F397196

General Info

Members Datasets Scaffolds Average Seq Length
303 199 606 190

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0075318|Ga0466958_0075318_179_808
Length 209
Sequence LLNQPVEQFTIGSERWSMGRIVVTEFVSLDGVMQDPGGAEDFKYGGWSFEFSRGEEGDKFKYDEVLDSEALLLGRVTYDGFADAWPQREGDFADRFNNMPKYVVGSKADASRWTNTTVLDGDPVEAVRRVRDERSGNIYVHGSRQLAQTLFEHNLVDQLNLMIFPVVLGTGDRIFGETSDKKTLKLVDSKVVGDGVVILIYQPAHQEAT

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.58
Rhizosphere 86.14
Stem 0
Stem Tuber 0
Unclassified 11.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0075318 3300045836 Unclassified 2070
2 JGI24737J22298_10113857 3300001990 Bacteria 800
3 JGI25407J50210_10031560 3300003373 Bacteria 1371
4 Ga0070676_10163034 3300005328 Bacteria 1436
5 Ga0070676_10315312 3300005328 Bacteria 1065
6 Ga0070683_100112724 3300005329 Bacteria 2566
7 Ga0070683_100133083 3300005329 Bacteria 2353
8 Ga0070690_100183954 3300005330 Bacteria 1445
9 Ga0070670_100705072 3300005331 Bacteria 908
10 Ga0068869_100115430 3300005334 Bacteria 2047
11 Ga0070682_100000016 3300005337 Bacteria 239799
12 Ga0070682_100412465 3300005337 Bacteria 1024
13 Ga0068868_100218580 3300005338 Bacteria 1594
14 Ga0070660_100173060 3300005339 Bacteria 1745
15 Ga0070689_100007508 3300005340 Bacteria 7632
16 Ga0070661_100225812 3300005344 Bacteria 1438
17 Ga0070692_10338005 3300005345 Bacteria 931
18 Ga0070692_10594602 3300005345 Bacteria 731
19 Ga0070668_100035842 3300005347 Bacteria 3785
20 Ga0070668_100151903 3300005347 Bacteria 1873
21 Ga0070675_100203078 3300005354 Bacteria 1720
22 Ga0070659_100643785 3300005366 Bacteria 913
23 Ga0070667_100971678 3300005367 Bacteria 792
24 Ga0070709_10036243 3300005434 Bacteria 3004
25 Ga0070709_10386475 3300005434 Bacteria 1042
26 Ga0070709_10618487 3300005434 Bacteria 836
27 Ga0070714_100018615 3300005435 Bacteria 5645
28 Ga0070714_100109905 3300005435 Bacteria 2440
29 Ga0070713_100230799 3300005436 Bacteria 1682
30 Ga0070710_10022941 3300005437 Bacteria 3273
31 Ga0070701_10265989 3300005438 Bacteria 1041
32 Ga0070711_100008910 3300005439 Bacteria 6159
33 Ga0070711_100675833 3300005439 Unclassified 868
34 Ga0070694_100886112 3300005444 Bacteria 736
35 Ga0070663_100028130 3300005455 Bacteria 3823
36 Ga0070678_100132843 3300005456 Bacteria 1980
37 Ga0070662_100040151 3300005457 Bacteria 3331
38 Ga0070662_100060730 3300005457 Bacteria 2757
39 Ga0068867_101336778 3300005459 Bacteria 663
40 Ga0070685_10032173 3300005466 Bacteria 2936
41 Ga0070684_100551649 3300005535 Bacteria 1069
42 Ga0070684_100886062 3300005535 Bacteria 836
43 Ga0068853_100576709 3300005539 Bacteria 1067
44 Ga0070672_100834848 3300005543 Bacteria 812
45 Ga0070686_100846057 3300005544 Bacteria 741
46 Ga0070686_101244757 3300005544 Bacteria 620
47 Ga0070696_100224067 3300005546 Bacteria 1412
48 Ga0070704_100092096 3300005549 Bacteria 2262
49 Ga0068856_100174717 3300005614 Bacteria 2160
50 Ga0068856_100600431 3300005614 Bacteria 1122
51 Ga0068856_100699178 3300005614 Bacteria 1034
52 Ga0070702_100314725 3300005615 Bacteria 1088
53 Ga0068852_100077052 3300005616 Bacteria 2946
54 Ga0068861_100022049 3300005719 Bacteria 4583
55 Ga0068861_100313607 3300005719 Bacteria 1363
56 Ga0068861_100893417 3300005719 Bacteria 841
57 Ga0068851_10065864 3300005834 Bacteria 1866
58 Ga0068870_10027907 3300005840 Bacteria 2828
59 Ga0068863_101012415 3300005841 Bacteria 834
60 Ga0068858_100650096 3300005842 Bacteria 1024
61 Ga0068860_100053497 3300005843 Bacteria 3839
62 Ga0081455_10098872 3300005937 Bacteria 2348
63 Ga0081455_10275704 3300005937 Bacteria 1217
64 Ga0081538_10000660 3300005981 Bacteria 38084
65 Ga0070715_10052254 3300006163 Unclassified 1762
66 Ga0070716_100260351 3300006173 Bacteria 1187
67 Ga0070716_100935417 3300006173 Unclassified 681
68 Ga0070712_100009099 3300006175 Bacteria 6254
69 Ga0068871_100739317 3300006358 Bacteria 904
70 Ga0075428_100077968 3300006844 Bacteria 3617
71 Ga0075428_100956023 3300006844 Bacteria 908
72 Ga0075433_10198362 3300006852 Bacteria 1785
73 Ga0075434_100001905 3300006871 Bacteria 18081
74 Ga0075429_100035335 3300006880 Bacteria 4347
75 Ga0075435_100009904 3300007076 Bacteria 6940
76 Ga0099794_10000268 3300007265 Bacteria 18058
77 Ga0111539_10016559 3300009094 Bacteria 9140
78 Ga0111539_10118775 3300009094 Bacteria 3099
79 Ga0111539_11045861 3300009094 Bacteria 949
80 Ga0105245_10019019 3300009098 Bacteria 6012
81 Ga0105245_10032100 3300009098 Bacteria 4649
82 Ga0105245_10142222 3300009098 Bacteria 2261
83 Ga0105245_10252495 3300009098 Bacteria 1714
84 Ga0105247_10095352 3300009101 Bacteria 1894
85 Ga0114129_10004640 3300009147 Bacteria 19389
86 Ga0114129_10080080 3300009147 Bacteria 4541
87 Ga0105243_10181311 3300009148 Bacteria 1831
88 Ga0105241_10332159 3300009174 Bacteria 1314
89 Ga0105242_11865700 3300009176 Bacteria 641
90 Ga0105237_10219986 3300009545 Bacteria 1899
91 Ga0105237_10750169 3300009545 Bacteria 983
92 Ga0105238_10332994 3300009551 Bacteria 1505
93 Ga0105249_10012324 3300009553 Bacteria 7533
94 Ga0105249_10484642 3300009553 Bacteria 1280
95 Ga0105239_11297758 3300010375 Bacteria 840
96 Ga0157369_10370358 3300013105 Bacteria 1487
97 Ga0157374_10525560 3300013296 Bacteria 1189
98 Ga0157374_10618538 3300013296 Bacteria 1094
99 Ga0157378_10468537 3300013297 Bacteria 1253
100 Ga0163162_10023949 3300013306 Bacteria 6025
101 Ga0163162_10115832 3300013306 Bacteria 2780
102 Ga0157372_10216433 3300013307 Bacteria 2220
103 Ga0157372_11318201 3300013307 Bacteria 833
104 Ga0157375_10135656 3300013308 Bacteria 2584
105 Ga0157375_10289154 3300013308 Bacteria 1802
106 Ga0163163_10847093 3300014325 Bacteria 978
107 Ga0157380_10587664 3300014326 Bacteria 1099
108 Ga0157377_10327614 3300014745 Bacteria 1020
109 Ga0157379_10075475 3300014968 Bacteria 3018
110 Ga0157379_10166513 3300014968 Bacteria 1990
111 Ga0163161_10126198 3300017792 Bacteria 1927
112 Ga0163161_10477654 3300017792 Bacteria 1012
113 Ga0213876_10004448 3300021384 Bacteria 7848
114 Ga0213876_10193875 3300021384 Unclassified 1080
115 Ga0213876_10241944 3300021384 Bacteria 959
116 Ga0207656_10025239 3300025321 Bacteria 2411
117 Ga0207692_10062123 3300025898 Unclassified 1938
118 Ga0207692_10130858 3300025898 Bacteria 1417
119 Ga0207692_10605267 3300025898 Bacteria 705
120 Ga0207642_10188655 3300025899 Bacteria 1129
121 Ga0207688_10104740 3300025901 Bacteria 1637
122 Ga0207688_10140324 3300025901 Bacteria 1422
123 Ga0207647_10223475 3300025904 Bacteria 1085
124 Ga0207699_10027083 3300025906 Bacteria 3169
125 Ga0207699_10488317 3300025906 Bacteria 888
126 Ga0207645_10076016 3300025907 Bacteria 2150
127 Ga0207645_10151212 3300025907 Bacteria 1515
128 Ga0207643_10016180 3300025908 Bacteria 4066
129 Ga0207705_10164199 3300025909 Bacteria 1669
130 Ga0207693_10002247 3300025915 Bacteria 16812
131 Ga0207693_10210812 3300025915 Bacteria 1527
132 Ga0207663_10009442 3300025916 Bacteria 5150
133 Ga0207663_10855878 3300025916 Bacteria 726
134 Ga0207662_10027056 3300025918 Bacteria 3311
135 Ga0207657_10069413 3300025919 Bacteria 2990
136 Ga0207652_10364953 3300025921 Bacteria 1303
137 Ga0207687_10210267 3300025927 Bacteria 1526
138 Ga0207700_10016837 3300025928 Unclassified 4868
139 Ga0207700_10122012 3300025928 Bacteria 2115
140 Ga0207664_10068931 3300025929 Bacteria 2843
141 Ga0207664_10419352 3300025929 Bacteria 1192
142 Ga0207706_10008875 3300025933 Bacteria 9254
143 Ga0207706_10053569 3300025933 Bacteria 3561
144 Ga0207686_10196062 3300025934 Bacteria 1443
145 Ga0207709_10064795 3300025935 Bacteria 2296
146 Ga0207670_10141646 3300025936 Bacteria 1774
147 Ga0207669_10025493 3300025937 Bacteria 3198
148 Ga0207669_10315725 3300025937 Bacteria 1194
149 Ga0207704_10318553 3300025938 Bacteria 1198
150 Ga0207665_10618088 3300025939 Bacteria 847
151 Ga0207665_10732032 3300025939 Bacteria 779
152 Ga0207665_10892467 3300025939 Unclassified 705
153 Ga0207691_10125300 3300025940 Bacteria 2273
154 Ga0207689_10373478 3300025942 Bacteria 1187
155 Ga0207661_10335073 3300025944 Bacteria 1362
156 Ga0207679_10488082 3300025945 Bacteria 1098
157 Ga0207712_10065980 3300025961 Bacteria 2586
158 Ga0207712_10712011 3300025961 Unclassified 877
159 Ga0207668_10008215 3300025972 Bacteria 6217
160 Ga0207640_10043176 3300025981 Bacteria 2880
161 Ga0207658_10169235 3300025986 Bacteria 1799
162 Ga0207677_10262189 3300026023 Bacteria 1409
163 Ga0207677_10350688 3300026023 Bacteria 1237
164 Ga0207703_10320957 3300026035 Bacteria 1418
165 Ga0207639_10300011 3300026041 Bacteria 1420
166 Ga0207678_10018825 3300026067 Bacteria 6064
167 Ga0207708_10144545 3300026075 Bacteria 1868
168 Ga0207708_10488799 3300026075 Bacteria 1030
169 Ga0207702_10181160 3300026078 Bacteria 1940
170 Ga0207702_10264092 3300026078 Bacteria 1622
171 Ga0207702_10645381 3300026078 Bacteria 1041
172 Ga0207675_100010483 3300026118 Bacteria 8682
173 Ga0207675_100011183 3300026118 Bacteria 8405
174 Ga0207683_10192672 3300026121 Bacteria 1851
175 Ga0207698_10191097 3300026142 Bacteria 1824
176 Ga0207698_10575580 3300026142 Bacteria 1107
177 Ga0209588_1000042 3300027671 Bacteria 59013
178 Ga0207428_10010022 3300027907 Bacteria 8479
179 Ga0268264_10345010 3300028381 Bacteria 1415
180 Ga0307405_10029994 3300031731 Bacteria 3185
181 Ga0307405_10517210 3300031731 Bacteria 960
182 Ga0307410_10185556 3300031852 Bacteria 1578
183 Ga0307406_10506612 3300031901 Bacteria 980
184 Ga0307407_10107395 3300031903 Bacteria 1746
185 Ga0307409_100039859 3300031995 Bacteria 3490
186 Ga0307409_100365239 3300031995 Bacteria 1367
187 Ga0307409_100682788 3300031995 Bacteria 1024
188 Ga0307416_100018729 3300032002 Bacteria 4887
189 Ga0307416_101417939 3300032002 Bacteria 800
190 Ga0307411_10482845 3300032005 Bacteria 1044
191 Ga0307415_100000559 3300032126 Bacteria 16315
192 Ga0307415_100125600 3300032126 Bacteria 1933
193 Ga0307415_101256866 3300032126 Bacteria 700
194 Ga0395900_0008888 3300037418 Bacteria 10314
195 Ga0395900_0694585 3300037418 Bacteria 951
196 Ga0395900_0850836 3300037418 Bacteria 838
197 Ga0395898_0005065 3300037466 Bacteria 14288
198 Ga0395898_0168748 3300037466 Bacteria 2092
199 Ga0395905_0027449 3300037471 Bacteria 5368
200 Ga0395905_0264963 3300037471 Unclassified 1604
201 Ga0395905_0581017 3300037471 Bacteria 1022
202 Ga0436364_0034377 3300037853 Unclassified 3153
203 Ga0436364_0256246 3300037853 Unclassified 3651
204 Ga0436364_0635143 3300037853 Bacteria 45186
205 Ga0395901_0028204 3300038443 Bacteria 5775
206 Ga0395901_0248119 3300038443 Bacteria 1855
207 Ga0395901_0317633 3300038443 Bacteria 1612
208 Ga0395901_0603391 3300038443 Bacteria 1107
209 Ga0436365_1016535 3300039437 Unclassified 3822
210 Ga0436365_1234754 3300039437 Bacteria 12455
211 Ga0436365_1338309 3300039437 Bacteria 7707
212 Ga0436365_1743313 3300039437 Bacteria 2404
213 Ga0436363_0064177 3300039450 Bacteria 10777
214 Ga0436363_0225137 3300039450 Unclassified 1230
215 Ga0436363_0305484 3300039450 Unclassified 1243
216 Ga0436363_0324665 3300039450 Bacteria 1905
217 Ga0436363_1410143 3300039450 Bacteria 972
218 Ga0436363_1625118 3300039450 Bacteria 2055
219 Ga0436362_0038653 3300039453 Bacteria 3593
220 Ga0436362_0504942 3300039453 Bacteria 1746
221 Ga0466969_0218800 3300044656 Bacteria 866
222 Ga0466966_0498586 3300044684 Bacteria 732
223 Ga0466963_0204463 3300044694 Bacteria 1381
224 Ga0466971_0109467 3300044719 Unclassified 1274
225 Ga0466968_0010729 3300044735 Bacteria 3559
226 Ga0466970_0030584 3300044765 Bacteria 2840
227 Ga0466957_0417534 3300044842 Bacteria 920
228 Ga0466959_0049156 3300045049 Bacteria 3098
229 Ga0466958_0021652 3300045836 Bacteria 3759
230 Ga0466958_0394106 3300045836 Bacteria 894
231 Ga0466958_0398250 3300045836 Bacteria 889
232 Ga0466967_0033619 3300045976 Bacteria 4342
233 Ga0466967_0521972 3300045976 Unclassified 1167
234 Ga0495653_0095209 3300046463 Unclassified 2168
235 Ga0495653_0630840 3300046463 Bacteria 656
236 Ga0495664_0458819 3300046477 Unclassified 763
237 Ga0495608_0000001 3300046511 Bacteria 411278
238 Ga0495608_0279920 3300046511 Unclassified 1035
239 Ga0495618_0094481 3300046514 Unclassified 1912
240 Ga0495628_0101259 3300046516 Bacteria 2223
241 Ga0495628_0545375 3300046516 Bacteria 833
242 Ga0495630_0126515 3300046517 Bacteria 1940
243 Ga0495637_0127573 3300046520 Bacteria 974
244 Ga0495652_0223568 3300046529 Unclassified 1413
245 Ga0495587_0314634 3300046536 Unclassified 875
246 Ga0495667_0037139 3300046559 Bacteria 3247
247 Ga0495634_0297733 3300046642 Unclassified 976
248 Ga0495635_0221934 3300046663 Unclassified 1278
249 Ga0495657_0000002 3300046675 Bacteria 411958
250 Ga0495657_0196340 3300046675 Unclassified 1231
251 Ga0495599_0111763 3300046678 Bacteria 1701
252 Ga0495623_0045444 3300046679 Bacteria 2790
253 Ga0495646_0142455 3300046680 Unclassified 1339
254 Ga0495658_0847436 3300046683 Bacteria 585
255 Ga0495613_0378556 3300046689 Unclassified 968
256 Ga0495604_0032728 3300047317 Bacteria 4119
257 Ga0495675_0000019 3300047444 Bacteria 113641
258 Ga0495684_0043706 3300047471 Bacteria 3431
259 Ga0495593_0020588 3300047673 Bacteria 3693
260 Ga0496100_0763488 3300048903 Bacteria 757
261 Ga0496101_0003970 3300048904 Bacteria 9256
262 Ga0496102_0008894 3300048905 Bacteria 8619
263 Ga0496103_0635080 3300048906 Unclassified 679
264 Ga0496104_0160266 3300048907 Bacteria 2158
265 Ga0496105_0050152 3300048908 Unclassified 3448
266 Ga0496105_0070749 3300048908 Bacteria 2884
267 Ga0496106_0005928 3300048909 Bacteria 9030
268 Ga0496106_0914610 3300048909 Bacteria 692
269 Ga0496107_0005442 3300048910 Bacteria 8716
270 Ga0496108_0142265 3300048911 Bacteria 2067
271 Ga0496109_0331280 3300048912 Bacteria 1437
272 Ga0496109_0413593 3300048912 Unclassified 1274
273 Ga0496109_0605728 3300048912 Bacteria 1032
274 Ga0496109_0611185 3300048912 Bacteria 1026
275 Ga0496110_0854252 3300048913 Bacteria 815
276 Ga0496111_0227221 3300048914 Bacteria 1386
277 Ga0496112_0038873 3300048915 Bacteria 4648
278 Ga0496112_0706677 3300048915 Bacteria 936
279 Ga0496113_0042403 3300048916 Bacteria 3362
280 Ga0496114_0112466 3300048917 Bacteria 2334
281 Ga0496114_0187390 3300048917 Bacteria 1809
282 Ga0496114_0262931 3300048917 Bacteria 1519
283 Ga0496115_0011852 3300048918 Bacteria 6549
284 Ga0496115_0119191 3300048918 Bacteria 2170
285 Ga0496115_0377115 3300048918 Bacteria 1154
286 Ga0501067_0077078 3300049583 Bacteria 1847
287 nmdc:mga05p37_342846_c1 3300050507 Bacteria 1761
288 nmdc:mga05p37_50346_c1 3300050507 Bacteria 5123
289 nmdc:mga05p37_574165_c1 3300050507 Bacteria 1278
290 nmdc:mga08y16_117058_c1 3300050511 Bacteria 2774
291 nmdc:mga0n895_191754_c1 3300050512 Bacteria 2075
292 nmdc:mga0n895_805860_c1 3300050512 Bacteria 929
293 nmdc:mga0rr50_68379_c1 3300050513 Bacteria 2701
294 nmdc:mga08x19_622997_c1 3300050514 Unclassified 765
295 nmdc:mga0a205_184352_c1 3300050515 Bacteria 1981
296 Ga0495601_0621178 3300053077 Unclassified 692
297 Ga0495655_0036395 3300053083 Bacteria 1230
298 Ga0495595_0000001 3300053084 Bacteria 495226
299 Ga0495595_0109633 3300053084 Unclassified 1337
300 Ga0495619_0000046 3300053085 Bacteria 104451
301 Ga0466962_0022244 3300061719 Bacteria 3046
302 Ga0466962_0174849 3300061719 Bacteria 1046
303 Ga0466962_0329567 3300061719 Bacteria 758
304 Ga0466958_0075318
305 JGI24737J22298_10113857
306 JGI25407J50210_10031560
307 Ga0070676_10163034
308 Ga0070676_10315312
309 Ga0070683_100112724
310 Ga0070683_100133083
311 Ga0070690_100183954
312 Ga0070670_100705072
313 Ga0068869_100115430
314 Ga0070682_100000016
315 Ga0070682_100412465
316 Ga0068868_100218580
317 Ga0070660_100173060
318 Ga0070689_100007508
319 Ga0070661_100225812
320 Ga0070692_10338005
321 Ga0070692_10594602
322 Ga0070668_100035842
323 Ga0070668_100151903
324 Ga0070675_100203078
325 Ga0070659_100643785
326 Ga0070667_100971678
327 Ga0070709_10036243
328 Ga0070709_10386475
329 Ga0070709_10618487
330 Ga0070714_100018615
331 Ga0070714_100109905
332 Ga0070713_100230799
333 Ga0070710_10022941
334 Ga0070701_10265989
335 Ga0070711_100008910
336 Ga0070711_100675833
337 Ga0070694_100886112
338 Ga0070663_100028130
339 Ga0070678_100132843
340 Ga0070662_100040151
341 Ga0070662_100060730
342 Ga0068867_101336778
343 Ga0070685_10032173
344 Ga0070684_100551649
345 Ga0070684_100886062
346 Ga0068853_100576709
347 Ga0070672_100834848
348 Ga0070686_100846057
349 Ga0070686_101244757
350 Ga0070696_100224067
351 Ga0070704_100092096
352 Ga0068856_100174717
353 Ga0068856_100600431
354 Ga0068856_100699178
355 Ga0070702_100314725
356 Ga0068852_100077052
357 Ga0068861_100022049
358 Ga0068861_100313607
359 Ga0068861_100893417
360 Ga0068851_10065864
361 Ga0068870_10027907
362 Ga0068863_101012415
363 Ga0068858_100650096
364 Ga0068860_100053497
365 Ga0081455_10098872
366 Ga0081455_10275704
367 Ga0081538_10000660
368 Ga0070715_10052254
369 Ga0070716_100260351
370 Ga0070716_100935417
371 Ga0070712_100009099
372 Ga0068871_100739317
373 Ga0075428_100077968
374 Ga0075428_100956023
375 Ga0075433_10198362
376 Ga0075434_100001905
377 Ga0075429_100035335
378 Ga0075435_100009904
379 Ga0099794_10000268
380 Ga0111539_10016559
381 Ga0111539_10118775
382 Ga0111539_11045861
383 Ga0105245_10019019
384 Ga0105245_10032100
385 Ga0105245_10142222
386 Ga0105245_10252495
387 Ga0105247_10095352
388 Ga0114129_10004640
389 Ga0114129_10080080
390 Ga0105243_10181311
391 Ga0105241_10332159
392 Ga0105242_11865700
393 Ga0105237_10219986
394 Ga0105237_10750169
395 Ga0105238_10332994
396 Ga0105249_10012324
397 Ga0105249_10484642
398 Ga0105239_11297758
399 Ga0157369_10370358
400 Ga0157374_10525560
401 Ga0157374_10618538
402 Ga0157378_10468537
403 Ga0163162_10023949
404 Ga0163162_10115832
405 Ga0157372_10216433
406 Ga0157372_11318201
407 Ga0157375_10135656
408 Ga0157375_10289154
409 Ga0163163_10847093
410 Ga0157380_10587664
411 Ga0157377_10327614
412 Ga0157379_10075475
413 Ga0157379_10166513
414 Ga0163161_10126198
415 Ga0163161_10477654
416 Ga0213876_10004448
417 Ga0213876_10193875
418 Ga0213876_10241944
419 Ga0207656_10025239
420 Ga0207692_10062123
421 Ga0207692_10130858
422 Ga0207692_10605267
423 Ga0207642_10188655
424 Ga0207688_10104740
425 Ga0207688_10140324
426 Ga0207647_10223475
427 Ga0207699_10027083
428 Ga0207699_10488317
429 Ga0207645_10076016
430 Ga0207645_10151212
431 Ga0207643_10016180
432 Ga0207705_10164199
433 Ga0207693_10002247
434 Ga0207693_10210812
435 Ga0207663_10009442
436 Ga0207663_10855878
437 Ga0207662_10027056
438 Ga0207657_10069413
439 Ga0207652_10364953
440 Ga0207687_10210267
441 Ga0207700_10016837
442 Ga0207700_10122012
443 Ga0207664_10068931
444 Ga0207664_10419352
445 Ga0207706_10008875
446 Ga0207706_10053569
447 Ga0207686_10196062
448 Ga0207709_10064795
449 Ga0207670_10141646
450 Ga0207669_10025493
451 Ga0207669_10315725
452 Ga0207704_10318553
453 Ga0207665_10618088
454 Ga0207665_10732032
455 Ga0207665_10892467
456 Ga0207691_10125300
457 Ga0207689_10373478
458 Ga0207661_10335073
459 Ga0207679_10488082
460 Ga0207712_10065980
461 Ga0207712_10712011
462 Ga0207668_10008215
463 Ga0207640_10043176
464 Ga0207658_10169235
465 Ga0207677_10262189
466 Ga0207677_10350688
467 Ga0207703_10320957
468 Ga0207639_10300011
469 Ga0207678_10018825
470 Ga0207708_10144545
471 Ga0207708_10488799
472 Ga0207702_10181160
473 Ga0207702_10264092
474 Ga0207702_10645381
475 Ga0207675_100010483
476 Ga0207675_100011183
477 Ga0207683_10192672
478 Ga0207698_10191097
479 Ga0207698_10575580
480 Ga0209588_1000042
481 Ga0207428_10010022
482 Ga0268264_10345010
483 Ga0307405_10029994
484 Ga0307405_10517210
485 Ga0307410_10185556
486 Ga0307406_10506612
487 Ga0307407_10107395
488 Ga0307409_100039859
489 Ga0307409_100365239
490 Ga0307409_100682788
491 Ga0307416_100018729
492 Ga0307416_101417939
493 Ga0307411_10482845
494 Ga0307415_100000559
495 Ga0307415_100125600
496 Ga0307415_101256866
497 Ga0395900_0008888
498 Ga0395900_0694585
499 Ga0395900_0850836
500 Ga0395898_0005065
501 Ga0395898_0168748
502 Ga0395905_0027449
503 Ga0395905_0264963
504 Ga0395905_0581017
505 Ga0436364_0034377
506 Ga0436364_0256246
507 Ga0436364_0635143
508 Ga0395901_0028204
509 Ga0395901_0248119
510 Ga0395901_0317633
511 Ga0395901_0603391
512 Ga0436365_1016535
513 Ga0436365_1234754
514 Ga0436365_1338309
515 Ga0436365_1743313
516 Ga0436363_0064177
517 Ga0436363_0225137
518 Ga0436363_0305484
519 Ga0436363_0324665
520 Ga0436363_1410143
521 Ga0436363_1625118
522 Ga0436362_0038653
523 Ga0436362_0504942
524 Ga0466969_0218800
525 Ga0466966_0498586
526 Ga0466963_0204463
527 Ga0466971_0109467
528 Ga0466968_0010729
529 Ga0466970_0030584
530 Ga0466957_0417534
531 Ga0466959_0049156
532 Ga0466958_0021652
533 Ga0466958_0394106
534 Ga0466958_0398250
535 Ga0466967_0033619
536 Ga0466967_0521972
537 Ga0495653_0095209
538 Ga0495653_0630840
539 Ga0495664_0458819
540 Ga0495608_0000001
541 Ga0495608_0279920
542 Ga0495618_0094481
543 Ga0495628_0101259
544 Ga0495628_0545375
545 Ga0495630_0126515
546 Ga0495637_0127573
547 Ga0495652_0223568
548 Ga0495587_0314634
549 Ga0495667_0037139
550 Ga0495634_0297733
551 Ga0495635_0221934
552 Ga0495657_0000002
553 Ga0495657_0196340
554 Ga0495599_0111763
555 Ga0495623_0045444
556 Ga0495646_0142455
557 Ga0495658_0847436
558 Ga0495613_0378556
559 Ga0495604_0032728
560 Ga0495675_0000019
561 Ga0495684_0043706
562 Ga0495593_0020588
563 Ga0496100_0763488
564 Ga0496101_0003970
565 Ga0496102_0008894
566 Ga0496103_0635080
567 Ga0496104_0160266
568 Ga0496105_0050152
569 Ga0496105_0070749
570 Ga0496106_0005928
571 Ga0496106_0914610
572 Ga0496107_0005442
573 Ga0496108_0142265
574 Ga0496109_0331280
575 Ga0496109_0413593
576 Ga0496109_0605728
577 Ga0496109_0611185
578 Ga0496110_0854252
579 Ga0496111_0227221
580 Ga0496112_0038873
581 Ga0496112_0706677
582 Ga0496113_0042403
583 Ga0496114_0112466
584 Ga0496114_0187390
585 Ga0496114_0262931
586 Ga0496115_0011852
587 Ga0496115_0119191
588 Ga0496115_0377115
589 Ga0501067_0077078
590 nmdc:mga05p37_342846_c1
591 nmdc:mga05p37_50346_c1
592 nmdc:mga05p37_574165_c1
593 nmdc:mga08y16_117058_c1
594 nmdc:mga0n895_191754_c1
595 nmdc:mga0n895_805860_c1
596 nmdc:mga0rr50_68379_c1
597 nmdc:mga08x19_622997_c1
598 nmdc:mga0a205_184352_c1
599 Ga0495601_0621178
600 Ga0495655_0036395
601 Ga0495595_0000001
602 Ga0495595_0109633
603 Ga0495619_0000046
604 Ga0466962_0022244
605 Ga0466962_0174849
606 Ga0466962_0329567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

20

198

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7989 1 185
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7947 1 185
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7925 1 185
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7898 3 186
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7885 1 185
ID Description Score Start End Superfamily
af_A0A1X7YGG3_447_560_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8501 165 184 3.30.70.240
af_Q2FXY7_377_486_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8195 165 184 3.30.70.240
af_Q4DZ91_511_627_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7987 165 184 3.30.70.240
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.794 3 182 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.789 4 184 3.40.430.10
ID Description Score Start End GO Terms
AF-E3JD59-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9665 1 186 GO:0008703
GO:0009231
AF-E3JD59-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9615 1 186 GO:0008703
GO:0009231
AF-A0A179V6W6-F1-model_v4 Deaminase 0.9578 1 183 GO:0008703
GO:0009231
AF-H8IKP3-F1-model_v4 Deaminase-reductase domain protein 0.9547 1 186 GO:0008703
GO:0009231
AF-A0A6I5VKT6-F1-model_v4 Deaminase 0.9499 1 185 GO:0008703
GO:0009231

Map