F397154

General Info

Members Datasets Scaffolds Average Seq Length
303 181 604 123

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0734805|Ga0436364_0734805_55_498
Length 147
Sequence MALQGLIDKHLQSYSLTGICRIQYIKDVESVFEIIAEPNRRAILSLLVSSQKSVGDIERQLRIPQPAVSKHLRVLREAGFVESTVDAQRRLYRLKPEPLQEVDAWLAPFRRFWSAHLDALERHLDRMDQSTPKRRKTKTTTRSKPRK

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
96 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 2.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.3
Rhizosphere 92.74
Stem 0
Stem Tuber 0
Unclassified 13.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0734805 3300037853 Bacteria 624
2 Ga0070683_101523449 3300005329 Bacteria 643
3 Ga0070680_100090262 3300005336 Unclassified 2536
4 Ga0068868_100069163 3300005338 Bacteria 2813
5 Ga0070709_10126689 3300005434 Unclassified 1738
6 Ga0070709_10142895 3300005434 Bacteria 1646
7 Ga0070709_10860627 3300005434 Bacteria 715
8 Ga0070714_100559995 3300005435 Bacteria 1095
9 Ga0070713_100114223 3300005436 Bacteria 2359
10 Ga0070713_100148210 3300005436 Bacteria 2085
11 Ga0070713_100212236 3300005436 Bacteria 1753
12 Ga0070711_100043172 3300005439 Bacteria 3052
13 Ga0070705_100843127 3300005440 Bacteria 733
14 Ga0070708_100460059 3300005445 Bacteria 1200
15 Ga0070681_10442985 3300005458 Bacteria 1211
16 Ga0070681_10882703 3300005458 Unclassified 812
17 Ga0068867_100015442 3300005459 Bacteria 5415
18 Ga0070706_100127320 3300005467 Bacteria 2375
19 Ga0070706_100428835 3300005467 Bacteria 1230
20 Ga0070707_100115054 3300005468 Unclassified 2610
21 Ga0070707_100318097 3300005468 Bacteria 1512
22 Ga0070698_100042183 3300005471 Bacteria 4680
23 Ga0070698_100047853 3300005471 Bacteria 4371
24 Ga0070698_100308788 3300005471 Bacteria 1512
25 Ga0070699_100042504 3300005518 Bacteria 3933
26 Ga0070699_100147336 3300005518 Bacteria 2080
27 Ga0070699_100426124 3300005518 Bacteria 1201
28 Ga0070679_100144485 3300005530 Bacteria 2357
29 Ga0070679_100267086 3300005530 Bacteria 1666
30 Ga0070679_100600835 3300005530 Unclassified 1043
31 Ga0070679_101026546 3300005530 Bacteria 769
32 Ga0070684_100254396 3300005535 Bacteria 1605
33 Ga0070697_100040103 3300005536 Bacteria 3787
34 Ga0070697_100393683 3300005536 Bacteria 1201
35 Ga0070672_100224816 3300005543 Bacteria 1575
36 Ga0070696_100999474 3300005546 Unclassified 699
37 Ga0070696_101847623 3300005546 Bacteria 523
38 Ga0070693_101320314 3300005547 Bacteria 558
39 Ga0070665_100379272 3300005548 Bacteria 1421
40 Ga0070704_100562347 3300005549 Bacteria 998
41 Ga0068855_100579483 3300005563 Bacteria 1212
42 Ga0068855_100990699 3300005563 Bacteria 883
43 Ga0068854_100056768 3300005578 Bacteria 2823
44 Ga0068852_100232297 3300005616 Bacteria 1758
45 Ga0068852_100523779 3300005616 Unclassified 1183
46 Ga0068864_101754068 3300005618 Bacteria 626
47 Ga0068863_100048380 3300005841 Unclassified 4033
48 Ga0068863_100297741 3300005841 Bacteria 1564
49 Ga0068858_100130634 3300005842 Unclassified 2355
50 Ga0068858_100637416 3300005842 Bacteria 1035
51 Ga0081539_10333808 3300005985 Bacteria 641
52 Ga0070717_10327159 3300006028 Bacteria 1367
53 Ga0070717_10669062 3300006028 Bacteria 943
54 Ga0070717_11046106 3300006028 Bacteria 743
55 Ga0070716_100151910 3300006173 Bacteria 1491
56 Ga0070716_100223735 3300006173 Bacteria 1266
57 Ga0070716_100493517 3300006173 Bacteria 902
58 Ga0070712_100199035 3300006175 Bacteria 1572
59 Ga0070712_100344763 3300006175 Bacteria 1217
60 Ga0070712_101453821 3300006175 Bacteria 599
61 Ga0097621_100001121 3300006237 Bacteria 18657
62 Ga0068871_100060648 3300006358 Bacteria 3086
63 Ga0075433_10025539 3300006852 Bacteria 4994
64 Ga0075434_100001525 3300006871 Bacteria 19566
65 Ga0075434_100809939 3300006871 Bacteria 953
66 Ga0075434_101260542 3300006871 Bacteria 751
67 Ga0105240_10014941 3300009093 Bacteria 10577
68 Ga0105240_10841429 3300009093 Bacteria 991
69 Ga0105240_10968806 3300009093 Bacteria 911
70 Ga0105240_11051558 3300009093 Unclassified 868
71 Ga0105240_12259061 3300009093 Bacteria 564
72 Ga0105245_10012430 3300009098 Bacteria 7409
73 Ga0105245_10094902 3300009098 Bacteria 2750
74 Ga0105241_10011928 3300009174 Bacteria 6383
75 Ga0105241_10464882 3300009174 Bacteria 1121
76 Ga0105242_10083423 3300009176 Bacteria 2676
77 Ga0105248_10145169 3300009177 Bacteria 2678
78 Ga0105248_11602001 3300009177 Unclassified 738
79 Ga0105237_10256127 3300009545 Bacteria 1752
80 Ga0105237_10493504 3300009545 Unclassified 1231
81 Ga0105237_11904888 3300009545 Bacteria 603
82 Ga0105238_10176660 3300009551 Bacteria 2112
83 Ga0105238_11196945 3300009551 Bacteria 784
84 Ga0105249_10964205 3300009553 Bacteria 921
85 Ga0105239_10204879 3300010375 Bacteria 2210
86 Ga0105239_10271975 3300010375 Bacteria 1906
87 Ga0105239_11088621 3300010375 Unclassified 920
88 Ga0105246_10374849 3300011119 Bacteria 1174
89 Ga0157373_10048016 3300013100 Bacteria 3044
90 Ga0157373_10358638 3300013100 Bacteria 1041
91 Ga0157370_10397399 3300013104 Bacteria 1269
92 Ga0157370_11352097 3300013104 Bacteria 641
93 Ga0157369_10047291 3300013105 Bacteria 4673
94 Ga0157369_10061202 3300013105 Bacteria 4059
95 Ga0157369_10118201 3300013105 Bacteria 2814
96 Ga0157369_11574723 3300013105 Bacteria 668
97 Ga0157374_10353309 3300013296 Unclassified 1461
98 Ga0157374_10638482 3300013296 Unclassified 1076
99 Ga0157378_10000108 3300013297 Bacteria 78677
100 Ga0157378_10012506 3300013297 Bacteria 7429
101 Ga0157378_10835864 3300013297 Bacteria 948
102 Ga0157378_12350494 3300013297 Unclassified 585
103 Ga0157372_10001881 3300013307 Bacteria 22752
104 Ga0157372_10054159 3300013307 Bacteria 4474
105 Ga0157372_10248458 3300013307 Bacteria 2065
106 Ga0157375_10275724 3300013308 Unclassified 1844
107 Ga0157375_13745262 3300013308 Bacteria 505
108 Ga0182008_10470028 3300014497 Bacteria 687
109 Ga0157379_10341687 3300014968 Bacteria 1369
110 Ga0157379_12112171 3300014968 Bacteria 558
111 Ga0213874_10003436 3300021377 Bacteria 3512
112 Ga0213875_10001973 3300021388 Bacteria 12686
113 Ga0224570_101699 3300022730 Bacteria 1581
114 Ga0228598_1000028 3300024227 Bacteria 20121
115 Ga0207697_10462085 3300025315 Bacteria 562
116 Ga0207692_10189425 3300025898 Bacteria 1203
117 Ga0207680_10206384 3300025903 Bacteria 1341
118 Ga0207685_10378714 3300025905 Bacteria 720
119 Ga0207699_10147308 3300025906 Bacteria 1554
120 Ga0207699_10282242 3300025906 Bacteria 1154
121 Ga0207699_10783364 3300025906 Bacteria 701
122 Ga0207705_10104209 3300025909 Bacteria 2090
123 Ga0207684_10058713 3300025910 Bacteria 3265
124 Ga0207684_10155385 3300025910 Bacteria 1969
125 Ga0207684_10364090 3300025910 Bacteria 1244
126 Ga0207654_10041670 3300025911 Bacteria 2594
127 Ga0207654_10393942 3300025911 Bacteria 962
128 Ga0207707_10051171 3300025912 Bacteria 3597
129 Ga0207707_10078645 3300025912 Bacteria 2880
130 Ga0207707_11051438 3300025912 Bacteria 666
131 Ga0207695_10012864 3300025913 Bacteria 10017
132 Ga0207695_10675183 3300025913 Bacteria 914
133 Ga0207695_10723974 3300025913 Bacteria 875
134 Ga0207693_10080388 3300025915 Bacteria 2552
135 Ga0207693_11120944 3300025915 Bacteria 597
136 Ga0207663_10033085 3300025916 Bacteria 3076
137 Ga0207663_10147190 3300025916 Bacteria 1648
138 Ga0207646_10001180 3300025922 Bacteria 32946
139 Ga0207646_10121433 3300025922 Bacteria 2347
140 Ga0207646_10273677 3300025922 Bacteria 1526
141 Ga0207646_10602585 3300025922 Bacteria 986
142 Ga0207694_10298441 3300025924 Bacteria 1326
143 Ga0207694_10833498 3300025924 Bacteria 779
144 Ga0207687_10051198 3300025927 Bacteria 2878
145 Ga0207700_10438585 3300025928 Bacteria 1149
146 Ga0207664_10122797 3300025929 Bacteria 2176
147 Ga0207664_10933758 3300025929 Bacteria 778
148 Ga0207706_11186924 3300025933 Bacteria 635
149 Ga0207686_10436592 3300025934 Bacteria 1004
150 Ga0207709_10129704 3300025935 Bacteria 1716
151 Ga0207704_10018924 3300025938 Bacteria 3606
152 Ga0207665_10036953 3300025939 Bacteria 3249
153 Ga0207665_10137517 3300025939 Bacteria 1740
154 Ga0207691_10046418 3300025940 Bacteria 3992
155 Ga0207711_11488012 3300025941 Bacteria 620
156 Ga0207711_11720622 3300025941 Unclassified 570
157 Ga0207667_10182828 3300025949 Bacteria 2152
158 Ga0207667_10354075 3300025949 Bacteria 1497
159 Ga0207667_11554207 3300025949 Bacteria 631
160 Ga0207640_11989981 3300025981 Bacteria 526
161 Ga0207677_10244917 3300026023 Bacteria 1452
162 Ga0207703_10781236 3300026035 Bacteria 911
163 Ga0207703_10961741 3300026035 Unclassified 819
164 Ga0207641_10027865 3300026088 Unclassified 4666
165 Ga0207641_10410080 3300026088 Bacteria 1303
166 Ga0207648_10019241 3300026089 Bacteria 6163
167 Ga0268266_10372412 3300028379 Bacteria 1345
168 Ga0268266_11752414 3300028379 Bacteria 596
169 Ga0268264_11762944 3300028381 Bacteria 629
170 Ga0265338_10038289 3300028800 Bacteria 4546
171 Ga0265338_10150604 3300028800 Bacteria 1808
172 Ga0316178_1032798 3300030735 Bacteria 559
173 Ga0265765_1022016 3300030879 Bacteria 776
174 Ga0265328_10013760 3300031239 Bacteria 3196
175 Ga0265339_10000670 3300031249 Bacteria 26468
176 Ga0265339_10057786 3300031249 Bacteria 2097
177 Ga0265339_10366633 3300031249 Bacteria 677
178 Ga0265331_10044824 3300031250 Bacteria 2137
179 Ga0265316_10010386 3300031344 Bacteria 8488
180 Ga0265314_10005213 3300031711 Bacteria 11795
181 Ga0373926_0006911 3300035083 Bacteria 3772
182 Ga0373944_0101378 3300035089 Unclassified 973
183 Ga0373923_0129738 3300035111 Bacteria 1132
184 Ga0373923_0490887 3300035111 Bacteria 598
185 Ga0373936_0015015 3300035113 Unclassified 2965
186 Ga0373936_0031824 3300035113 Bacteria 2084
187 Ga0373936_0072458 3300035113 Bacteria 1422
188 Ga0373945_0030857 3300035116 Unclassified 1890
189 Ga0373945_0256558 3300035116 Bacteria 740
190 Ga0373945_0512440 3300035116 Bacteria 535
191 Ga0373953_0034263 3300035117 Bacteria 1990
192 Ga0373957_0055708 3300035120 Bacteria 1521
193 Ga0373943_0057122 3300035170 Bacteria 1938
194 Ga0373943_0251639 3300035170 Bacteria 992
195 Ga0373955_0085740 3300035172 Unclassified 1788
196 Ga0373955_0118279 3300035172 Bacteria 1538
197 Ga0373955_0150981 3300035172 Bacteria 1367
198 Ga0373924_0003063 3300035410 Bacteria 5704
199 Ga0373935_0005446 3300035692 Bacteria 7499
200 Ga0373935_0049793 3300035692 Unclassified 2657
201 Ga0373927_0006740 3300035695 Bacteria 7817
202 Ga0373933_0267536 3300035724 Bacteria 1103
203 Ga0373947_0008929 3300035725 Bacteria 5761
204 Ga0373947_0025587 3300035725 Bacteria 3443
205 Ga0373947_0097555 3300035725 Unclassified 1842
206 Ga0373947_0436685 3300035725 Bacteria 886
207 Ga0373937_0132421 3300036401 Bacteria 2329
208 Ga0373925_0009663 3300037068 Bacteria 7024
209 Ga0373925_0015442 3300037068 Bacteria 5520
210 Ga0373925_0100377 3300037068 Bacteria 2224
211 Ga0373925_0247965 3300037068 Bacteria 1428
212 Ga0395900_0938500 3300037418 Bacteria 787
213 Ga0395898_0027918 3300037466 Bacteria 5660
214 Ga0395898_0342462 3300037466 Bacteria 1426
215 Ga0395898_1222372 3300037466 Bacteria 682
216 Ga0395905_0021752 3300037471 Bacteria 6067
217 Ga0436364_1395861 3300037853 Bacteria 710
218 Ga0436364_1409525 3300037853 Bacteria 732
219 Ga0395901_0491835 3300038443 Bacteria 1250
220 Ga0436365_0221120 3300039437 Unclassified 2957
221 Ga0436365_1011546 3300039437 Bacteria 898
222 Ga0436365_1694268 3300039437 Bacteria 635
223 Ga0436361_0105626 3300039447 Bacteria 76260
224 Ga0436363_0700174 3300039450 Unclassified 597
225 Ga0436363_0725077 3300039450 Unclassified 3256
226 Ga0436363_1391243 3300039450 Bacteria 771
227 Ga0436363_1610980 3300039450 Bacteria 1512
228 Ga0436362_0358889 3300039453 Bacteria 1555
229 Ga0436362_0435137 3300039453 Bacteria 656
230 Ga0436362_0675707 3300039453 Bacteria 948
231 Ga0436362_1044195 3300039453 Bacteria 2768
232 Ga0466957_1416076 3300044842 Bacteria 506
233 Ga0466967_1192574 3300045976 Unclassified 758
234 Ga0466967_2149615 3300045976 Unclassified 554
235 Ga0495580_0007551 3300046472 Bacteria 8723
236 Ga0495580_0033234 3300046472 Bacteria 3717
237 Ga0495580_0450714 3300046472 Bacteria 863
238 Ga0495582_0004223 3300046473 Bacteria 8083
239 Ga0495639_0170167 3300046475 Bacteria 1057
240 Ga0495639_0204171 3300046475 Bacteria 968
241 Ga0495662_0084865 3300046476 Unclassified 1542
242 Ga0495664_0092917 3300046477 Unclassified 1815
243 Ga0495594_0073779 3300046499 Bacteria 1900
244 Ga0495618_0445228 3300046514 Unclassified 787
245 Ga0495618_0923939 3300046514 Bacteria 503
246 Ga0495628_0380503 3300046516 Unclassified 1034
247 Ga0495630_0104082 3300046517 Unclassified 2148
248 Ga0495666_0182107 3300046526 Bacteria 970
249 Ga0495665_0005513 3300046531 Bacteria 6818
250 Ga0495665_0392995 3300046531 Bacteria 704
251 Ga0495587_0380108 3300046536 Bacteria 786
252 Ga0495645_0086738 3300046543 Bacteria 2240
253 Ga0495645_0319221 3300046543 Unclassified 1009
254 Ga0495622_0468461 3300046557 Bacteria 540
255 Ga0495667_0490328 3300046559 Bacteria 770
256 Ga0495635_0415070 3300046663 Bacteria 893
257 Ga0495623_0212447 3300046679 Bacteria 1107
258 Ga0495624_0160390 3300046690 Unclassified 1374
259 Ga0495581_0026943 3300047315 Bacteria 3333
260 Ga0495674_0024468 3300047319 Bacteria 5548
261 Ga0495674_0120469 3300047319 Bacteria 2217
262 Ga0495675_0407321 3300047444 Bacteria 792
263 Ga0495602_0663021 3300048088 Bacteria 711
264 Ga0495614_0543353 3300048089 Bacteria 555
265 Ga0496100_0389496 3300048903 Bacteria 1059
266 Ga0496101_0309361 3300048904 Bacteria 1238
267 Ga0496102_0679344 3300048905 Bacteria 953
268 Ga0496104_0056994 3300048907 Bacteria 3697
269 Ga0496105_0542614 3300048908 Bacteria 908
270 Ga0496107_0382394 3300048910 Bacteria 1047
271 Ga0496110_0763015 3300048913 Bacteria 871
272 Ga0496112_0946350 3300048915 Bacteria 782
273 Ga0496114_0022151 3300048917 Bacteria 5176
274 Ga0496115_0010633 3300048918 Bacteria 6883
275 Ga0501037_0187607 3300049573 Unclassified 1465
276 Ga0501047_0594447 3300049581 Unclassified 929
277 Ga0501047_0698317 3300049581 Bacteria 832
278 Ga0501048_0204778 3300049582 Unclassified 1399
279 Ga0501070_0148001 3300049586 Bacteria 1938
280 Ga0501071_0259927 3300049587 Bacteria 1311
281 Ga0501074_0192000 3300049590 Unclassified 1456
282 Ga0501076_0152178 3300049592 Bacteria 1882
283 Ga0501076_0281821 3300049592 Bacteria 1362
284 Ga0501044_0001670 3300049823 Bacteria 26059
285 nmdc:mga08y16_1360715_c1 3300050511 Bacteria 674
286 nmdc:mga0n895_1944_c1 3300050512 Bacteria 15863
287 nmdc:mga0n895_7557_c1 3300050512 Bacteria 9341
288 nmdc:mga0rr50_1722981_c1 3300050513 Bacteria 528
289 nmdc:mga0rr50_731580_c1 3300050513 Bacteria 844
290 nmdc:mga0rr50_888130_c1 3300050513 Bacteria 760
291 nmdc:mga08x19_19725_c1 3300050514 Bacteria 4142
292 nmdc:mga08x19_57874_c1 3300050514 Bacteria 2506
293 nmdc:mga0a205_10836_c1 3300050515 Bacteria 8387
294 nmdc:mga0a205_113049_c1 3300050515 Bacteria 2614
295 Ga0495601_0014427 3300053077 Bacteria 4762
296 Ga0495619_0294242 3300053085 Bacteria 1125
297 Ga0587066_007075 3300059490 Bacteria 1507
298 Ga0587083_0021147 3300059505 Bacteria 1206
299 Ga0587091_005025 3300059511 Bacteria 1776
300 Ga0587128_029359 3300059630 Bacteria 901
301 Ga0587078_003053 3300059646 Bacteria 1664
302 Ga0587079_031373 3300059647 Bacteria 1023
303 Ga0436364_0734805
304 Ga0070683_101523449
305 Ga0070680_100090262
306 Ga0068868_100069163
307 Ga0070709_10126689
308 Ga0070709_10142895
309 Ga0070709_10860627
310 Ga0070714_100559995
311 Ga0070713_100114223
312 Ga0070713_100148210
313 Ga0070713_100212236
314 Ga0070711_100043172
315 Ga0070705_100843127
316 Ga0070708_100460059
317 Ga0070681_10442985
318 Ga0070681_10882703
319 Ga0068867_100015442
320 Ga0070706_100127320
321 Ga0070706_100428835
322 Ga0070707_100115054
323 Ga0070707_100318097
324 Ga0070698_100042183
325 Ga0070698_100047853
326 Ga0070698_100308788
327 Ga0070699_100042504
328 Ga0070699_100147336
329 Ga0070699_100426124
330 Ga0070679_100144485
331 Ga0070679_100267086
332 Ga0070679_100600835
333 Ga0070679_101026546
334 Ga0070684_100254396
335 Ga0070697_100040103
336 Ga0070697_100393683
337 Ga0070672_100224816
338 Ga0070696_100999474
339 Ga0070696_101847623
340 Ga0070693_101320314
341 Ga0070665_100379272
342 Ga0070704_100562347
343 Ga0068855_100579483
344 Ga0068855_100990699
345 Ga0068854_100056768
346 Ga0068852_100232297
347 Ga0068852_100523779
348 Ga0068864_101754068
349 Ga0068863_100048380
350 Ga0068863_100297741
351 Ga0068858_100130634
352 Ga0068858_100637416
353 Ga0081539_10333808
354 Ga0070717_10327159
355 Ga0070717_10669062
356 Ga0070717_11046106
357 Ga0070716_100151910
358 Ga0070716_100223735
359 Ga0070716_100493517
360 Ga0070712_100199035
361 Ga0070712_100344763
362 Ga0070712_101453821
363 Ga0097621_100001121
364 Ga0068871_100060648
365 Ga0075433_10025539
366 Ga0075434_100001525
367 Ga0075434_100809939
368 Ga0075434_101260542
369 Ga0105240_10014941
370 Ga0105240_10841429
371 Ga0105240_10968806
372 Ga0105240_11051558
373 Ga0105240_12259061
374 Ga0105245_10012430
375 Ga0105245_10094902
376 Ga0105241_10011928
377 Ga0105241_10464882
378 Ga0105242_10083423
379 Ga0105248_10145169
380 Ga0105248_11602001
381 Ga0105237_10256127
382 Ga0105237_10493504
383 Ga0105237_11904888
384 Ga0105238_10176660
385 Ga0105238_11196945
386 Ga0105249_10964205
387 Ga0105239_10204879
388 Ga0105239_10271975
389 Ga0105239_11088621
390 Ga0105246_10374849
391 Ga0157373_10048016
392 Ga0157373_10358638
393 Ga0157370_10397399
394 Ga0157370_11352097
395 Ga0157369_10047291
396 Ga0157369_10061202
397 Ga0157369_10118201
398 Ga0157369_11574723
399 Ga0157374_10353309
400 Ga0157374_10638482
401 Ga0157378_10000108
402 Ga0157378_10012506
403 Ga0157378_10835864
404 Ga0157378_12350494
405 Ga0157372_10001881
406 Ga0157372_10054159
407 Ga0157372_10248458
408 Ga0157375_10275724
409 Ga0157375_13745262
410 Ga0182008_10470028
411 Ga0157379_10341687
412 Ga0157379_12112171
413 Ga0213874_10003436
414 Ga0213875_10001973
415 Ga0224570_101699
416 Ga0228598_1000028
417 Ga0207697_10462085
418 Ga0207692_10189425
419 Ga0207680_10206384
420 Ga0207685_10378714
421 Ga0207699_10147308
422 Ga0207699_10282242
423 Ga0207699_10783364
424 Ga0207705_10104209
425 Ga0207684_10058713
426 Ga0207684_10155385
427 Ga0207684_10364090
428 Ga0207654_10041670
429 Ga0207654_10393942
430 Ga0207707_10051171
431 Ga0207707_10078645
432 Ga0207707_11051438
433 Ga0207695_10012864
434 Ga0207695_10675183
435 Ga0207695_10723974
436 Ga0207693_10080388
437 Ga0207693_11120944
438 Ga0207663_10033085
439 Ga0207663_10147190
440 Ga0207646_10001180
441 Ga0207646_10121433
442 Ga0207646_10273677
443 Ga0207646_10602585
444 Ga0207694_10298441
445 Ga0207694_10833498
446 Ga0207687_10051198
447 Ga0207700_10438585
448 Ga0207664_10122797
449 Ga0207664_10933758
450 Ga0207706_11186924
451 Ga0207686_10436592
452 Ga0207709_10129704
453 Ga0207704_10018924
454 Ga0207665_10036953
455 Ga0207665_10137517
456 Ga0207691_10046418
457 Ga0207711_11488012
458 Ga0207711_11720622
459 Ga0207667_10182828
460 Ga0207667_10354075
461 Ga0207667_11554207
462 Ga0207640_11989981
463 Ga0207677_10244917
464 Ga0207703_10781236
465 Ga0207703_10961741
466 Ga0207641_10027865
467 Ga0207641_10410080
468 Ga0207648_10019241
469 Ga0268266_10372412
470 Ga0268266_11752414
471 Ga0268264_11762944
472 Ga0265338_10038289
473 Ga0265338_10150604
474 Ga0316178_1032798
475 Ga0265765_1022016
476 Ga0265328_10013760
477 Ga0265339_10000670
478 Ga0265339_10057786
479 Ga0265339_10366633
480 Ga0265331_10044824
481 Ga0265316_10010386
482 Ga0265314_10005213
483 Ga0373926_0006911
484 Ga0373944_0101378
485 Ga0373923_0129738
486 Ga0373923_0490887
487 Ga0373936_0015015
488 Ga0373936_0031824
489 Ga0373936_0072458
490 Ga0373945_0030857
491 Ga0373945_0256558
492 Ga0373945_0512440
493 Ga0373953_0034263
494 Ga0373957_0055708
495 Ga0373943_0057122
496 Ga0373943_0251639
497 Ga0373955_0085740
498 Ga0373955_0118279
499 Ga0373955_0150981
500 Ga0373924_0003063
501 Ga0373935_0005446
502 Ga0373935_0049793
503 Ga0373927_0006740
504 Ga0373933_0267536
505 Ga0373947_0008929
506 Ga0373947_0025587
507 Ga0373947_0097555
508 Ga0373947_0436685
509 Ga0373937_0132421
510 Ga0373925_0009663
511 Ga0373925_0015442
512 Ga0373925_0100377
513 Ga0373925_0247965
514 Ga0395900_0938500
515 Ga0395898_0027918
516 Ga0395898_0342462
517 Ga0395898_1222372
518 Ga0395905_0021752
519 Ga0436364_1395861
520 Ga0436364_1409525
521 Ga0395901_0491835
522 Ga0436365_0221120
523 Ga0436365_1011546
524 Ga0436365_1694268
525 Ga0436361_0105626
526 Ga0436363_0700174
527 Ga0436363_0725077
528 Ga0436363_1391243
529 Ga0436363_1610980
530 Ga0436362_0358889
531 Ga0436362_0435137
532 Ga0436362_0675707
533 Ga0436362_1044195
534 Ga0466957_1416076
535 Ga0466967_1192574
536 Ga0466967_2149615
537 Ga0495580_0007551
538 Ga0495580_0033234
539 Ga0495580_0450714
540 Ga0495582_0004223
541 Ga0495639_0170167
542 Ga0495639_0204171
543 Ga0495662_0084865
544 Ga0495664_0092917
545 Ga0495594_0073779
546 Ga0495618_0445228
547 Ga0495618_0923939
548 Ga0495628_0380503
549 Ga0495630_0104082
550 Ga0495666_0182107
551 Ga0495665_0005513
552 Ga0495665_0392995
553 Ga0495587_0380108
554 Ga0495645_0086738
555 Ga0495645_0319221
556 Ga0495622_0468461
557 Ga0495667_0490328
558 Ga0495635_0415070
559 Ga0495623_0212447
560 Ga0495624_0160390
561 Ga0495581_0026943
562 Ga0495674_0024468
563 Ga0495674_0120469
564 Ga0495675_0407321
565 Ga0495602_0663021
566 Ga0495614_0543353
567 Ga0496100_0389496
568 Ga0496101_0309361
569 Ga0496102_0679344
570 Ga0496104_0056994
571 Ga0496105_0542614
572 Ga0496107_0382394
573 Ga0496110_0763015
574 Ga0496112_0946350
575 Ga0496114_0022151
576 Ga0496115_0010633
577 Ga0501037_0187607
578 Ga0501047_0594447
579 Ga0501047_0698317
580 Ga0501048_0204778
581 Ga0501070_0148001
582 Ga0501071_0259927
583 Ga0501074_0192000
584 Ga0501076_0152178
585 Ga0501076_0281821
586 Ga0501044_0001670
587 nmdc:mga08y16_1360715_c1
588 nmdc:mga0n895_1944_c1
589 nmdc:mga0n895_7557_c1
590 nmdc:mga0rr50_1722981_c1
591 nmdc:mga0rr50_731580_c1
592 nmdc:mga0rr50_888130_c1
593 nmdc:mga08x19_19725_c1
594 nmdc:mga08x19_57874_c1
595 nmdc:mga0a205_10836_c1
596 nmdc:mga0a205_113049_c1
597 Ga0495601_0014427
598 Ga0495619_0294242
599 Ga0587066_007075
600 Ga0587083_0021147
601 Ga0587091_005025
602 Ga0587128_029359
603 Ga0587078_003053
604 Ga0587079_031373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

37

83

0.98

PF12840

HTH_20

Helix-turn-helix domain

35

84

0.97

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

37

97

0.88

PF12802

MarR_2

MarR family

38

90

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9772 4 68
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.956 4 76
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9503 13 68
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9459 4 79
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9444 25 68
ID Description Score Start End Superfamily
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9814 4 68 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9751 10 66 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9616 5 68 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 14 67 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9575 5 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q8ADR8-F1-model_v4 ArsR family transcriptional regulator 0.9931 4 84 GO:0003700
AF-A0A2V7U777-F1-model_v4 Transcriptional regulator 0.9889 1 74 GO:0003700
AF-A0A644WGE3-F1-model_v4 Transcriptional repressor SdpR 0.9876 5 74 GO:0003700
AF-M0B0V8-F1-model_v4 ArsR family transcriptional regulator 0.9835 2 67 GO:0003700
AF-A0A0M3R905-F1-model_v4 ArsR family transcriptional regulator 0.9823 6 74 GO:0003677
GO:0003700

Map