F397272

General Info

Members Datasets Scaffolds Average Seq Length
303 181 606 441

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0028391|Ga0501036_0028391_1384_2856
Length 475
Sequence LVIPAPIGNPQSAIRQSAQMSLNYLATRFTCSWPWNTLVMLCDGRMVCGCADPYARRLLGDARAESVSAIWTGERLSALRRDLNAGGSSFCGDCALKLPLRTGDAPPQRDLAVRPQPTRLYIECTAACNISCAQACCAPETGITRTRQAGMLDFDLFRRVVDEAGPSLERIEFFNYGEAFLHKRAIEMCEYIKSRLPHVYLYTSTNGLAFTEEQARRLARSGIDEVTFSIDGATQESYVKYRQRGDLARALRNMRAAADEKQAAGRDLPFLNWRYILFTHNDSDGEMDLARRLAAEAGVDRLCWELTDHPEDMYSRRFAPGTADYARIAHEVWDRTGLGNAIPGATPRARIDLRPTLQHLPGLPVIARRGRAVRLRTRVQNASRRPFAARTPHGRRLIRLGAQLCTVSGAVIDRDYERAWLPHDVAPGDAVDVPITLRAPAEPGRYALKFDLVCEGIDWFESHGSPVTITPLVVL

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
112 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
127 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
128 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.94
Nodule 0
Rhizoplane 4.95
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0028391 3300049572 Bacteria 4729
2 Ga0065712_10085192 3300005290 Bacteria 2713
3 Ga0065715_10005920 3300005293 Bacteria 5759
4 Ga0065715_10008049 3300005293 Bacteria 4911
5 Ga0065715_10014270 3300005293 Unclassified 1956
6 Ga0065715_10089425 3300005293 Bacteria 10301
7 Ga0070683_100000326 3300005329 Bacteria 32914
8 Ga0070683_100002445 3300005329 Bacteria 14778
9 Ga0070690_100005627 3300005330 Bacteria 7051
10 Ga0070670_100004688 3300005331 Bacteria 11470
11 Ga0070670_100015796 3300005331 Bacteria 6481
12 Ga0070670_100032503 3300005331 Bacteria 4494
13 Ga0070677_10018427 3300005333 Bacteria 2514
14 Ga0068869_100016747 3300005334 Bacteria 4948
15 Ga0070666_10028024 3300005335 Bacteria 3694
16 Ga0070689_100018035 3300005340 Bacteria 5192
17 Ga0070689_100147713 3300005340 Bacteria 1894
18 Ga0070687_100035838 3300005343 Bacteria 2468
19 Ga0070668_100035387 3300005347 Bacteria 3808
20 Ga0070669_100006846 3300005353 Bacteria 8198
21 Ga0070675_100000515 3300005354 Bacteria 26336
22 Ga0070675_100021629 3300005354 Bacteria 5139
23 Ga0070675_100096084 3300005354 Bacteria 2489
24 Ga0070671_100040632 3300005355 Bacteria 3864
25 Ga0070671_100045359 3300005355 Bacteria 3654
26 Ga0070671_100166192 3300005355 Bacteria 1866
27 Ga0070674_100017447 3300005356 Bacteria 4517
28 Ga0070674_100074607 3300005356 Bacteria 2407
29 Ga0070673_100007144 3300005364 Bacteria 7334
30 Ga0070673_100022587 3300005364 Bacteria 4583
31 Ga0070673_100046488 3300005364 Bacteria 3372
32 Ga0070688_100001778 3300005365 Bacteria 10785
33 Ga0070713_100020403 3300005436 Bacteria 5082
34 Ga0070662_100055615 3300005457 Bacteria 2871
35 Ga0070681_10067656 3300005458 Bacteria 3540
36 Ga0068867_100018536 3300005459 Bacteria 4947
37 Ga0068867_100158450 3300005459 Bacteria 1783
38 Ga0070699_100051923 3300005518 Bacteria 3550
39 Ga0070684_100000168 3300005535 Bacteria 45138
40 Ga0070672_100006955 3300005543 Bacteria 7650
41 Ga0070672_100039134 3300005543 Bacteria 3630
42 Ga0070686_100000438 3300005544 Bacteria 25888
43 Ga0070695_100060865 3300005545 Bacteria 2447
44 Ga0070664_100001248 3300005564 Bacteria 20353
45 Ga0068854_100036566 3300005578 Bacteria 3443
46 Ga0068852_100025184 3300005616 Bacteria 4817
47 Ga0068859_100185341 3300005617 Bacteria 2165
48 Ga0068864_100007161 3300005618 Bacteria 9161
49 Ga0068861_100177215 3300005719 Bacteria 1771
50 Ga0068861_100247995 3300005719 Bacteria 1518
51 Ga0068863_100046141 3300005841 Bacteria 4136
52 Ga0068863_100062048 3300005841 Bacteria 3535
53 Ga0068858_100052461 3300005842 Bacteria 3773
54 Ga0068858_100110006 3300005842 Bacteria 2573
55 Ga0068860_100191057 3300005843 Bacteria 1982
56 Ga0068862_100025434 3300005844 Bacteria 4971
57 Ga0068862_100055533 3300005844 Bacteria 3392
58 Ga0068862_100272905 3300005844 Bacteria 1547
59 Ga0081539_10047941 3300005985 Bacteria 2435
60 Ga0070717_10118794 3300006028 Bacteria 2263
61 Ga0075365_10000951 3300006038 Bacteria 12285
62 Ga0075368_10003270 3300006042 Bacteria 5396
63 Ga0075368_10014069 3300006042 Bacteria 2949
64 Ga0075364_10007303 3300006051 Bacteria 6557
65 Ga0075364_10008652 3300006051 Bacteria 6086
66 Ga0075362_10000489 3300006177 Bacteria 11538
67 Ga0075367_10008193 3300006178 Bacteria 5401
68 Ga0075367_10009128 3300006178 Bacteria 5170
69 Ga0075367_10100796 3300006178 Bacteria 1765
70 Ga0075366_10004237 3300006195 Bacteria 7689
71 Ga0075370_10011543 3300006353 Bacteria 4645
72 Ga0075428_100014864 3300006844 Bacteria 8649
73 Ga0075428_100037184 3300006844 Bacteria 5360
74 Ga0075430_100018688 3300006846 Bacteria 5898
75 Ga0075430_100020696 3300006846 Bacteria 5595
76 Ga0075431_100004362 3300006847 Bacteria 13882
77 Ga0075431_100008733 3300006847 Bacteria 10151
78 Ga0075431_100018733 3300006847 Bacteria 7053
79 Ga0075431_100050925 3300006847 Unclassified 4270
80 Ga0075431_100053307 3300006847 Bacteria 4170
81 Ga0075431_100130180 3300006847 Bacteria 2596
82 Ga0075433_10000771 3300006852 Bacteria 22052
83 Ga0075433_10034875 3300006852 Bacteria 4324
84 Ga0075434_100005218 3300006871 Bacteria 11802
85 Ga0075434_100013308 3300006871 Bacteria 7824
86 Ga0075429_100006230 3300006880 Bacteria 10324
87 Ga0075429_100072929 3300006880 Bacteria 2990
88 Ga0075429_100073043 3300006880 Bacteria 2987
89 Ga0075436_100074606 3300006914 Bacteria 2349
90 Ga0097620_100185339 3300006931 Bacteria 2165
91 Ga0075435_100001374 3300007076 Bacteria 15713
92 Ga0075435_100157515 3300007076 Bacteria 1911
93 Ga0105240_10017207 3300009093 Bacteria 9753
94 Ga0105240_10099422 3300009093 Bacteria 3540
95 Ga0111539_10002086 3300009094 Bacteria 26719
96 Ga0111539_10013664 3300009094 Bacteria 10142
97 Ga0111539_10198464 3300009094 Bacteria 2340
98 Ga0114129_10002530 3300009147 Bacteria 25397
99 Ga0114129_10012135 3300009147 Bacteria 12266
100 Ga0114129_10020431 3300009147 Bacteria 9417
101 Ga0114129_10024673 3300009147 Bacteria 8522
102 Ga0114129_10033249 3300009147 Bacteria 7288
103 Ga0114129_10299810 3300009147 Bacteria 2142
104 Ga0105241_10058600 3300009174 Bacteria 2958
105 Ga0105248_10016814 3300009177 Bacteria 8052
106 Ga0105248_10055504 3300009177 Bacteria 4443
107 Ga0105248_10099758 3300009177 Bacteria 3272
108 Ga0105249_10324933 3300009553 Bacteria 1550
109 Ga0105246_10063330 3300011119 Bacteria 2579
110 Ga0163162_10201362 3300013306 Bacteria 2120
111 Ga0157372_10060996 3300013307 Bacteria 4221
112 Ga0157375_10100101 3300013308 Bacteria 2978
113 Ga0157375_10393550 3300013308 Unclassified 1552
114 Ga0163163_10201079 3300014325 Bacteria 2041
115 Ga0157380_10001199 3300014326 Bacteria 16776
116 Ga0157377_10117423 3300014745 Bacteria 1608
117 Ga0207697_10001132 3300025315 Bacteria 14697
118 Ga0207697_10009543 3300025315 Bacteria 4188
119 Ga0207682_10008666 3300025893 Bacteria 4021
120 Ga0207688_10002580 3300025901 Bacteria 9798
121 Ga0207688_10039828 3300025901 Bacteria 2610
122 Ga0207680_10023926 3300025903 Bacteria 3343
123 Ga0207647_10025156 3300025904 Bacteria 3918
124 Ga0207645_10002713 3300025907 Bacteria 13791
125 Ga0207645_10158699 3300025907 Unclassified 1479
126 Ga0207654_10041969 3300025911 Bacteria 2586
127 Ga0207695_10078786 3300025913 Bacteria 3342
128 Ga0207662_10003200 3300025918 Bacteria 8383
129 Ga0207662_10061596 3300025918 Bacteria 2253
130 Ga0207652_10047552 3300025921 Bacteria 3665
131 Ga0207650_10003560 3300025925 Bacteria 10690
132 Ga0207650_10015328 3300025925 Bacteria 5336
133 Ga0207650_10177172 3300025925 Bacteria 1697
134 Ga0207659_10000072 3300025926 Bacteria 64525
135 Ga0207659_10020284 3300025926 Bacteria 4392
136 Ga0207659_10020558 3300025926 Bacteria 4366
137 Ga0207700_10003078 3300025928 Bacteria 9625
138 Ga0207644_10018034 3300025931 Bacteria 4771
139 Ga0207644_10026069 3300025931 Bacteria 4025
140 Ga0207644_10030125 3300025931 Bacteria 3770
141 Ga0207706_10026758 3300025933 Bacteria 5163
142 Ga0207706_10033091 3300025933 Bacteria 4602
143 Ga0207706_10064176 3300025933 Bacteria 3233
144 Ga0207669_10118436 3300025937 Unclassified 1792
145 Ga0207691_10034293 3300025940 Bacteria 4721
146 Ga0207691_10046646 3300025940 Bacteria 3980
147 Ga0207691_10056267 3300025940 Bacteria 3583
148 Ga0207711_10031939 3300025941 Bacteria 4449
149 Ga0207711_10037678 3300025941 Bacteria 4109
150 Ga0207711_10071051 3300025941 Bacteria 3020
151 Ga0207689_10014641 3300025942 Bacteria 6663
152 Ga0207661_10001481 3300025944 Bacteria 15878
153 Ga0207679_10005466 3300025945 Bacteria 7961
154 Ga0207679_10249809 3300025945 Bacteria 1507
155 Ga0207651_10015673 3300025960 Bacteria 4414
156 Ga0207668_10059240 3300025972 Bacteria 2682
157 Ga0207640_10027158 3300025981 Bacteria 3485
158 Ga0207658_10069444 3300025986 Bacteria 2662
159 Ga0207677_10111603 3300026023 Bacteria 2037
160 Ga0207678_10003620 3300026067 Bacteria 13881
161 Ga0207708_10124346 3300026075 Bacteria 2012
162 Ga0207641_10053118 3300026088 Bacteria 3433
163 Ga0207648_10051234 3300026089 Bacteria 3608
164 Ga0207648_10067188 3300026089 Bacteria 3126
165 Ga0207648_10102428 3300026089 Bacteria 2509
166 Ga0207676_10018374 3300026095 Bacteria 5081
167 Ga0207674_10087221 3300026116 Bacteria 3115
168 Ga0207675_100052252 3300026118 Bacteria 3813
169 Ga0207675_100149161 3300026118 Bacteria 2225
170 Ga0207683_10145883 3300026121 Bacteria 2134
171 Ga0207683_10184897 3300026121 Bacteria 1890
172 Ga0307408_100047411 3300031548 Bacteria 3077
173 Ga0307405_10080671 3300031731 Bacteria 2125
174 Ga0307405_10157300 3300031731 Bacteria 1605
175 Ga0307406_10028273 3300031901 Bacteria 3387
176 Ga0307407_10009129 3300031903 Bacteria 4601
177 Ga0307409_100022487 3300031995 Bacteria 4349
178 Ga0307409_100053923 3300031995 Bacteria 3093
179 Ga0307416_100009915 3300032002 Bacteria 6266
180 Ga0307416_100056674 3300032002 Bacteria 3164
181 Ga0307416_100160014 3300032002 Bacteria 2080
182 Ga0307416_100210004 3300032002 Bacteria 1856
183 Ga0307411_10012530 3300032005 Bacteria 4633
184 Ga0307415_100023163 3300032126 Bacteria 3850
185 Ga0307415_100035392 3300032126 Bacteria 3261
186 Ga0373930_0001089 3300034816 Bacteria 3936
187 Ga0373940_0003660 3300035088 Bacteria 3162
188 Ga0373949_0001604 3300035090 Bacteria 6370
189 Ga0373951_0001636 3300035091 Bacteria 5873
190 Ga0373952_0001201 3300035092 Bacteria 4719
191 Ga0373932_0001001 3300035112 Bacteria 8175
192 Ga0373939_0000747 3300035114 Bacteria 8008
193 Ga0373941_0001198 3300035115 Bacteria 5418
194 Ga0373960_0004419 3300035121 Bacteria 3219
195 Ga0373961_0001136 3300035241 Bacteria 8359
196 Ga0373962_0000651 3300035242 Bacteria 7891
197 Ga0373931_0010056 3300035691 Bacteria 4537
198 Ga0373937_0015050 3300036401 Bacteria 6833
199 Ga0373925_0002232 3300037068 Bacteria 15727
200 Ga0439461_0015014 3300041410 Bacteria 1480
201 Ga0439437_004330 3300042000 Bacteria 1547
202 Ga0450896_000368 3300042133 Bacteria 4452
203 Ga0450906_010424 3300042145 Bacteria 1758
204 Ga0439446_0008533 3300042156 Bacteria 2725
205 Ga0439464_0005212 3300042439 Bacteria 3351
206 Ga0451577_0049297 3300042876 Bacteria 3761
207 Ga0451577_0060838 3300042876 Bacteria 3367
208 Ga0453684_0020035 3300044712 Bacteria 10130
209 Ga0451576_0009854 3300045051 Bacteria 11040
210 Ga0495594_0112397 3300046499 Bacteria 1536
211 Ga0496102_0245107 3300048905 Bacteria 1689
212 Ga0496104_0013330 3300048907 Bacteria 7407
213 Ga0496105_0030594 3300048908 Bacteria 4411
214 Ga0496106_0037675 3300048909 Bacteria 3618
215 Ga0496106_0187965 3300048909 Bacteria 1641
216 Ga0496108_0004028 3300048911 Bacteria 11793
217 Ga0496108_0035069 3300048911 Bacteria 4169
218 Ga0496108_0063650 3300048911 Bacteria 3106
219 Ga0496109_0001846 3300048912 Bacteria 17552
220 Ga0496109_0171606 3300048912 Bacteria 2035
221 Ga0496110_0001102 3300048913 Bacteria 19046
222 Ga0496111_0000954 3300048914 Bacteria 15825
223 Ga0496111_0157377 3300048914 Bacteria 1686
224 Ga0496113_0006797 3300048916 Bacteria 7290
225 Ga0496113_0049516 3300048916 Bacteria 3129
226 Ga0501031_0038545 3300049568 Bacteria 3119
227 Ga0501036_0234303 3300049572 Bacteria 1540
228 Ga0501039_0035497 3300049575 Bacteria 3848
229 Ga0501040_0054707 3300049576 Bacteria 2737
230 Ga0501041_0117335 3300049577 Unclassified 1653
231 Ga0501042_0049639 3300049578 Bacteria 2994
232 Ga0501048_0135270 3300049582 Bacteria 1742
233 Ga0501068_0107334 3300049584 Bacteria 1734
234 Ga0501071_0013953 3300049587 Bacteria 5489
235 Ga0501071_0048323 3300049587 Bacteria 3060
236 Ga0501071_0081426 3300049587 Unclassified 2369
237 Ga0501071_0121724 3300049587 Unclassified 1934
238 Ga0501072_0101218 3300049588 Bacteria 2290
239 Ga0501072_0148072 3300049588 Bacteria 1872
240 Ga0501073_0018016 3300049589 Bacteria 5106
241 Ga0501074_0044825 3300049590 Bacteria 3200
242 Ga0501075_0001534 3300049591 Bacteria 15063
243 Ga0501075_0049516 3300049591 Bacteria 3158
244 Ga0501076_0038764 3300049592 Bacteria 3741
245 Ga0501077_0041522 3300049593 Unclassified 2928
246 Ga0501077_0055837 3300049593 Bacteria 2507
247 Ga0501217_009465 3300049661 Bacteria 2121
248 Ga0501079_0027535 3300049741 Bacteria 4359
249 Ga0501079_0092478 3300049741 Bacteria 2343
250 Ga0501079_0182822 3300049741 Unclassified 1636
251 Ga0501079_0255447 3300049741 Bacteria 1370
252 Ga0501080_0027010 3300049742 Bacteria 5338
253 Ga0501080_0050155 3300049742 Bacteria 3886
254 Ga0501080_0089572 3300049742 Bacteria 2858
255 Ga0501045_0015789 3300049824 Bacteria 5356
256 Ga0501045_0050835 3300049824 Bacteria 3025
257 Ga0501045_0061246 3300049824 Bacteria 2761
258 Ga0501045_0079907 3300049824 Bacteria 2411
259 nmdc:mga03683_8315_c1 3300050489 Bacteria 3643
260 nmdc:mga0yw44_1720_c1 3300050492 Bacteria 8885
261 nmdc:mga0k408_13579_c1 3300050493 Bacteria 4471
262 nmdc:mga0k408_15652_c1 3300050493 Bacteria 4198
263 nmdc:mga0k408_36576_c1 3300050493 Bacteria 2818
264 nmdc:mga06z11_14615_c1 3300050494 Bacteria 3482
265 nmdc:mga07m45_19799_c1 3300050496 Bacteria 3649
266 nmdc:mga05p37_1976_c1 3300050507 Bacteria 23897
267 nmdc:mga05p37_202063_c1 3300050507 Bacteria 2406
268 nmdc:mga05p37_22697_c1 3300050507 Bacteria 7612
269 nmdc:mga05p37_2876_c1 3300050507 Bacteria 19986
270 nmdc:mga05p37_32481_c1 3300050507 Bacteria 6383
271 nmdc:mga05p37_6316_c1 3300050507 Bacteria 13955
272 nmdc:mga09592_176953_c1 3300050508 Bacteria 1845
273 nmdc:mga09592_2613_c1 3300050508 Bacteria 14575
274 nmdc:mga09592_30662_c1 3300050508 Bacteria 4475
275 nmdc:mga09592_39462_c1 3300050508 Bacteria 3966
276 nmdc:mga0qj67_176070_c1 3300050509 Bacteria 1737
277 nmdc:mga0qj67_5741_c1 3300050509 Bacteria 9085
278 nmdc:mga0qj67_69415_c1 3300050509 Bacteria 2811
279 nmdc:mga06r32_159312_c1 3300050510 Bacteria 2239
280 nmdc:mga06r32_171304_c1 3300050510 Bacteria 2155
281 nmdc:mga06r32_178119_c1 3300050510 Bacteria 2111
282 nmdc:mga06r32_41924_c1 3300050510 Bacteria 4350
283 nmdc:mga06r32_51723_c1 3300050510 Bacteria 3932
284 nmdc:mga08y16_144753_c1 3300050511 Bacteria 2470
285 nmdc:mga08y16_32786_c1 3300050511 Bacteria 5461
286 nmdc:mga08y16_5002_c1 3300050511 Bacteria 13862
287 nmdc:mga0n895_20928_c1 3300050512 Bacteria 6110
288 nmdc:mga0n895_70695_c1 3300050512 Bacteria 3459
289 nmdc:mga0rr50_13953_c1 3300050513 Bacteria 5250
290 nmdc:mga0rr50_1520_c1 3300050513 Bacteria 12786
291 nmdc:mga0rr50_155735_c1 3300050513 Bacteria 1851
292 nmdc:mga0a205_10145_c1 3300050515 Bacteria 6534
293 nmdc:mga0a205_133186_c1 3300050515 Bacteria 2386
294 nmdc:mga0a205_47260_c1 3300050515 Bacteria 4152
295 Ga0495619_0034307 3300053085 Bacteria 3299
296 Ga0501084_0023866 3300054114 Bacteria 5101
297 Ga0501084_0033548 3300054114 Bacteria 4295
298 Ga0590071_000282 3300059421 Bacteria 14815
299 Ga0590075_000872 3300059424 Bacteria 7892
300 Ga0590077_000238 3300059426 Bacteria 15670
301 Ga0501082_0021769 3300060353 Bacteria 5528
302 Ga0501082_0159202 3300060353 Bacteria 1962
303 Ga0530510_0001988 3300061734 Bacteria 14024
304 Ga0501036_0028391
305 Ga0065712_10085192
306 Ga0065715_10005920
307 Ga0065715_10008049
308 Ga0065715_10014270
309 Ga0065715_10089425
310 Ga0070683_100000326
311 Ga0070683_100002445
312 Ga0070690_100005627
313 Ga0070670_100004688
314 Ga0070670_100015796
315 Ga0070670_100032503
316 Ga0070677_10018427
317 Ga0068869_100016747
318 Ga0070666_10028024
319 Ga0070689_100018035
320 Ga0070689_100147713
321 Ga0070687_100035838
322 Ga0070668_100035387
323 Ga0070669_100006846
324 Ga0070675_100000515
325 Ga0070675_100021629
326 Ga0070675_100096084
327 Ga0070671_100040632
328 Ga0070671_100045359
329 Ga0070671_100166192
330 Ga0070674_100017447
331 Ga0070674_100074607
332 Ga0070673_100007144
333 Ga0070673_100022587
334 Ga0070673_100046488
335 Ga0070688_100001778
336 Ga0070713_100020403
337 Ga0070662_100055615
338 Ga0070681_10067656
339 Ga0068867_100018536
340 Ga0068867_100158450
341 Ga0070699_100051923
342 Ga0070684_100000168
343 Ga0070672_100006955
344 Ga0070672_100039134
345 Ga0070686_100000438
346 Ga0070695_100060865
347 Ga0070664_100001248
348 Ga0068854_100036566
349 Ga0068852_100025184
350 Ga0068859_100185341
351 Ga0068864_100007161
352 Ga0068861_100177215
353 Ga0068861_100247995
354 Ga0068863_100046141
355 Ga0068863_100062048
356 Ga0068858_100052461
357 Ga0068858_100110006
358 Ga0068860_100191057
359 Ga0068862_100025434
360 Ga0068862_100055533
361 Ga0068862_100272905
362 Ga0081539_10047941
363 Ga0070717_10118794
364 Ga0075365_10000951
365 Ga0075368_10003270
366 Ga0075368_10014069
367 Ga0075364_10007303
368 Ga0075364_10008652
369 Ga0075362_10000489
370 Ga0075367_10008193
371 Ga0075367_10009128
372 Ga0075367_10100796
373 Ga0075366_10004237
374 Ga0075370_10011543
375 Ga0075428_100014864
376 Ga0075428_100037184
377 Ga0075430_100018688
378 Ga0075430_100020696
379 Ga0075431_100004362
380 Ga0075431_100008733
381 Ga0075431_100018733
382 Ga0075431_100050925
383 Ga0075431_100053307
384 Ga0075431_100130180
385 Ga0075433_10000771
386 Ga0075433_10034875
387 Ga0075434_100005218
388 Ga0075434_100013308
389 Ga0075429_100006230
390 Ga0075429_100072929
391 Ga0075429_100073043
392 Ga0075436_100074606
393 Ga0097620_100185339
394 Ga0075435_100001374
395 Ga0075435_100157515
396 Ga0105240_10017207
397 Ga0105240_10099422
398 Ga0111539_10002086
399 Ga0111539_10013664
400 Ga0111539_10198464
401 Ga0114129_10002530
402 Ga0114129_10012135
403 Ga0114129_10020431
404 Ga0114129_10024673
405 Ga0114129_10033249
406 Ga0114129_10299810
407 Ga0105241_10058600
408 Ga0105248_10016814
409 Ga0105248_10055504
410 Ga0105248_10099758
411 Ga0105249_10324933
412 Ga0105246_10063330
413 Ga0163162_10201362
414 Ga0157372_10060996
415 Ga0157375_10100101
416 Ga0157375_10393550
417 Ga0163163_10201079
418 Ga0157380_10001199
419 Ga0157377_10117423
420 Ga0207697_10001132
421 Ga0207697_10009543
422 Ga0207682_10008666
423 Ga0207688_10002580
424 Ga0207688_10039828
425 Ga0207680_10023926
426 Ga0207647_10025156
427 Ga0207645_10002713
428 Ga0207645_10158699
429 Ga0207654_10041969
430 Ga0207695_10078786
431 Ga0207662_10003200
432 Ga0207662_10061596
433 Ga0207652_10047552
434 Ga0207650_10003560
435 Ga0207650_10015328
436 Ga0207650_10177172
437 Ga0207659_10000072
438 Ga0207659_10020284
439 Ga0207659_10020558
440 Ga0207700_10003078
441 Ga0207644_10018034
442 Ga0207644_10026069
443 Ga0207644_10030125
444 Ga0207706_10026758
445 Ga0207706_10033091
446 Ga0207706_10064176
447 Ga0207669_10118436
448 Ga0207691_10034293
449 Ga0207691_10046646
450 Ga0207691_10056267
451 Ga0207711_10031939
452 Ga0207711_10037678
453 Ga0207711_10071051
454 Ga0207689_10014641
455 Ga0207661_10001481
456 Ga0207679_10005466
457 Ga0207679_10249809
458 Ga0207651_10015673
459 Ga0207668_10059240
460 Ga0207640_10027158
461 Ga0207658_10069444
462 Ga0207677_10111603
463 Ga0207678_10003620
464 Ga0207708_10124346
465 Ga0207641_10053118
466 Ga0207648_10051234
467 Ga0207648_10067188
468 Ga0207648_10102428
469 Ga0207676_10018374
470 Ga0207674_10087221
471 Ga0207675_100052252
472 Ga0207675_100149161
473 Ga0207683_10145883
474 Ga0207683_10184897
475 Ga0307408_100047411
476 Ga0307405_10080671
477 Ga0307405_10157300
478 Ga0307406_10028273
479 Ga0307407_10009129
480 Ga0307409_100022487
481 Ga0307409_100053923
482 Ga0307416_100009915
483 Ga0307416_100056674
484 Ga0307416_100160014
485 Ga0307416_100210004
486 Ga0307411_10012530
487 Ga0307415_100023163
488 Ga0307415_100035392
489 Ga0373930_0001089
490 Ga0373940_0003660
491 Ga0373949_0001604
492 Ga0373951_0001636
493 Ga0373952_0001201
494 Ga0373932_0001001
495 Ga0373939_0000747
496 Ga0373941_0001198
497 Ga0373960_0004419
498 Ga0373961_0001136
499 Ga0373962_0000651
500 Ga0373931_0010056
501 Ga0373937_0015050
502 Ga0373925_0002232
503 Ga0439461_0015014
504 Ga0439437_004330
505 Ga0450896_000368
506 Ga0450906_010424
507 Ga0439446_0008533
508 Ga0439464_0005212
509 Ga0451577_0049297
510 Ga0451577_0060838
511 Ga0453684_0020035
512 Ga0451576_0009854
513 Ga0495594_0112397
514 Ga0496102_0245107
515 Ga0496104_0013330
516 Ga0496105_0030594
517 Ga0496106_0037675
518 Ga0496106_0187965
519 Ga0496108_0004028
520 Ga0496108_0035069
521 Ga0496108_0063650
522 Ga0496109_0001846
523 Ga0496109_0171606
524 Ga0496110_0001102
525 Ga0496111_0000954
526 Ga0496111_0157377
527 Ga0496113_0006797
528 Ga0496113_0049516
529 Ga0501031_0038545
530 Ga0501036_0234303
531 Ga0501039_0035497
532 Ga0501040_0054707
533 Ga0501041_0117335
534 Ga0501042_0049639
535 Ga0501048_0135270
536 Ga0501068_0107334
537 Ga0501071_0013953
538 Ga0501071_0048323
539 Ga0501071_0081426
540 Ga0501071_0121724
541 Ga0501072_0101218
542 Ga0501072_0148072
543 Ga0501073_0018016
544 Ga0501074_0044825
545 Ga0501075_0001534
546 Ga0501075_0049516
547 Ga0501076_0038764
548 Ga0501077_0041522
549 Ga0501077_0055837
550 Ga0501217_009465
551 Ga0501079_0027535
552 Ga0501079_0092478
553 Ga0501079_0182822
554 Ga0501079_0255447
555 Ga0501080_0027010
556 Ga0501080_0050155
557 Ga0501080_0089572
558 Ga0501045_0015789
559 Ga0501045_0050835
560 Ga0501045_0061246
561 Ga0501045_0079907
562 nmdc:mga03683_8315_c1
563 nmdc:mga0yw44_1720_c1
564 nmdc:mga0k408_13579_c1
565 nmdc:mga0k408_15652_c1
566 nmdc:mga0k408_36576_c1
567 nmdc:mga06z11_14615_c1
568 nmdc:mga07m45_19799_c1
569 nmdc:mga05p37_1976_c1
570 nmdc:mga05p37_202063_c1
571 nmdc:mga05p37_22697_c1
572 nmdc:mga05p37_2876_c1
573 nmdc:mga05p37_32481_c1
574 nmdc:mga05p37_6316_c1
575 nmdc:mga09592_176953_c1
576 nmdc:mga09592_2613_c1
577 nmdc:mga09592_30662_c1
578 nmdc:mga09592_39462_c1
579 nmdc:mga0qj67_176070_c1
580 nmdc:mga0qj67_5741_c1
581 nmdc:mga0qj67_69415_c1
582 nmdc:mga06r32_159312_c1
583 nmdc:mga06r32_171304_c1
584 nmdc:mga06r32_178119_c1
585 nmdc:mga06r32_41924_c1
586 nmdc:mga06r32_51723_c1
587 nmdc:mga08y16_144753_c1
588 nmdc:mga08y16_32786_c1
589 nmdc:mga08y16_5002_c1
590 nmdc:mga0n895_20928_c1
591 nmdc:mga0n895_70695_c1
592 nmdc:mga0rr50_13953_c1
593 nmdc:mga0rr50_1520_c1
594 nmdc:mga0rr50_155735_c1
595 nmdc:mga0a205_10145_c1
596 nmdc:mga0a205_133186_c1
597 nmdc:mga0a205_47260_c1
598 Ga0495619_0034307
599 Ga0501084_0023866
600 Ga0501084_0033548
601 Ga0590071_000282
602 Ga0590075_000872
603 Ga0590077_000238
604 Ga0501082_0021769
605 Ga0501082_0159202
606 Ga0530510_0001988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

122

263

0.91

PF13186

SPASM

Iron-sulfur cluster-binding domain

31

95

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.8351 77 268
7voc-assembly1.cif.gz_C the crystal structure of a radical sam enzyme blse involved in the biosynthesis of blasticidin s 0.8023 77 290
7n7i-assembly3.cif.gz_C x-ray crystal structure of viperin-like enzyme from trichoderma virens 0.7972 77 267
5v1s-assembly1.cif.gz_A crystal structure of streptococcus suis suib bound to s-adenosylmethionine 0.7934 77 275
6q2q-assembly2.cif.gz_B crystal structure of mouse viperin bound to uridine triphosphate and s-adenosylhomocysteine 0.7923 78 267
ID Description Score Start End Superfamily
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8198 78 267 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7924 79 266 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7708 78 292 3.20.20.70
af_Q58251_16_253_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7689 130 265 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7635 80 276 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A538LCM3-F1-model_v4 Next to BRCA1 central domain-containing protein 0.9465 323 433
AF-A0A0J1F8D5-F1-model_v4 Uncharacterized protein 0.9433 309 433
AF-A0A536IBZ7-F1-model_v4 Intracellular proteinase inhibitor BsuPI domain-containing protein 0.9421 310 433
AF-A0A1F5AZ09-F1-model_v4 Mannosylglycerate hydrolase MGH1-like glycoside hydrolase domain-containing protein 0.9397 322 433 GO:0005975
AF-A0A126S1N3-F1-model_v4 deleted 0.9343 311 433

Map