100_0357360 | 3300048903 | Unclassified | 1104 |
| 159 | Ga0496101_0201895 | 3300048904 | Unclassified | 1537 |
| 160 | Ga0496102_0110534 | 3300048905 | Bacteria | 2562 |
| 161 | Ga0496104_0052071 | 3300048907 | Bacteria | 3866 |
| 162 | Ga0496104_0351037 | 3300048907 | Unclassified | 1388 |
| 163 | Ga0496104_1006197 | 3300048907 | Unclassified | 737 |
| 164 | Ga0496105_0125115 | 3300048908 | Bacteria | 2119 |
| 165 | Ga0496105_0410595 | 3300048908 | Unclassified | 1073 |
| 166 | Ga0496105_1260773 | 3300048908 | Bacteria | 541 |
| 167 | Ga0496106_0222167 | 3300048909 | Bacteria | 1507 |
| 168 | Ga0496107_0318079 | 3300048910 | Bacteria | 1158 |
| 169 | Ga0496107_0326755 | 3300048910 | Bacteria | 1141 |
| 170 | Ga0496108_0019351 | 3300048911 | Bacteria | 5590 |
| 171 | Ga0496108_1259325 | 3300048911 | Unclassified | 623 |
| 172 | Ga0496109_0001518 | 3300048912 | Bacteria | 19311 |
| 173 | Ga0496109_0138118 | 3300048912 | Bacteria | 2279 |
| 174 | Ga0496109_0945611 | 3300048912 | Bacteria | 800 |
| 175 | Ga0496110_0002108 | 3300048913 | Bacteria | 14845 |
| 176 | Ga0496110_0360331 | 3300048913 | Unclassified | 1325 |
| 177 | Ga0496110_0755202 | 3300048913 | Bacteria | 876 |
| 178 | Ga0496111_0000359 | 3300048914 | Bacteria | 22584 |
| 179 | Ga0496112_0021506 | 3300048915 | Bacteria | 6137 |
| 180 | Ga0496112_0558149 | 3300048915 | Unclassified | 1079 |
| 181 | Ga0496113_0033516 | 3300048916 | Bacteria | 3740 |
| 182 | Ga0496113_0275882 | 3300048916 | Unclassified | 1344 |
| 183 | Ga0496113_0374418 | 3300048916 | Unclassified | 1143 |
| 184 | Ga0496114_0042627 | 3300048917 | Bacteria | 3762 |
| 185 | Ga0496114_1408106 | 3300048917 | Unclassified | 585 |
| 186 | Ga0496115_0722284 | 3300048918 | Bacteria | 781 |
| 187 | Ga0501031_0002854 | 3300049568 | Bacteria | 11035 |
| 188 | Ga0501031_0065461 | 3300049568 | Bacteria | 2368 |
| 189 | Ga0501031_0125107 | 3300049568 | Bacteria | 1679 |
| 190 | Ga0501032_0005053 | 3300049569 | Bacteria | 9863 |
| 191 | Ga0501032_0030124 | 3300049569 | Bacteria | 3722 |
| 192 | Ga0501033_0001995 | 3300049570 | Bacteria | 17792 |
| 193 | Ga0501033_0016378 | 3300049570 | Bacteria | 5614 |
| 194 | Ga0501034_0025185 | 3300049571 | Bacteria | 6055 |
| 195 | Ga0501034_0217704 | 3300049571 | Bacteria | 1863 |
| 196 | Ga0501036_0019039 | 3300049572 | Bacteria | 5760 |
| 197 | Ga0501036_0027573 | 3300049572 | Bacteria | 4799 |
| 198 | Ga0501037_0001952 | 3300049573 | Bacteria | 14896 |
| 199 | Ga0501037_0002931 | 3300049573 | Bacteria | 12376 |
| 200 | Ga0501038_0003618 | 3300049574 | Bacteria | 14395 |
| 201 | Ga0501038_0008725 | 3300049574 | Bacteria | 9303 |
| 202 | Ga0501039_0013453 | 3300049575 | Bacteria | 6258 |
| 203 | Ga0501039_0023430 | 3300049575 | Bacteria | 4738 |
| 204 | Ga0501039_0457652 | 3300049575 | Unclassified | 1002 |
| 205 | Ga0501040_0009343 | 3300049576 | Bacteria | 6387 |
| 206 | Ga0501040_0061202 | 3300049576 | Bacteria | 2588 |
| 207 | Ga0501040_0086741 | 3300049576 | Bacteria | 2173 |
| 208 | Ga0501041_0003228 | 3300049577 | Bacteria | 9372 |
| 209 | Ga0501041_0088046 | 3300049577 | Bacteria | 1916 |
| 210 | Ga0501041_0202757 | 3300049577 | Bacteria | 1244 |
| 211 | Ga0501042_0005628 | 3300049578 | Bacteria | 8080 |
| 212 | Ga0501042_0016780 | 3300049578 | Bacteria | 5035 |
| 213 | Ga0501042_0164646 | 3300049578 | Bacteria | 1600 |
| 214 | Ga0501043_0003253 | 3300049579 | Bacteria | 13391 |
| 215 | Ga0501043_0117007 | 3300049579 | Bacteria | 2091 |
| 216 | Ga0501043_0248787 | 3300049579 | Bacteria | 1370 |
| 217 | Ga0501046_0003201 | 3300049580 | Bacteria | 15064 |
| 218 | Ga0501046_0003649 | 3300049580 | Bacteria | 14103 |
| 219 | Ga0501047_0023621 | 3300049581 | Bacteria | 5902 |
| 220 | Ga0501047_0304649 | 3300049581 | Bacteria | 1435 |
| 221 | Ga0501048_0003186 | 3300049582 | Bacteria | 12510 |
| 222 | Ga0501048_0008629 | 3300049582 | Bacteria | 7694 |
| 223 | Ga0501048_0096927 | 3300049582 | Bacteria | 2080 |
| 224 | Ga0501048_1311712 | 3300049582 | Bacteria | 520 |
| 225 | Ga0501067_0000751 | 3300049583 | Bacteria | 17412 |
| 226 | Ga0501067_0050346 | 3300049583 | Bacteria | 2308 |
| 227 | Ga0501067_0094127 | 3300049583 | Bacteria | 1663 |
| 228 | Ga0501067_0364607 | 3300049583 | Bacteria | 805 |
| 229 | Ga0501068_0007217 | 3300049584 | Bacteria | 6151 |
| 230 | Ga0501068_0010443 | 3300049584 | Bacteria | 5218 |
| 231 | Ga0501068_0018019 | 3300049584 | Bacteria | 4088 |
| 232 | Ga0501068_0060778 | 3300049584 | Bacteria | 2295 |
| 233 | Ga0501068_0166840 | 3300049584 | Bacteria | 1389 |
| 234 | Ga0501068_0648027 | 3300049584 | Unclassified | 689 |
| 235 | Ga0501069_0000767 | 3300049585 | Bacteria | 15020 |
| 236 | Ga0501069_0001923 | 3300049585 | Bacteria | 10374 |
| 237 | Ga0501069_0020262 | 3300049585 | Bacteria | 3602 |
| 238 | Ga0501069_0085467 | 3300049585 | Unclassified | 1780 |
| 239 | Ga0501069_0174990 | 3300049585 | Bacteria | 1239 |
| 240 | Ga0501070_0009310 | 3300049586 | Bacteria | 8308 |
| 241 | Ga0501070_0017852 | 3300049586 | Bacteria | 5958 |
| 242 | Ga0501070_0244323 | 3300049586 | Bacteria | 1469 |
| 243 | Ga0501071_0022222 | 3300049587 | Bacteria | 4421 |
| 244 | Ga0501071_0028997 | 3300049587 | Bacteria | 3903 |
| 245 | Ga0501071_0032069 | 3300049587 | Bacteria | 3729 |
| 246 | Ga0501071_0198513 | 3300049587 | Bacteria | 1506 |
| 247 | Ga0501072_0021175 | 3300049588 | Bacteria | 5043 |
| 248 | Ga0501072_0026133 | 3300049588 | Bacteria | 4549 |
| 249 | Ga0501073_0000754 | 3300049589 | Bacteria | 22923 |
| 250 | Ga0501073_0001630 | 3300049589 | Bacteria | 16651 |
| 251 | Ga0501073_0989149 | 3300049589 | Bacteria | 579 |
| 252 | Ga0501074_0020490 | 3300049590 | Bacteria | 4805 |
| 253 | Ga0501074_0021614 | 3300049590 | Bacteria | 4671 |
| 254 | Ga0501074_0435357 | 3300049590 | Bacteria | 930 |
| 255 | Ga0501075_0009353 | 3300049591 | Bacteria | 6854 |
| 256 | Ga0501075_0031730 | 3300049591 | Bacteria | 3923 |
| 257 | Ga0501075_0555136 | 3300049591 | Bacteria | 876 |
| 258 | Ga0501075_1480021 | 3300049591 | Bacteria | 514 |
| 259 | Ga0501076_0009818 | 3300049592 | Bacteria | 7073 |
| 260 | Ga0501076_0050150 | 3300049592 | Bacteria | 3301 |
| 261 | Ga0501076_0088815 | 3300049592 | Bacteria | 2484 |
| 262 | Ga0501077_0010528 | 3300049593 | Bacteria | 5757 |
| 263 | Ga0501077_0032879 | 3300049593 | Bacteria | 3303 |
| 264 | Ga0501077_0106688 | 3300049593 | Bacteria | 1775 |
| 265 | Ga0501079_0005555 | 3300049741 | Bacteria | 9404 |
| 266 | Ga0501079_0027173 | 3300049741 | Bacteria | 4386 |
| 267 | Ga0501080_0004395 | 3300049742 | Bacteria | 12527 |
| 268 | Ga0501080_0012337 | 3300049742 | Bacteria | 7831 |
| 269 | Ga0501080_0111344 | 3300049742 | Bacteria | 2537 |
| 270 | Ga0501080_0268638 | 3300049742 | Unclassified | 1553 |
| 271 | Ga0501081_0016660 | 3300049743 | Bacteria | 4859 |
| 272 | Ga0501081_0036654 | 3300049743 | Bacteria | 3344 |
| 273 | Ga0501081_0091518 | 3300049743 | Bacteria | 2139 |
| 274 | Ga0501083_0001667 | 3300049744 | Bacteria | 15162 |
| 275 | Ga0501083_0040018 | 3300049744 | Bacteria | 3182 |
| 276 | Ga0501083_0118766 | 3300049744 | Unclassified | 1735 |
| 277 | Ga0501035_0012786 | 3300049822 | Bacteria | 7753 |
| 278 | Ga0501035_0027996 | 3300049822 | Bacteria | 5148 |
| 279 | Ga0501035_0096941 | 3300049822 | Bacteria | 2591 |
| 280 | Ga0501044_0006171 | 3300049823 | Bacteria | 13245 |
| 281 | Ga0501044_0110242 | 3300049823 | Bacteria | 2761 |
| 282 | Ga0501045_0003408 | 3300049824 | Bacteria | 10876 |
| 283 | Ga0501045_0020305 | 3300049824 | Bacteria | 4745 |
| 284 | Ga0501045_0639795 | 3300049824 | Unclassified | 786 |
| 285 | nmdc:mga0n895_234158_c1 | 3300050512 | Bacteria | 1864 |
| 286 | nmdc:mga0a205_44851_c1 | 3300050515 | Bacteria | 4263 |
| 287 | Ga0495601_0429716 | 3300053077 | Unclassified | 855 |
| 288 | Ga0495601_0938794 | 3300053077 | Unclassified | 545 |
| 289 | Ga0495595_0246092 | 3300053084 | Bacteria | 895 |
| 290 | Ga0495619_0047678 | 3300053085 | Unclassified | 2822 |
| 291 | Ga0495619_0138501 | 3300053085 | Bacteria | 1675 |
| 292 | Ga0500566_0415581 | 3300053094 | Bacteria | 598 |
| 293 | Ga0501084_0015804 | 3300054114 | Bacteria | 6259 |
| 294 | Ga0501084_0061911 | 3300054114 | Bacteria | 3133 |
| 295 | Ga0501082_0033644 | 3300060353 | Bacteria | 4421 |
| 296 | Ga0501082_0085365 | 3300060353 | Bacteria | 2722 |
| 297 | Ga0501082_0591442 | 3300060353 | Bacteria | 971 |
| 298 | Ga0501082_0605607 | 3300060353 | Bacteria | 959 |
| 299 | Ga0530510_0019617 | 3300061734 | Bacteria | 4799 |
| 300 | Ga0530510_0029992 | 3300061734 | Bacteria | 3905 |
| 301 | Ga0530510_0090115 | 3300061734 | Bacteria | 2236 |
| 302 | Ga0530510_0184807 | 3300061734 | Unclassified | 1546 |
| 303 | Ga0530510_0622840 | 3300061734 | Unclassified | 821 |
| 304 | Ga0501047_0139602 | |||
| 305 | rootL2_10228306 | |||
| 306 | Ga0070658_10702595 | |||
| 307 | Ga0070683_100288211 | |||
| 308 | Ga0070683_100516273 | |||
| 309 | Ga0070682_101286911 | |||
| 310 | Ga0070660_100010364 | |||
| 311 | Ga0070661_100068665 | |||
| 312 | Ga0070659_100026342 | |||
| 313 | Ga0070711_100886584 | |||
| 314 | Ga0070708_100246449 | |||
| 315 | Ga0070706_100796481 | |||
| 316 | Ga0070707_100299754 | |||
| 317 | Ga0070699_100093716 | |||
| 318 | Ga0070684_101885999 | |||
| 319 | Ga0068853_100327471 | |||
| 320 | Ga0070665_100936229 | |||
| 321 | Ga0070664_102048732 | |||
| 322 | Ga0068852_100121656 | |||
| 323 | Ga0068859_101589031 | |||
| 324 | Ga0068870_11182169 | |||
| 325 | Ga0081538_10080920 | |||
| 326 | Ga0081539_10044934 | |||
| 327 | Ga0081539_10220760 | |||
| 328 | Ga0070712_100621366 | |||
| 329 | Ga0097621_100896258 | |||
| 330 | Ga0075433_10052936 | |||
| 331 | Ga0075434_100246543 | |||
| 332 | Ga0097620_101588975 | |||
| 333 | Ga0075435_101969055 | |||
| 334 | Ga0099794_10432915 | |||
| 335 | Ga0111539_11514230 | |||
| 336 | Ga0105247_11593695 | |||
| 337 | Ga0114129_10087254 | |||
| 338 | Ga0114129_10560822 | |||
| 339 | Ga0114129_11380763 | |||
| 340 | Ga0105243_11783912 | |||
| 341 | Ga0105241_11990262 | |||
| 342 | Ga0105248_10484930 | |||
| 343 | Ga0105248_11109660 | |||
| 344 | Ga0105237_12470454 | |||
| 345 | Ga0105249_11777825 | |||
| 346 | Ga0105030_118033 | |||
| 347 | Ga0157371_11584661 | |||
| 348 | Ga0157369_10224354 | |||
| 349 | Ga0157378_11619569 | |||
| 350 | Ga0157372_10505615 | |||
| 351 | Ga0157375_10425106 | |||
| 352 | Ga0157376_11762034 | |||
| 353 | Ga0206356_11691416 | |||
| 354 | Ga0206354_10007320 | |||
| 355 | Ga0206353_12066276 | |||
| 356 | Ga0207692_11129279 | |||
| 357 | Ga0207705_10306933 | |||
| 358 | Ga0207707_10038770 | |||
| 359 | Ga0207693_10754863 | |||
| 360 | Ga0207660_10027190 | |||
| 361 | Ga0207657_10019424 | |||
| 362 | Ga0207649_10111473 | |||
| 363 | Ga0207652_10013380 | |||
| 364 | Ga0207650_11423315 | |||
| 365 | Ga0207659_10996305 | |||
| 366 | Ga0207690_10941775 | |||
| 367 | Ga0207709_10805593 | |||
| 368 | Ga0207689_10113871 | |||
| 369 | Ga0207661_10358337 | |||
| 370 | Ga0207703_11372002 | |||
| 371 | Ga0207639_10200171 | |||
| 372 | Ga0207674_10744757 | |||
| 373 | Ga0207674_11293921 | |||
| 374 | Ga0207683_11328800 | |||
| 375 | Ga0207698_10038135 | |||
| 376 | Ga0265337_1090586 | |||
| 377 | Ga0265318_10004807 | |||
| 378 | Ga0265338_10024413 | |||
| 379 | Ga0265338_10055511 | |||
| 380 | Ga0265324_10190898 | |||
| 381 | Ga0265330_10017673 | |||
| 382 | Ga0265330_10057746 | |||
| 383 | Ga0265332_10158386 | |||
| 384 | Ga0265320_10008301 | |||
| 385 | Ga0265325_10048021 | |||
| 386 | Ga0265329_10185820 | |||
| 387 | Ga0265339_10003801 | |||
| 388 | Ga0265331_10099731 | |||
| 389 | Ga0265327_10022960 | |||
| 390 | Ga0265316_10029203 | |||
| 391 | Ga0265316_10076553 | |||
| 392 | Ga0265314_10003240 | |||
| 393 | Ga0265314_10005935 | |||
| 394 | Ga0265342_10034388 | |||
| 395 | Ga0265342_10419407 | |||
| 396 | Ga0373945_0281383 | |||
| 397 | Ga0373962_0235627 | |||
| 398 | Ga0373931_0523368 | |||
| 399 | Ga0395900_0081821 | |||
| 400 | Ga0395900_0134023 | |||
| 401 | Ga0395900_1205572 | |||
| 402 | Ga0395905_0168688 | |||
| 403 | Ga0395905_1140732 | |||
| 404 | Ga0395905_1654353 | |||
| 405 | Ga0395901_0013039 | |||
| 406 | Ga0395901_0356542 | |||
| 407 | Ga0395901_0392286 | |||
| 408 | Ga0439453_0087899 | |||
| 409 | Ga0451807_1627899 | |||
| 410 | Ga0466961_0289688 | |||
| 411 | Ga0466963_0088391 | |||
| 412 | Ga0466963_0164417 | |||
| 413 | Ga0466970_0461570 | |||
| 414 | Ga0466957_0363404 | |||
| 415 | Ga0466967_0046746 | |||
| 416 | Ga0466967_0074274 | |||
| 417 | Ga0466967_0101887 | |||
| 418 | Ga0466967_1739313 | |||
| 419 | Ga0495592_0098471 | |||
| 420 | Ga0495629_0003253 | |||
| 421 | Ga0495629_0058834 | |||
| 422 | Ga0495629_0506844 | |||
| 423 | Ga0495641_0469421 | |||
| 424 | Ga0495651_0602355 | |||
| 425 | Ga0495653_0257185 | |||
| 426 | Ga0495582_0405482 | |||
| 427 | Ga0495664_0575797 | |||
| 428 | Ga0495594_0388024 | |||
| 429 | Ga0495594_0612903 | |||
| 430 | Ga0495607_0107143 | |||
| 431 | Ga0495608_0236997 | |||
| 432 | Ga0495628_0217481 | |||
| 433 | Ga0495628_0664696 | |||
| 434 | Ga0495630_0066669 | |||
| 435 | Ga0495630_0595367 | |||
| 436 | Ga0495652_0255970 | |||
| 437 | Ga0495652_0628068 | |||
| 438 | Ga0495652_0889604 | |||
| 439 | Ga0495665_0263010 | |||
| 440 | Ga0495667_0077133 | |||
| 441 | Ga0495634_0091462 | |||
| 442 | Ga0495634_0341963 | |||
| 443 | Ga0495634_0787266 | |||
| 444 | Ga0495635_0123522 | |||
| 445 | Ga0495657_0296276 | |||
| 446 | Ga0495657_0827259 | |||
| 447 | Ga0495599_0738563 | |||
| 448 | Ga0495623_0588530 | |||
| 449 | Ga0495658_0031422 | |||
| 450 | Ga0495613_0408268 | |||
| 451 | Ga0495613_1049661 | |||
| 452 | Ga0495600_0526655 | |||
| 453 | Ga0495581_0734963 | |||
| 454 | Ga0495674_0136363 | |||
| 455 | Ga0495680_0238538 | |||
| 456 | Ga0495680_0278850 | |||
| 457 | Ga0495680_0371276 | |||
| 458 | Ga0495593_0188321 | |||
| 459 | Ga0495615_0064529 | |||
| 460 | Ga0496100_0110303 | |||
| 461 | Ga0496100_0357360 | |||
| 462 | Ga0496101_0201895 | |||
| 463 | Ga0496102_0110534 | |||
| 464 | Ga0496104_0052071 | |||
| 465 | Ga0496104_0351037 | |||
| 466 | Ga0496104_1006197 | |||
| 467 | Ga0496105_0125115 | |||
| 468 | Ga0496105_0410595 | |||
| 469 | Ga0496105_1260773 | |||
| 470 | Ga0496106_0222167 | |||
| 471 | Ga0496107_0318079 | |||
| 472 | Ga0496107_0326755 | |||
| 473 | Ga0496108_0019351 | |||
| 474 | Ga0496108_1259325 | |||
| 475 | Ga0496109_0001518 | |||
| 476 | Ga0496109_0138118 | |||
| 477 | Ga0496109_0945611 | |||
| 478 | Ga0496110_0002108 | |||
| 479 | Ga0496110_0360331 | |||
| 480 | Ga0496110_0755202 | |||
| 481 | Ga0496111_0000359 | |||
| 482 | Ga0496112_0021506 | |||
| 483 | Ga0496112_0558149 | |||
| 484 | Ga0496113_0033516 | |||
| 485 | Ga0496113_0275882 | |||
| 486 | Ga0496113_0374418 | |||
| 487 | Ga0496114_0042627 | |||
| 488 | Ga0496114_1408106 | |||
| 489 | Ga0496115_0722284 | |||
| 490 | Ga0501031_0002854 | |||
| 491 | Ga0501031_0065461 | |||
| 492 | Ga0501031_0125107 | |||
| 493 | Ga0501032_0005053 | |||
| 494 | Ga0501032_0030124 | |||
| 495 | Ga0501033_0001995 | |||
| 496 | Ga0501033_0016378 | |||
| 497 | Ga0501034_0025185 | |||
| 498 | Ga0501034_0217704 | |||
| 499 | Ga0501036_0019039 | |||
| 500 | Ga0501036_0027573 | |||
| 501 | Ga0501037_0001952 | |||
| 502 | Ga0501037_0002931 | |||
| 503 | Ga0501038_0003618 | |||
| 504 | Ga0501038_0008725 | |||
| 505 | Ga0501039_0013453 | |||
| 506 | Ga0501039_0023430 | |||
| 507 | Ga0501039_0457652 | |||
| 508 | Ga0501040_0009343 | |||
| 509 | Ga0501040_0061202 | |||
| 510 | Ga0501040_0086741 | |||
| 511 | Ga0501041_0003228 | |||
| 512 | Ga0501041_0088046 | |||
| 513 | Ga0501041_0202757 | |||
| 514 | Ga0501042_0005628 | |||
| 515 | Ga0501042_0016780 | |||
| 516 | Ga0501042_0164646 | |||
| 517 | Ga0501043_0003253 | |||
| 518 | Ga0501043_0117007 | |||
| 519 | Ga0501043_0248787 | |||
| 520 | Ga0501046_0003201 | |||
| 521 | Ga0501046_0003649 | |||
| 522 | Ga0501047_0023621 | |||
| 523 | Ga0501047_0304649 | |||
| 524 | Ga0501048_0003186 | |||
| 525 | Ga0501048_0008629 | |||
| 526 | Ga0501048_0096927 | |||
| 527 | Ga0501048_1311712 | |||
| 528 | Ga0501067_0000751 | |||
| 529 | Ga0501067_0050346 | |||
| 530 | Ga0501067_0094127 | |||
| 531 | Ga0501067_0364607 | |||
| 532 | Ga0501068_0007217 | |||
| 533 | Ga0501068_0010443 | |||
| 534 | Ga0501068_0018019 | |||
| 535 | Ga0501068_0060778 | |||
| 536 | Ga0501068_0166840 | |||
| 537 | Ga0501068_0648027 | |||
| 538 | Ga0501069_0000767 | |||
| 539 | Ga0501069_0001923 | |||
| 540 | Ga0501069_0020262 | |||
| 541 | Ga0501069_0085467 | |||
| 542 | Ga0501069_0174990 | |||
| 543 | Ga0501070_0009310 | |||
| 544 | Ga0501070_0017852 | |||
| 545 | Ga0501070_0244323 | |||
| 546 | Ga0501071_0022222 | |||
| 547 | Ga0501071_0028997 | |||
| 548 | Ga0501071_0032069 | |||
| 549 | Ga0501071_0198513 | |||
| 550 | Ga0501072_0021175 | |||
| 551 | Ga0501072_0026133 | |||
| 552 | Ga0501073_0000754 | |||
| 553 | Ga0501073_0001630 | |||
| 554 | Ga0501073_0989149 | |||
| 555 | Ga0501074_0020490 | |||
| 556 | Ga0501074_0021614 | |||
| 557 | Ga0501074_0435357 | |||
| 558 | Ga0501075_0009353 | |||
| 559 | Ga0501075_0031730 | |||
| 560 | Ga0501075_0555136 | |||
| 561 | Ga0501075_1480021 | |||
| 562 | Ga0501076_0009818 | |||
| 563 | Ga0501076_0050150 | |||
| 564 | Ga0501076_0088815 | |||
| 565 | Ga0501077_0010528 | |||
| 566 | Ga0501077_0032879 | |||
| 567 | Ga0501077_0106688 | |||
| 568 | Ga0501079_0005555 | |||
| 569 | Ga0501079_0027173 | |||
| 570 | Ga0501080_0004395 | |||
| 571 | Ga0501080_0012337 | |||
| 572 | Ga0501080_0111344 | |||
| 573 | Ga0501080_0268638 | |||
| 574 | Ga0501081_0016660 | |||
| 575 | Ga0501081_0036654 | |||
| 576 | Ga0501081_0091518 | |||
| 577 | Ga0501083_0001667 | |||
| 578 | Ga0501083_0040018 | |||
| 579 | Ga0501083_0118766 | |||
| 580 | Ga0501035_0012786 | |||
| 581 | Ga0501035_0027996 | |||
| 582 | Ga0501035_0096941 | |||
| 583 | Ga0501044_0006171 | |||
| 584 | Ga0501044_0110242 | |||
| 585 | Ga0501045_0003408 | |||
| 586 | Ga0501045_0020305 | |||
| 587 | Ga0501045_0639795 | |||
| 588 | nmdc:mga0n895_234158_c1 | |||
| 589 | nmdc:mga0a205_44851_c1 | |||
| 590 | Ga0495601_0429716 | |||
| 591 | Ga0495601_0938794 | |||
| 592 | Ga0495595_0246092 | |||
| 593 | Ga0495619_0047678 | |||
| 594 | Ga0495619_0138501 | |||
| 595 | Ga0500566_0415581 | |||
| 596 | Ga0501084_0015804 | |||
| 597 | Ga0501084_0061911 | |||
| 598 | Ga0501082_0033644 | |||
| 599 | Ga0501082_0085365 | |||
| 600 | Ga0501082_0591442 | |||
| 601 | Ga0501082_0605607 | |||
| 602 | Ga0530510_0019617 | |||
| 603 | Ga0530510_0029992 | |||
| 604 | Ga0530510_0090115 | |||
| 605 | Ga0530510_0184807 | |||
| 606 | Ga0530510_0622840 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b4v-assembly2.cif.gz_GD | antibiotic blasticidin s and e. coli release factor 1 bound to the 70s ribosome | 0.9477 | 9 | 83 |
| 4v8g-assembly1.cif.gz_AT | crystal structure of rmf bound to the 70s ribosome. | 0.9467 | 9 | 86 |
| 4dv5-assembly1.cif.gz_T | crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g, bound with streptomycin | 0.9466 | 9 | 83 |
| 4v47-assembly1.cif.gz_BT | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome | 0.9448 | 8 | 87 |
| 7v2p-assembly1.cif.gz_T | t.thermophilus 30s ribosome with ksga, class k5 | 0.9434 | 9 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14338_103_408_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9633 | 26 | 59 | 1.25.40.10 |
| af_A0A0R0JQH9_25_317_1.20.120.670 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase | 0.9512 | 21 | 59 | 1.20.120.670 |
| 4jyaT00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9482 | 9 | 83 | 1.20.58.110 |
| 4qjtt00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9456 | 9 | 85 | 1.20.58.110 |
| 6caqT00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Ribosomal protein S20 | 0.9445 | 9 | 83 | 1.20.58.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LMQ1-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9928 | 24 | 83 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2H0W0G2-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9685 | 9 | 83 |
GO:0003735
GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A7W0PKM4-F1-model_v4 | Small ribosomal subunit protein bS20 | 0.9529 | 3 | 88 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A1F8QQ69-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9492 | 12 | 86 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A6L6B8C7-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9489 | 19 | 86 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |