F397116

General Info

Members Datasets Scaffolds Average Seq Length
303 166 267 180

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10673479|Ga0307410_106734791
Length 193
Sequence MGSYAVFLRGINVGGINIKMADLREALKAAGFADARTLLASGNVVLTSTLDAAAVKRECEKCLRAAFGYDAWVVVLEAARVAELVAACPYPDDDKTTHTYITLSSDKAMLDELDTAGAALEGIQQTRLGPEALAWLAPAGGTLDSPFSKISAKPRFKATTTTRNLRTLIKVRDAAAELAAAGGNPGADSARKD

Samples

Sample ID Description Type Environment
1 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
2 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
3 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
4 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
5 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
6 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
7 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
8 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
9 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
10 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
11 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
12 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
13 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
14 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
15 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
16 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
17 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
18 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
19 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
20 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
21 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
22 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
23 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
24 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
25 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
26 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
27 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
28 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
29 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
30 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
31 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
32 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
33 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
103 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
109 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
110 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
111 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
112 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
165 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
166 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 0
Isolates 11.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 10.23
Rhizosphere 83.17
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10050208 3300003322 Bacteria 6832
2 Ga0065714_10009239 3300005288 Bacteria 3996
3 Ga0065712_10189573 3300005290 Bacteria 1154
4 Ga0070676_10013868 3300005328 Bacteria 4421
5 Ga0070670_100434080 3300005331 Bacteria 1162
6 Ga0070677_10016519 3300005333 Bacteria 2630
7 Ga0070666_10346874 3300005335 Bacteria 1062
8 Ga0070675_100139025 3300005354 Bacteria 2075
9 Ga0070671_100051009 3300005355 Bacteria 3441
10 Ga0070674_100106389 3300005356 Bacteria 2053
11 Ga0070667_100137806 3300005367 Bacteria 2134
12 Ga0070678_100018531 3300005456 Bacteria 4513
13 Ga0070672_100023553 3300005543 Bacteria 4540
14 Ga0075432_10005921 3300006058 Bacteria 4159
15 Ga0075362_10335470 3300006177 Bacteria 755
16 Ga0105251_10013879 3300009011 Bacteria 4481
17 Ga0105244_10004695 3300009036 Bacteria 9311
18 Ga0105244_10011687 3300009036 Bacteria 5241
19 Ga0105243_10004365 3300009148 Bacteria 11202
20 Ga0105243_10155206 3300009148 Bacteria 1968
21 Ga0105242_10321140 3300009176 Bacteria 1420
22 Ga0105248_10058233 3300009177 Bacteria 4338
23 Ga0105238_11887470 3300009551 Bacteria 630
24 Ga0105246_10001313 3300011119 Bacteria 14635
25 Ga0105246_10025131 3300011119 Bacteria 3881
26 Ga0105246_10055877 3300011119 Bacteria 2726
27 Ga0157371_10262375 3300013102 Bacteria 1245
28 Ga0157371_10557519 3300013102 Bacteria 850
29 Ga0157369_10367643 3300013105 Bacteria 1493
30 Ga0157369_11549992 3300013105 Bacteria 674
31 Ga0163162_10375794 3300013306 Bacteria 1554
32 Ga0157372_11709440 3300013307 Bacteria 724
33 Ga0209148_1011188 3300025254 Bacteria 1675
34 Ga0209759_1018905 3300025256 Bacteria 1653
35 Ga0209051_1022187 3300025303 Bacteria 2678
36 Ga0207697_10002620 3300025315 Bacteria 9253
37 Ga0207697_10034852 3300025315 Bacteria 2060
38 Ga0207655_1011356 3300025728 Bacteria 5308
39 Ga0207655_1056622 3300025728 Bacteria 1545
40 Ga0207713_1081667 3300025735 Bacteria 1161
41 Ga0207682_10022229 3300025893 Bacteria 2498
42 Ga0207645_10015972 3300025907 Bacteria 4974
43 Ga0207681_10021594 3300025923 Bacteria 4095
44 Ga0207650_10317067 3300025925 Bacteria 1276
45 Ga0207659_10086520 3300025926 Bacteria 2331
46 Ga0207644_10121355 3300025931 Bacteria 1990
47 Ga0207686_10266658 3300025934 Bacteria 1258
48 Ga0207709_10098400 3300025935 Bacteria 1929
49 Ga0207709_10126454 3300025935 Bacteria 1735
50 Ga0207669_10020093 3300025937 Bacteria 3494
51 Ga0207691_10000233 3300025940 Bacteria 54222
52 Ga0207711_10329720 3300025941 Bacteria 1411
53 Ga0207651_10284628 3300025960 Bacteria 1368
54 Ga0207658_10021498 3300025986 Bacteria 4481
55 Ga0207683_10009097 3300026121 Bacteria 8465
56 Ga0207428_10000930 3300027907 Bacteria 32598
57 Ga0207428_10174250 3300027907 Bacteria 1628
58 Ga0307408_100010991 3300031548 Bacteria 5973
59 Ga0307408_100021303 3300031548 Bacteria 4386
60 Ga0307408_100028450 3300031548 Bacteria 3862
61 Ga0307408_100047316 3300031548 Bacteria 3080
62 Ga0307408_100066511 3300031548 Bacteria 2647
63 Ga0307408_100080164 3300031548 Bacteria 2438
64 Ga0307408_100160234 3300031548 Bacteria 1786
65 Ga0307408_100260462 3300031548 Bacteria 1435
66 Ga0307408_100276921 3300031548 Bacteria 1395
67 Ga0307408_100290756 3300031548 Bacteria 1364
68 Ga0307408_100681877 3300031548 Bacteria 922
69 Ga0307408_100780474 3300031548 Bacteria 865
70 Ga0307405_10002212 3300031731 Bacteria 8494
71 Ga0307405_10005056 3300031731 Bacteria 6311
72 Ga0307405_10012356 3300031731 Bacteria 4516
73 Ga0307405_10122228 3300031731 Bacteria 1783
74 Ga0307405_10182164 3300031731 Bacteria 1509
75 Ga0307405_10456428 3300031731 Bacteria 1014
76 Ga0307405_10500057 3300031731 Bacteria 974
77 Ga0307405_10769770 3300031731 Bacteria 804
78 Ga0307413_10038806 3300031824 Bacteria 2763
79 Ga0307413_10118949 3300031824 Bacteria 1785
80 Ga0307413_10133336 3300031824 Bacteria 1704
81 Ga0307413_10233523 3300031824 Bacteria 1352
82 Ga0307413_10266743 3300031824 Bacteria 1279
83 Ga0307413_10279060 3300031824 Bacteria 1256
84 Ga0307413_10550932 3300031824 Bacteria 935
85 Ga0307410_10018224 3300031852 Bacteria 4238
86 Ga0307410_10053691 3300031852 Bacteria 2728
87 Ga0307410_10201246 3300031852 Bacteria 1520
88 Ga0307410_10255759 3300031852 Bacteria 1364
89 Ga0307410_10376844 3300031852 Bacteria 1141
90 Ga0307410_10389380 3300031852 Bacteria 1123
91 Ga0307410_10484443 3300031852 Bacteria 1015
92 Ga0307410_10633082 3300031852 Bacteria 895
93 Ga0307410_10673479 3300031852 Bacteria 870
94 Ga0307406_10055089 3300031901 Bacteria 2541
95 Ga0307406_10247042 3300031901 Bacteria 1342
96 Ga0307406_11165984 3300031901 Bacteria 668
97 Ga0307406_11423242 3300031901 Bacteria 608
98 Ga0307407_10029763 3300031903 Bacteria 2938
99 Ga0307407_10079077 3300031903 Bacteria 1983
100 Ga0307407_10264655 3300031903 Bacteria 1184
101 Ga0307407_10533642 3300031903 Bacteria 865
102 Ga0307412_10007885 3300031911 Bacteria 6064
103 Ga0307412_10009780 3300031911 Bacteria 5504
104 Ga0307412_10034535 3300031911 Bacteria 3223
105 Ga0307412_10040812 3300031911 Bacteria 3004
106 Ga0307412_10047692 3300031911 Bacteria 2814
107 Ga0307412_10079888 3300031911 Bacteria 2257
108 Ga0307412_10151362 3300031911 Bacteria 1712
109 Ga0307412_10152075 3300031911 Bacteria 1709
110 Ga0307412_10205580 3300031911 Bacteria 1498
111 Ga0307412_10239058 3300031911 Bacteria 1403
112 Ga0307412_10826134 3300031911 Bacteria 806
113 Ga0307409_100015438 3300031995 Bacteria 5014
114 Ga0307409_100065335 3300031995 Bacteria 2862
115 Ga0307409_100136169 3300031995 Bacteria 2108
116 Ga0307416_100051905 3300032002 Bacteria 3279
117 Ga0307416_100110309 3300032002 Bacteria 2422
118 Ga0307416_100226590 3300032002 Bacteria 1798
119 Ga0307416_100253583 3300032002 Bacteria 1714
120 Ga0307416_100259617 3300032002 Bacteria 1697
121 Ga0307416_100401957 3300032002 Bacteria 1408
122 Ga0307416_100661763 3300032002 Bacteria 1130
123 Ga0307416_100842748 3300032002 Bacteria 1014
124 Ga0307414_10148477 3300032004 Bacteria 1846
125 Ga0307414_10152911 3300032004 Bacteria 1823
126 Ga0307414_10680171 3300032004 Bacteria 930
127 Ga0307415_100314148 3300032126 Bacteria 1304
128 Ga0307415_100392824 3300032126 Bacteria 1182
129 Ga0395899_0035658 3300037312 Bacteria 3733
130 Ga0395899_0078169 3300037312 Bacteria 2412
131 Ga0395899_0116946 3300037312 Bacteria 1912
132 Ga0395899_0125543 3300037312 Bacteria 1835
133 Ga0395900_0031105 3300037418 Bacteria 5483
134 Ga0395900_0043297 3300037418 Bacteria 4640
135 Ga0395900_0071504 3300037418 Bacteria 3566
136 Ga0395900_0274963 3300037418 Bacteria 1678
137 Ga0395898_0041184 3300037466 Bacteria 4563
138 Ga0395898_0057219 3300037466 Bacteria 3800
139 Ga0395898_0110862 3300037466 Bacteria 2630
140 Ga0395901_0021029 3300038443 Bacteria 6684
141 Ga0395901_0025258 3300038443 Bacteria 6099
142 Ga0395901_0054805 3300038443 Bacteria 4145
143 Ga0439436_0002874 3300041404 Bacteria 5229
144 Ga0439436_0013114 3300041404 Bacteria 2509
145 Ga0439438_005823 3300041405 Bacteria 4469
146 Ga0439439_0000210 3300041406 Bacteria 9030
147 Ga0439439_0007810 3300041406 Bacteria 2512
148 Ga0439439_0028912 3300041406 Bacteria 1406
149 Ga0439461_0000735 3300041410 Bacteria 4764
150 Ga0439466_0016408 3300041411 Bacteria 2676
151 Ga0439466_0017136 3300041411 Bacteria 2612
152 Ga0439466_0101583 3300041411 Bacteria 896
153 Ga0439431_0078223 3300041997 Bacteria 889
154 Ga0439433_0000454 3300041999 Bacteria 7545
155 Ga0439433_0001333 3300041999 Bacteria 5078
156 Ga0439433_0002686 3300041999 Bacteria 3782
157 Ga0439442_000210 3300042002 Bacteria 14549
158 Ga0439442_000520 3300042002 Bacteria 8571
159 Ga0439442_001050 3300042002 Bacteria 5563
160 Ga0439442_001087 3300042002 Bacteria 5464
161 Ga0439442_047606 3300042002 Bacteria 904
162 Ga0439432_002241 3300042006 Bacteria 7293
163 Ga0439432_080994 3300042006 Bacteria 983
164 Ga0439449_0001056 3300042007 Bacteria 10862
165 Ga0439449_0002498 3300042007 Bacteria 7190
166 Ga0439449_0020074 3300042007 Bacteria 2504
167 Ga0439449_0232808 3300042007 Bacteria 691
168 Ga0439457_010611 3300042014 Bacteria 2115
169 Ga0439462_0009323 3300042015 Bacteria 2482
170 Ga0439462_0022966 3300042015 Bacteria 1634
171 Ga0450919_000308 3300042121 Bacteria 5786
172 Ga0450920_000561 3300042122 Bacteria 5900
173 Ga0450920_003342 3300042122 Bacteria 2770
174 Ga0450920_006126 3300042122 Bacteria 2154
175 Ga0450907_000065 3300042146 Bacteria 40682
176 Ga0450907_004941 3300042146 Bacteria 2266
177 Ga0450908_001199 3300042184 Bacteria 5016
178 Ga0450909_007045 3300042185 Bacteria 1623
179 Ga0439434_0000100 3300042435 Bacteria 22043
180 Ga0439434_0003973 3300042435 Bacteria 4316
181 Ga0495603_0262900 3300046455 Bacteria 993
182 Ga0495580_0002953 3300046472 Bacteria 14598
183 Ga0495580_0045078 3300046472 Bacteria 3133
184 Ga0495582_0069433 3300046473 Bacteria 1948
185 Ga0495639_0005090 3300046475 Bacteria 5648
186 Ga0495664_0109640 3300046477 Bacteria 1666
187 Ga0495594_0113585 3300046499 Bacteria 1528
188 Ga0495606_0184175 3300046507 Bacteria 1202
189 Ga0495643_0080674 3300046522 Bacteria 1693
190 Ga0495665_0054660 3300046531 Bacteria 2109
191 Ga0495586_0004103 3300046535 Bacteria 7806
192 Ga0495586_0007883 3300046535 Bacteria 5677
193 Ga0495587_0043252 3300046536 Bacteria 2682
194 Ga0495587_0117893 3300046536 Bacteria 1521
195 Ga0495645_0085226 3300046543 Bacteria 2262
196 Ga0495667_0022330 3300046559 Bacteria 4263
197 Ga0495656_0124601 3300046615 Bacteria 1220
198 Ga0495668_0044017 3300046616 Bacteria 2481
199 Ga0495659_0334578 3300046664 Bacteria 645
200 Ga0495588_0005497 3300046674 Bacteria 5643
201 Ga0495588_0016106 3300046674 Bacteria 3608
202 Ga0495588_0132654 3300046674 Bacteria 1314
203 Ga0495670_0035333 3300046691 Bacteria 2491
204 Ga0495670_0106330 3300046691 Bacteria 1449
205 Ga0495670_0538660 3300046691 Bacteria 635
206 Ga0495600_0021040 3300046809 Bacteria 4174
207 Ga0495581_0011540 3300047315 Bacteria 5110
208 Ga0495581_0014339 3300047315 Bacteria 4596
209 Ga0495581_0038824 3300047315 Bacteria 2756
210 Ga0495581_0171841 3300047315 Bacteria 1267
211 Ga0495604_0415539 3300047317 Bacteria 884
212 Ga0495680_0313598 3300047322 Bacteria 1099
213 Ga0495675_0011607 3300047444 Bacteria 5531
214 Ga0495675_0065823 3300047444 Bacteria 2291
215 Ga0495677_0161750 3300047445 Bacteria 864
216 Ga0495593_0090406 3300047673 Bacteria 1577
217 Ga0496100_0064851 3300048903 Bacteria 2418
218 Ga0496100_0340598 3300048903 Bacteria 1130
219 Ga0496101_0240538 3300048904 Bacteria 1408
220 Ga0496101_0393944 3300048904 Bacteria 1090
221 Ga0496101_0829061 3300048904 Bacteria 729
222 Ga0496102_0049476 3300048905 Bacteria 3824
223 Ga0496102_0428375 3300048905 Bacteria 1242
224 Ga0496102_0769376 3300048905 Bacteria 885
225 Ga0496103_0027346 3300048906 Bacteria 3455
226 Ga0496103_0072176 3300048906 Bacteria 2162
227 Ga0496105_0280177 3300048908 Bacteria 1344
228 Ga0496106_0045234 3300048909 Bacteria 3306
229 Ga0496106_0247923 3300048909 Bacteria 1423
230 Ga0496107_0050977 3300048910 Bacteria 2984
231 Ga0496107_0196932 3300048910 Bacteria 1497
232 Ga0496107_0240331 3300048910 Bacteria 1347
233 Ga0496108_0273791 3300048911 Bacteria 1469
234 Ga0496109_0083121 3300048912 Bacteria 2952
235 Ga0496109_0406396 3300048912 Bacteria 1286
236 Ga0496110_0104083 3300048913 Bacteria 2546
237 Ga0496110_0176409 3300048913 Bacteria 1939
238 Ga0496111_0089647 3300048914 Bacteria 2252
239 Ga0496111_0339763 3300048914 Bacteria 1111
240 Ga0496112_0055103 3300048915 Bacteria 3908
241 Ga0496112_0058551 3300048915 Bacteria 3794
242 Ga0496112_0544155 3300048915 Bacteria 1095
243 Ga0496113_0272841 3300048916 Bacteria 1352
244 Ga0496113_0286861 3300048916 Bacteria 1316
245 Ga0496113_1157703 3300048916 Bacteria 605
246 Ga0496114_0169264 3300048917 Bacteria 1903
247 Ga0496115_0273902 3300048918 Bacteria 1386
248 Ga0501032_0001739 3300049569 Bacteria 17222
249 Ga0501032_0023324 3300049569 Bacteria 4278
250 Ga0501034_0000123 3300049571 Bacteria 143688
251 Ga0501036_0187634 3300049572 Bacteria 1740
252 Ga0501037_0000863 3300049573 Bacteria 22612
253 Ga0501037_0001957 3300049573 Bacteria 14880
254 Ga0501038_0046118 3300049574 Bacteria 3779
255 Ga0501038_0088979 3300049574 Bacteria 2591
256 Ga0501038_0231751 3300049574 Bacteria 1469
257 Ga0501038_0308320 3300049574 Bacteria 1241
258 Ga0501039_0010556 3300049575 Bacteria 7039
259 Ga0501039_0017134 3300049575 Bacteria 5556
260 Ga0501039_0850082 3300049575 Bacteria 711
261 Ga0501043_0186768 3300049579 Bacteria 1613
262 Ga0501043_0391755 3300049579 Bacteria 1050
263 Ga0501043_0466844 3300049579 Bacteria 946
264 Ga0501043_0557520 3300049579 Bacteria 850
265 Ga0501279_057423 3300049775 Bacteria 630
266 Ga0501044_0201163 3300049823 Bacteria 1950
267 nmdc:mga00v17_625558_c1 3300050491 Bacteria 693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0850082 Ga0501039_0850082_51_605 159
2 3300025893 Ga0207682_10022229 Ga0207682_100222293 162
3 iso_pu_bacteria 2738543011 2739238310 167
4 iso_pu_bacteria 2889300758 2889302270 167
5 iso_pu_bacteria 2939743619 2939748303 167
6 iso_pu_bacteria 2690315906 2691514390 170
7 iso_pu_bacteria 2775506735 2775655282 170
8 iso_pu_bacteria 2808606357 2808827474 170
9 iso_pu_bacteria 2808606360 2808852840 170
10 iso_pu_bacteria 2808606366 2808878711 170
11 iso_pu_bacteria 2808606370 2808891709 170
12 iso_pu_bacteria 2808606371 2808896839 170
13 iso_pu_bacteria 2811994871 2812320741 170
14 iso_pu_bacteria 2904497146 2904500080 170
15 iso_pu_bacteria 2904776348 2904776407 170
16 iso_pu_bacteria 2910809715 2910813209 170
17 iso_pu_bacteria 2919034639 2919037536 170
18 iso_pu_bacteria 2919059106 2919063290 170
19 iso_pu_bacteria 2919391150 2919391206 170
20 iso_pu_bacteria 2919538618 2919541923 170
21 iso_pu_bacteria 2932426870 2932429024 170
22 iso_pu_bacteria 2939598168 2939598443 170
23 iso_pu_bacteria 2939647034 2939649089 170
24 iso_pu_bacteria 2939674588 2939676283 170
25 iso_pu_bacteria 2945916053 2945918501 170
26 iso_pu_bacteria 2945920336 2945921216 170
27 iso_pu_bacteria 2945941187 2945942622 170
28 iso_pu_bacteria 2945956166 2945959621 170
29 iso_pu_bacteria 2946037020 2946038541 170
30 iso_pu_bacteria 2946059875 2946062359 170
31 iso_pu_bacteria 2953998280 2953999814 170
32 iso_pu_bacteria 8004021418 8004021858 170
33 iso_pu_bacteria 8004025490 8004027686 170
34 iso_pu_bacteria 8054107350 8054107883 170
35 3300006177 Ga0075362_10335470 Ga0075362_103354701 171
36 3300009148 Ga0105243_10004365 Ga0105243_100043657 171
37 3300025935 Ga0207709_10098400 Ga0207709_100984002 171
38 3300046455 Ga0495603_0262900 Ga0495603_0262900_309_833 171
39 iso_pu_bacteria 2974302888 2974306532 171
40 iso_pu_bacteria 2857740372 2857741548 173
41 iso_pu_bacteria 2933418574 2933421232 173
42 3300005288 Ga0065714_10009239 Ga0065714_100092392 174
43 3300005290 Ga0065712_10189573 Ga0065712_101895732 174
44 3300005328 Ga0070676_10013868 Ga0070676_100138682 174
45 3300005331 Ga0070670_100434080 Ga0070670_1004340802 174
46 3300005333 Ga0070677_10016519 Ga0070677_100165193 174
47 3300005335 Ga0070666_10346874 Ga0070666_103468742 174
48 3300005354 Ga0070675_100139025 Ga0070675_1001390253 174
49 3300005355 Ga0070671_100051009 Ga0070671_1000510093 174
50 3300005356 Ga0070674_100106389 Ga0070674_1001063893 174
51 3300005367 Ga0070667_100137806 Ga0070667_1001378062 174
52 3300005456 Ga0070678_100018531 Ga0070678_1000185312 174
53 3300005543 Ga0070672_100023553 Ga0070672_1000235532 174
54 3300006058 Ga0075432_10005921 Ga0075432_100059214 174
55 3300009011 Ga0105251_10013879 Ga0105251_100138794 174
56 3300009036 Ga0105244_10004695 Ga0105244_100046952 174
57 3300009036 Ga0105244_10011687 Ga0105244_100116872 174
58 3300009148 Ga0105243_10155206 Ga0105243_101552062 174
59 3300009176 Ga0105242_10321140 Ga0105242_103211402 174
60 3300009177 Ga0105248_10058233 Ga0105248_100582335 174
61 3300009551 Ga0105238_11887470 Ga0105238_118874701 174
62 3300011119 Ga0105246_10001313 Ga0105246_100013139 174
63 3300011119 Ga0105246_10025131 Ga0105246_100251313 174
64 3300011119 Ga0105246_10055877 Ga0105246_100558773 174
65 3300013102 Ga0157371_10262375 Ga0157371_102623752 174
66 3300013102 Ga0157371_10557519 Ga0157371_105575192 174
67 3300013105 Ga0157369_10367643 Ga0157369_103676432 174
68 3300013105 Ga0157369_11549992 Ga0157369_115499921 174
69 3300013306 Ga0163162_10375794 Ga0163162_103757942 174
70 3300013307 Ga0157372_11709440 Ga0157372_117094401 174
71 3300025254 Ga0209148_1011188 Ga0209148_10111882 174
72 3300025303 Ga0209051_1022187 Ga0209051_10221871 174
73 3300025315 Ga0207697_10002620 Ga0207697_100026203 174
74 3300025315 Ga0207697_10034852 Ga0207697_100348522 174
75 3300025728 Ga0207655_1011356 Ga0207655_10113563 174
76 3300025728 Ga0207655_1056622 Ga0207655_10566222 174
77 3300025735 Ga0207713_1081667 Ga0207713_10816672 174
78 3300025907 Ga0207645_10015972 Ga0207645_100159724 174
79 3300025923 Ga0207681_10021594 Ga0207681_100215944 174
80 3300025925 Ga0207650_10317067 Ga0207650_103170672 174
81 3300025926 Ga0207659_10086520 Ga0207659_100865202 174
82 3300025931 Ga0207644_10121355 Ga0207644_101213552 174
83 3300025934 Ga0207686_10266658 Ga0207686_102666581 174
84 3300025935 Ga0207709_10126454 Ga0207709_101264542 174
85 3300025937 Ga0207669_10020093 Ga0207669_100200932 174
86 3300025940 Ga0207691_10000233 Ga0207691_100002335 174
87 3300025941 Ga0207711_10329720 Ga0207711_103297202 174
88 3300025960 Ga0207651_10284628 Ga0207651_102846282 174
89 3300025986 Ga0207658_10021498 Ga0207658_100214982 174
90 3300026121 Ga0207683_10009097 Ga0207683_100090973 174
91 3300027907 Ga0207428_10000930 Ga0207428_1000093021 174
92 3300027907 Ga0207428_10174250 Ga0207428_101742502 174
93 3300031548 Ga0307408_100010991 Ga0307408_1000109914 174
94 3300031548 Ga0307408_100021303 Ga0307408_1000213035 174
95 3300031548 Ga0307408_100028450 Ga0307408_1000284502 174
96 3300031548 Ga0307408_100047316 Ga0307408_1000473163 174
97 3300031548 Ga0307408_100066511 Ga0307408_1000665112 174
98 3300031548 Ga0307408_100080164 Ga0307408_1000801642 174
99 3300031548 Ga0307408_100160234 Ga0307408_1001602343 174
100 3300031548 Ga0307408_100260462 Ga0307408_1002604622 174
101 3300031548 Ga0307408_100276921 Ga0307408_1002769212 174
102 3300031548 Ga0307408_100290756 Ga0307408_1002907562 174
103 3300031548 Ga0307408_100780474 Ga0307408_1007804742 174
104 3300031731 Ga0307405_10002212 Ga0307405_100022123 174
105 3300031731 Ga0307405_10005056 Ga0307405_100050562 174
106 3300031731 Ga0307405_10012356 Ga0307405_100123562 174
107 3300031731 Ga0307405_10122228 Ga0307405_101222282 174
108 3300031731 Ga0307405_10182164 Ga0307405_101821642 174
109 3300031731 Ga0307405_10456428 Ga0307405_104564282 174
110 3300031731 Ga0307405_10500057 Ga0307405_105000572 174
111 3300031731 Ga0307405_10769770 Ga0307405_107697701 174
112 3300031824 Ga0307413_10038806 Ga0307413_100388063 174
113 3300031824 Ga0307413_10133336 Ga0307413_101333362 174
114 3300031824 Ga0307413_10233523 Ga0307413_102335232 174
115 3300031824 Ga0307413_10266743 Ga0307413_102667432 174
116 3300031824 Ga0307413_10279060 Ga0307413_102790602 174
117 3300031824 Ga0307413_10550932 Ga0307413_105509321 174
118 3300031852 Ga0307410_10018224 Ga0307410_100182243 174
119 3300031852 Ga0307410_10201246 Ga0307410_102012462 174
120 3300031852 Ga0307410_10255759 Ga0307410_102557592 174
121 3300031852 Ga0307410_10376844 Ga0307410_103768442 174
122 3300031852 Ga0307410_10389380 Ga0307410_103893802 174
123 3300031852 Ga0307410_10484443 Ga0307410_104844432 174
124 3300031852 Ga0307410_10633082 Ga0307410_106330822 174
125 3300031852 Ga0307410_10673479 Ga0307410_106734791 174
126 3300031901 Ga0307406_10055089 Ga0307406_100550892 174
127 3300031901 Ga0307406_10247042 Ga0307406_102470422 174
128 3300031901 Ga0307406_11423242 Ga0307406_114232421 174
129 3300031903 Ga0307407_10029763 Ga0307407_100297632 174
130 3300031903 Ga0307407_10079077 Ga0307407_100790772 174
131 3300031903 Ga0307407_10264655 Ga0307407_102646551 174
132 3300031903 Ga0307407_10533642 Ga0307407_105336422 174
133 3300031911 Ga0307412_10007885 Ga0307412_100078853 174
134 3300031911 Ga0307412_10009780 Ga0307412_100097803 174
135 3300031911 Ga0307412_10034535 Ga0307412_100345352 174
136 3300031911 Ga0307412_10040812 Ga0307412_100408123 174
137 3300031911 Ga0307412_10047692 Ga0307412_100476923 174
138 3300031911 Ga0307412_10079888 Ga0307412_100798882 174
139 3300031911 Ga0307412_10151362 Ga0307412_101513622 174
140 3300031911 Ga0307412_10152075 Ga0307412_101520751 174
141 3300031911 Ga0307412_10205580 Ga0307412_102055802 174
142 3300031911 Ga0307412_10239058 Ga0307412_102390582 174
143 3300031911 Ga0307412_10826134 Ga0307412_108261341 174
144 3300031995 Ga0307409_100015438 Ga0307409_1000154383 174
145 3300031995 Ga0307409_100065335 Ga0307409_1000653352 174
146 3300032002 Ga0307416_100051905 Ga0307416_1000519053 174
147 3300032002 Ga0307416_100110309 Ga0307416_1001103093 174
148 3300032002 Ga0307416_100226590 Ga0307416_1002265901 174
149 3300032002 Ga0307416_100253583 Ga0307416_1002535832 174
150 3300032002 Ga0307416_100259617 Ga0307416_1002596172 174
151 3300032002 Ga0307416_100401957 Ga0307416_1004019572 174
152 3300032002 Ga0307416_100661763 Ga0307416_1006617632 174
153 3300032002 Ga0307416_100842748 Ga0307416_1008427482 174
154 3300032004 Ga0307414_10148477 Ga0307414_101484772 174
155 3300032004 Ga0307414_10152911 Ga0307414_101529112 174
156 3300032004 Ga0307414_10680171 Ga0307414_106801711 174
157 3300032126 Ga0307415_100314148 Ga0307415_1003141482 174
158 3300032126 Ga0307415_100392824 Ga0307415_1003928242 174
159 3300037312 Ga0395899_0035658 Ga0395899_0035658_2179_2727 174
160 3300037312 Ga0395899_0078169 Ga0395899_0078169_1422_1967 174
161 3300037312 Ga0395899_0116946 Ga0395899_0116946_795_1331 174
162 3300037312 Ga0395899_0125543 Ga0395899_0125543_161_712 174
163 3300037418 Ga0395900_0031105 Ga0395900_0031105_2177_2713 174
164 3300037418 Ga0395900_0043297 Ga0395900_0043297_2713_3261 174
165 3300037418 Ga0395900_0071504 Ga0395900_0071504_2751_3305 174
166 3300037418 Ga0395900_0274963 Ga0395900_0274963_529_1074 174
167 3300037466 Ga0395898_0041184 Ga0395898_0041184_610_1158 174
168 3300037466 Ga0395898_0057219 Ga0395898_0057219_2692_3228 174
169 3300037466 Ga0395898_0110862 Ga0395898_0110862_834_1379 174
170 3300038443 Ga0395901_0021029 Ga0395901_0021029_362_898 174
171 3300038443 Ga0395901_0025258 Ga0395901_0025258_2663_3211 174
172 3300038443 Ga0395901_0054805 Ga0395901_0054805_230_784 174
173 3300041404 Ga0439436_0002874 Ga0439436_0002874_1224_1769 174
174 3300041404 Ga0439436_0013114 Ga0439436_0013114_1001_1540 174
175 3300041405 Ga0439438_005823 Ga0439438_005823_1416_1976 174
176 3300041406 Ga0439439_0000210 Ga0439439_0000210_6474_7034 174
177 3300041406 Ga0439439_0007810 Ga0439439_0007810_1788_2327 174
178 3300041406 Ga0439439_0028912 Ga0439439_0028912_103_648 174
179 3300041410 Ga0439461_0000735 Ga0439461_0000735_3032_3592 174
180 3300041411 Ga0439466_0016408 Ga0439466_0016408_1680_2240 174
181 3300041411 Ga0439466_0017136 Ga0439466_0017136_667_1212 174
182 3300041411 Ga0439466_0101583 Ga0439466_0101583_35_595 174
183 3300041997 Ga0439431_0078223 Ga0439431_0078223_244_783 174
184 3300041999 Ga0439433_0000454 Ga0439433_0000454_4729_5274 174
185 3300041999 Ga0439433_0001333 Ga0439433_0001333_2558_3118 174
186 3300041999 Ga0439433_0002686 Ga0439433_0002686_1967_2506 174
187 3300042002 Ga0439442_000210 Ga0439442_000210_2387_2926 174
188 3300042002 Ga0439442_000520 Ga0439442_000520_1713_2258 174
189 3300042002 Ga0439442_001050 Ga0439442_001050_3698_4243 174
190 3300042002 Ga0439442_001087 Ga0439442_001087_538_1098 174
191 3300042002 Ga0439442_047606 Ga0439442_047606_150_689 174
192 3300042006 Ga0439432_002241 Ga0439432_002241_4565_5125 174
193 3300042006 Ga0439432_080994 Ga0439432_080994_147_698 174
194 3300042007 Ga0439449_0001056 Ga0439449_0001056_9847_10392 174
195 3300042007 Ga0439449_0002498 Ga0439449_0002498_310_861 174
196 3300042007 Ga0439449_0020074 Ga0439449_0020074_398_937 174
197 3300042007 Ga0439449_0232808 Ga0439449_0232808_38_598 174
198 3300042014 Ga0439457_010611 Ga0439457_010611_780_1319 174
199 3300042015 Ga0439462_0009323 Ga0439462_0009323_581_1141 174
200 3300042015 Ga0439462_0022966 Ga0439462_0022966_588_1133 174
201 3300042121 Ga0450919_000308 Ga0450919_000308_1805_2365 174
202 3300042122 Ga0450920_000561 Ga0450920_000561_3514_4053 174
203 3300042122 Ga0450920_003342 Ga0450920_003342_1455_1994 174
204 3300042122 Ga0450920_006126 Ga0450920_006126_1157_1717 174
205 3300042146 Ga0450907_000065 Ga0450907_000065_14551_15090 174
206 3300042146 Ga0450907_004941 Ga0450907_004941_1098_1658 174
207 3300042184 Ga0450908_001199 Ga0450908_001199_2332_2892 174
208 3300042185 Ga0450909_007045 Ga0450909_007045_608_1168 174
209 3300042435 Ga0439434_0000100 Ga0439434_0000100_1611_2150 174
210 3300042435 Ga0439434_0003973 Ga0439434_0003973_3605_4165 174
211 3300046472 Ga0495580_0045078 Ga0495580_0045078_977_1513 174
212 3300046473 Ga0495582_0069433 Ga0495582_0069433_372_908 174
213 3300046475 Ga0495639_0005090 Ga0495639_0005090_1009_1545 174
214 3300046477 Ga0495664_0109640 Ga0495664_0109640_1035_1571 174
215 3300046499 Ga0495594_0113585 Ga0495594_0113585_962_1498 174
216 3300046507 Ga0495606_0184175 Ga0495606_0184175_585_1121 174
217 3300046522 Ga0495643_0080674 Ga0495643_0080674_43_579 174
218 3300046531 Ga0495665_0054660 Ga0495665_0054660_771_1307 174
219 3300046535 Ga0495586_0004103 Ga0495586_0004103_2420_2956 174
220 3300046535 Ga0495586_0007883 Ga0495586_0007883_2172_2708 174
221 3300046536 Ga0495587_0043252 Ga0495587_0043252_110_646 174
222 3300046536 Ga0495587_0117893 Ga0495587_0117893_419_955 174
223 3300046559 Ga0495667_0022330 Ga0495667_0022330_2995_3531 174
224 3300046615 Ga0495656_0124601 Ga0495656_0124601_54_590 174
225 3300046616 Ga0495668_0044017 Ga0495668_0044017_340_876 174
226 3300046664 Ga0495659_0334578 Ga0495659_0334578_54_590 174
227 3300046674 Ga0495588_0005497 Ga0495588_0005497_2616_3152 174
228 3300046674 Ga0495588_0016106 Ga0495588_0016106_1284_1820 174
229 3300046674 Ga0495588_0132654 Ga0495588_0132654_744_1280 174
230 3300046691 Ga0495670_0035333 Ga0495670_0035333_1675_2211 174
231 3300046691 Ga0495670_0106330 Ga0495670_0106330_70_606 174
232 3300046691 Ga0495670_0538660 Ga0495670_0538660_72_608 174
233 3300046809 Ga0495600_0021040 Ga0495600_0021040_476_1012 174
234 3300047315 Ga0495581_0011540 Ga0495581_0011540_2269_2805 174
235 3300047315 Ga0495581_0014339 Ga0495581_0014339_37_573 174
236 3300047315 Ga0495581_0038824 Ga0495581_0038824_1665_2201 174
237 3300047315 Ga0495581_0171841 Ga0495581_0171841_636_1172 174
238 3300047317 Ga0495604_0415539 Ga0495604_0415539_249_785 174
239 3300047322 Ga0495680_0313598 Ga0495680_0313598_489_1025 174
240 3300047444 Ga0495675_0011607 Ga0495675_0011607_3129_3665 174
241 3300047444 Ga0495675_0065823 Ga0495675_0065823_583_1119 174
242 3300047445 Ga0495677_0161750 Ga0495677_0161750_230_766 174
243 3300047673 Ga0495593_0090406 Ga0495593_0090406_189_725 174
244 3300048903 Ga0496100_0064851 Ga0496100_0064851_932_1468 174
245 3300048903 Ga0496100_0340598 Ga0496100_0340598_431_967 174
246 3300048904 Ga0496101_0240538 Ga0496101_0240538_442_978 174
247 3300048904 Ga0496101_0393944 Ga0496101_0393944_116_661 174
248 3300048904 Ga0496101_0829061 Ga0496101_0829061_18_569 174
249 3300048905 Ga0496102_0049476 Ga0496102_0049476_23_574 174
250 3300048905 Ga0496102_0428375 Ga0496102_0428375_663_1199 174
251 3300048905 Ga0496102_0769376 Ga0496102_0769376_81_617 174
252 3300048906 Ga0496103_0027346 Ga0496103_0027346_2223_2759 174
253 3300048906 Ga0496103_0072176 Ga0496103_0072176_758_1309 174
254 3300048908 Ga0496105_0280177 Ga0496105_0280177_720_1256 174
255 3300048909 Ga0496106_0045234 Ga0496106_0045234_707_1243 174
256 3300048909 Ga0496106_0247923 Ga0496106_0247923_318_854 174
257 3300048910 Ga0496107_0050977 Ga0496107_0050977_423_959 174
258 3300048910 Ga0496107_0196932 Ga0496107_0196932_656_1207 174
259 3300048910 Ga0496107_0240331 Ga0496107_0240331_373_909 174
260 3300048911 Ga0496108_0273791 Ga0496108_0273791_213_749 174
261 3300048912 Ga0496109_0083121 Ga0496109_0083121_1990_2526 174
262 3300048912 Ga0496109_0406396 Ga0496109_0406396_665_1201 174
263 3300048913 Ga0496110_0104083 Ga0496110_0104083_64_600 174
264 3300048913 Ga0496110_0176409 Ga0496110_0176409_784_1320 174
265 3300048914 Ga0496111_0089647 Ga0496111_0089647_673_1209 174
266 3300048914 Ga0496111_0339763 Ga0496111_0339763_273_809 174
267 3300048915 Ga0496112_0055103 Ga0496112_0055103_621_1157 174
268 3300048915 Ga0496112_0544155 Ga0496112_0544155_360_908 174
269 3300048916 Ga0496113_0272841 Ga0496113_0272841_199_735 174
270 3300048916 Ga0496113_0286861 Ga0496113_0286861_533_1069 174
271 3300048916 Ga0496113_1157703 Ga0496113_1157703_45_590 174
272 3300048917 Ga0496114_0169264 Ga0496114_0169264_379_915 174
273 3300048918 Ga0496115_0273902 Ga0496115_0273902_50_586 174
274 3300049569 Ga0501032_0001739 Ga0501032_0001739_84_620 174
275 3300049571 Ga0501034_0000123 Ga0501034_0000123_45867_46403 174
276 3300049573 Ga0501037_0001957 Ga0501037_0001957_7735_8271 174
277 3300049574 Ga0501038_0088979 Ga0501038_0088979_1202_1759 174
278 3300049574 Ga0501038_0308320 Ga0501038_0308320_308_859 174
279 3300049579 Ga0501043_0186768 Ga0501043_0186768_13_549 174
280 3300049579 Ga0501043_0466844 Ga0501043_0466844_169_720 174
281 3300049775 Ga0501279_057423 Ga0501279_057423_48_596 174
282 3300050491 nmdc:mga00v17_625558_c1 nmdc:mga00v17_625558_c1_80_625 174
283 3300031824 Ga0307413_10118949 Ga0307413_101189492 175
284 3300049569 Ga0501032_0023324 Ga0501032_0023324_1337_1891 175
285 3300049572 Ga0501036_0187634 Ga0501036_0187634_414_968 175
286 3300049573 Ga0501037_0000863 Ga0501037_0000863_5384_5938 175
287 3300049574 Ga0501038_0046118 Ga0501038_0046118_44_598 175
288 3300049574 Ga0501038_0231751 Ga0501038_0231751_294_848 175
289 3300049575 Ga0501039_0010556 Ga0501039_0010556_1298_1852 175
290 3300049575 Ga0501039_0017134 Ga0501039_0017134_753_1307 175
291 3300049579 Ga0501043_0391755 Ga0501043_0391755_82_636 175
292 3300049579 Ga0501043_0557520 Ga0501043_0557520_215_769 175
293 3300049823 Ga0501044_0201163 Ga0501044_0201163_1373_1927 175
294 iso_pu_bacteria 2946024296 2946026210 175
295 3300025256 Ga0209759_1018905 Ga0209759_10189051 176
296 3300046472 Ga0495580_0002953 Ga0495580_0002953_10921_11478 176
297 3300046543 Ga0495645_0085226 Ga0495645_0085226_1359_1922 176
298 3300048915 Ga0496112_0058551 Ga0496112_0058551_3006_3569 176
299 3300031548 Ga0307408_100681877 Ga0307408_1006818772 177
300 3300031852 Ga0307410_10053691 Ga0307410_100536912 177
301 3300031901 Ga0307406_11165984 Ga0307406_111659842 177
302 3300031995 Ga0307409_100136169 Ga0307409_1001361692 177
303 3300003322 rootL2_10050208 rootL2_100502083 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

1

133

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7831 4 178
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7735 4 179
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7641 4 178
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7585 4 179
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.7378 4 80
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9495 2 88 3.30.70.1280
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9289 2 88 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9036 6 89 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.876 4 88 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.839 4 88 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A0B2AA88-F1-model_v4 Pyridoxamine 5-phosphate oxidase 0.9449 5 178
AF-A0A3Q9WFT6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.935 4 179
AF-A0A2S5XZM9-F1-model_v4 Pyridoxamine 5-phosphate oxidase 0.9262 5 176
AF-A0A4U2ZYR9-F1-model_v4 deleted 0.9248 6 88
AF-A0A6N0YG07-F1-model_v4 deleted 0.9243 6 77

Feature Viewer

pLDDT pTM Quality
88.54 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map