F396868

General Info

Members Datasets Scaffolds Average Seq Length
303 165 606 211

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100031461|Ga0070713_1000314612
Length 228
Sequence LRALAPEEIPLQPSTTNPQVKGAQPARPSLRLGVLLSGRGSNFLAIAESIRSGKLQGVEISIVLSNVADAPGIAAARDLNLPTAVFVSKGRPRAEHDADLIACLHDYKVDVVILAGYMRLLSPQFIAAFPNRILNIHPSLLPAFPGLDAQQQAFDYGVKVAGCTVHFVDERLDHGAIILQRTIAVLDTDDAHSLADRILAEEHIAYTEAIARIASGEYEIRGRRYLKR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0
Rhizoplane 0.66
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100031461 3300005436 Bacteria 4227
2 JGI24743J22301_10010254 3300001991 Unclassified 1670
3 Ga0070658_10049177 3300005327 Bacteria 3415
4 Ga0070658_10083245 3300005327 Bacteria 2630
5 Ga0070683_100000210 3300005329 Bacteria 39660
6 Ga0070683_100080474 3300005329 Bacteria 3050
7 Ga0070683_100100766 3300005329 Bacteria 2719
8 Ga0070683_100496444 3300005329 Bacteria 1166
9 Ga0070670_100002071 3300005331 Bacteria 16420
10 Ga0068869_100000308 3300005334 Bacteria 26106
11 Ga0068868_100000046 3300005338 Bacteria 68441
12 Ga0068868_100004012 3300005338 Bacteria 10279
13 Ga0068868_100026074 3300005338 Bacteria 4451
14 Ga0070661_100003076 3300005344 Bacteria 11480
15 Ga0070661_100016135 3300005344 Bacteria 5272
16 Ga0070669_100595766 3300005353 Bacteria 926
17 Ga0070671_100006477 3300005355 Bacteria 9362
18 Ga0070671_100093079 3300005355 Bacteria 2526
19 Ga0070667_100000728 3300005367 Bacteria 31585
20 Ga0070714_100103814 3300005435 Unclassified 2508
21 Ga0070714_100302534 3300005435 Bacteria 1491
22 Ga0070714_100477309 3300005435 Bacteria 1187
23 Ga0070694_100410249 3300005444 Unclassified 1062
24 Ga0070678_100021520 3300005456 Bacteria 4254
25 Ga0070681_10192366 3300005458 Bacteria 1960
26 Ga0070684_100003273 3300005535 Bacteria 12129
27 Ga0070684_100050250 3300005535 Bacteria 3621
28 Ga0070684_100052183 3300005535 Bacteria 3555
29 Ga0068853_100005792 3300005539 Bacteria 9734
30 Ga0068853_100090096 3300005539 Bacteria 2695
31 Ga0070665_100029723 3300005548 Bacteria 5499
32 Ga0070665_100410876 3300005548 Unclassified 1362
33 Ga0068855_100000368 3300005563 Bacteria 55842
34 Ga0068855_100111154 3300005563 Bacteria 3145
35 Ga0068855_100127460 3300005563 Bacteria 2909
36 Ga0068855_100513116 3300005563 Bacteria 1301
37 Ga0068857_100000448 3300005577 Bacteria 29339
38 Ga0068854_100065013 3300005578 Unclassified 2651
39 Ga0068856_100010522 3300005614 Bacteria 8982
40 Ga0068856_100018092 3300005614 Bacteria 6832
41 Ga0068856_100026104 3300005614 Bacteria 5696
42 Ga0068856_100070621 3300005614 Bacteria 3455
43 Ga0068856_100243002 3300005614 Bacteria 1815
44 Ga0068856_100501401 3300005614 Bacteria 1235
45 Ga0068852_100000063 3300005616 Bacteria 72990
46 Ga0068852_100002149 3300005616 Bacteria 13529
47 Ga0068852_100027886 3300005616 Bacteria 4610
48 Ga0068852_100305163 3300005616 Bacteria 1542
49 Ga0068852_100526206 3300005616 Bacteria 1180
50 Ga0068859_100013491 3300005617 Bacteria 8194
51 Ga0068864_100017062 3300005618 Bacteria 6052
52 Ga0068861_100585287 3300005719 Bacteria 1022
53 Ga0068863_100022882 3300005841 Bacteria 5972
54 Ga0068863_100039577 3300005841 Bacteria 4485
55 Ga0068858_100077877 3300005842 Unclassified 3080
56 Ga0068860_100001032 3300005843 Bacteria 30687
57 Ga0068862_100049901 3300005844 Unclassified 3575
58 Ga0081540_1007130 3300005983 Bacteria 8019
59 Ga0081539_10222868 3300005985 Bacteria 856
60 Ga0070717_10007402 3300006028 Bacteria 8151
61 Ga0075368_10157443 3300006042 Bacteria 950
62 Ga0075363_100113332 3300006048 Bacteria 1509
63 Ga0075364_10163404 3300006051 Bacteria 1503
64 Ga0075367_10018447 3300006178 Bacteria 3850
65 Ga0075366_10004749 3300006195 Bacteria 7322
66 Ga0075366_10038604 3300006195 Bacteria 2821
67 Ga0075366_10177580 3300006195 Bacteria 1293
68 Ga0075366_10265017 3300006195 Bacteria 1049
69 Ga0097621_100006730 3300006237 Bacteria 8166
70 Ga0097621_100122260 3300006237 Bacteria 2209
71 Ga0075370_10012117 3300006353 Bacteria 4549
72 Ga0068871_100005075 3300006358 Bacteria 9197
73 Ga0097620_100013490 3300006931 Bacteria 8194
74 Ga0097620_100347026 3300006931 Bacteria 1579
75 Ga0105240_10000187 3300009093 Bacteria 126042
76 Ga0105240_10000663 3300009093 Bacteria 63262
77 Ga0105240_10019106 3300009093 Bacteria 9162
78 Ga0105240_10019935 3300009093 Bacteria 8955
79 Ga0105240_10102912 3300009093 Bacteria 3470
80 Ga0105240_10139614 3300009093 Bacteria 2898
81 Ga0105245_10002815 3300009098 Bacteria 15638
82 Ga0105245_10169435 3300009098 Bacteria 2079
83 Ga0105247_10004217 3300009101 Bacteria 9218
84 Ga0105241_10003217 3300009174 Bacteria 12153
85 Ga0105241_10005170 3300009174 Bacteria 9627
86 Ga0105241_10143679 3300009174 Bacteria 1946
87 Ga0105248_10010289 3300009177 Bacteria 10297
88 Ga0105248_10102587 3300009177 Bacteria 3224
89 Ga0105237_10007213 3300009545 Bacteria 12201
90 Ga0105237_10314581 3300009545 Bacteria 1569
91 Ga0105237_10361562 3300009545 Bacteria 1456
92 Ga0105237_10487092 3300009545 Bacteria 1239
93 Ga0105237_10818810 3300009545 Bacteria 938
94 Ga0105238_10000657 3300009551 Bacteria 36213
95 Ga0105238_10005713 3300009551 Bacteria 12294
96 Ga0105238_10006697 3300009551 Bacteria 11494
97 Ga0105238_10014670 3300009551 Bacteria 7923
98 Ga0105238_10257738 3300009551 Bacteria 1723
99 Ga0105238_10416048 3300009551 Bacteria 1338
100 Ga0105238_10564694 3300009551 Bacteria 1143
101 Ga0105249_10025755 3300009553 Bacteria 5297
102 Ga0105239_10010212 3300010375 Bacteria 10519
103 Ga0105239_10015201 3300010375 Bacteria 8531
104 Ga0105239_10017866 3300010375 Bacteria 7844
105 Ga0105239_10135423 3300010375 Bacteria 2742
106 Ga0105246_10037370 3300011119 Bacteria 3259
107 Ga0157373_10149907 3300013100 Bacteria 1640
108 Ga0157370_10000066 3300013104 Bacteria 113884
109 Ga0157370_10049045 3300013104 Bacteria 4043
110 Ga0157369_10000188 3300013105 Bacteria 85789
111 Ga0157369_10015595 3300013105 Bacteria 8564
112 Ga0157369_10031690 3300013105 Bacteria 5818
113 Ga0157369_10032561 3300013105 Bacteria 5732
114 Ga0157369_10050281 3300013105 Bacteria 4515
115 Ga0157369_10777495 3300013105 Bacteria 984
116 Ga0157374_10005560 3300013296 Bacteria 10612
117 Ga0157374_10008655 3300013296 Bacteria 8709
118 Ga0157374_10036420 3300013296 Bacteria 4507
119 Ga0157378_10013370 3300013297 Bacteria 7173
120 Ga0157378_10311607 3300013297 Bacteria 1526
121 Ga0163162_10032004 3300013306 Bacteria 5221
122 Ga0157372_10000114 3300013307 Bacteria 85156
123 Ga0157372_10021218 3300013307 Bacteria 7017
124 Ga0157372_10044476 3300013307 Bacteria 4921
125 Ga0157372_10048639 3300013307 Bacteria 4713
126 Ga0157372_10059882 3300013307 Bacteria 4261
127 Ga0157372_10084136 3300013307 Bacteria 3605
128 Ga0157372_10116880 3300013307 Bacteria 3058
129 Ga0157375_10046557 3300013308 Bacteria 4230
130 Ga0163163_10009625 3300014325 Bacteria 8641
131 Ga0157379_10005193 3300014968 Bacteria 11186
132 Ga0157379_10381839 3300014968 Bacteria 1293
133 Ga0157376_10000173 3300014969 Bacteria 44682
134 Ga0157376_10173061 3300014969 Bacteria 1968
135 Ga0213872_10004039 3300021361 Bacteria 7915
136 Ga0213872_10016026 3300021361 Bacteria 3481
137 Ga0209233_1002973 3300025261 Bacteria 6040
138 Ga0207656_10023355 3300025321 Bacteria 2489
139 Ga0207656_10077104 3300025321 Bacteria 1492
140 Ga0207710_10002782 3300025900 Bacteria 7993
141 Ga0207705_10037862 3300025909 Bacteria 3451
142 Ga0207705_10105281 3300025909 Bacteria 2079
143 Ga0207654_10005127 3300025911 Bacteria 6612
144 Ga0207654_10028592 3300025911 Bacteria 3040
145 Ga0207654_10034343 3300025911 Bacteria 2817
146 Ga0207654_10090547 3300025911 Bacteria 1864
147 Ga0207707_10253919 3300025912 Bacteria 1527
148 Ga0207695_10000052 3300025913 Bacteria 398089
149 Ga0207695_10000253 3300025913 Bacteria 139044
150 Ga0207695_10001120 3300025913 Bacteria 46589
151 Ga0207695_10013281 3300025913 Bacteria 9824
152 Ga0207695_10109810 3300025913 Bacteria 2739
153 Ga0207695_10302759 3300025913 Bacteria 1490
154 Ga0207671_10000081 3300025914 Bacteria 148476
155 Ga0207671_10005934 3300025914 Bacteria 11073
156 Ga0207671_10098279 3300025914 Bacteria 2214
157 Ga0207671_10330859 3300025914 Bacteria 1206
158 Ga0207693_10605131 3300025915 Bacteria 853
159 Ga0207663_10291079 3300025916 Unclassified 1217
160 Ga0207649_10002341 3300025920 Bacteria 10624
161 Ga0207649_10505298 3300025920 Bacteria 920
162 Ga0207694_10000108 3300025924 Bacteria 87457
163 Ga0207694_10006127 3300025924 Bacteria 9190
164 Ga0207694_10054980 3300025924 Bacteria 3090
165 Ga0207694_10294085 3300025924 Bacteria 1336
166 Ga0207650_10001335 3300025925 Bacteria 17846
167 Ga0207659_10571308 3300025926 Bacteria 962
168 Ga0207687_10076395 3300025927 Bacteria 2406
169 Ga0207664_10047053 3300025929 Bacteria 3387
170 Ga0207664_10143410 3300025929 Bacteria 2023
171 Ga0207644_10002796 3300025931 Bacteria 11244
172 Ga0207711_10004803 3300025941 Bacteria 11473
173 Ga0207711_10016153 3300025941 Bacteria 6197
174 Ga0207689_10019346 3300025942 Bacteria 5739
175 Ga0207661_10002024 3300025944 Bacteria 13979
176 Ga0207661_10022132 3300025944 Bacteria 4780
177 Ga0207661_10077602 3300025944 Bacteria 2732
178 Ga0207661_10317730 3300025944 Bacteria 1399
179 Ga0207667_10001441 3300025949 Bacteria 29818
180 Ga0207667_10096050 3300025949 Bacteria 3059
181 Ga0207667_10152503 3300025949 Bacteria 2378
182 Ga0207640_10373890 3300025981 Bacteria 1153
183 Ga0207658_10000416 3300025986 Bacteria 40419
184 Ga0207677_10000025 3300026023 Bacteria 127400
185 Ga0207677_10019800 3300026023 Bacteria 4073
186 Ga0207677_10061465 3300026023 Bacteria 2601
187 Ga0207703_10048591 3300026035 Bacteria 3426
188 Ga0207639_10000055 3300026041 Bacteria 110260
189 Ga0207639_10004182 3300026041 Bacteria 9720
190 Ga0207639_10148685 3300026041 Bacteria 1960
191 Ga0207678_10648468 3300026067 Bacteria 927
192 Ga0207702_10010722 3300026078 Bacteria 7656
193 Ga0207702_10033198 3300026078 Bacteria 4310
194 Ga0207702_10095169 3300026078 Bacteria 2616
195 Ga0207702_10357751 3300026078 Bacteria 1398
196 Ga0207641_10010405 3300026088 Bacteria 7644
197 Ga0207641_10043335 3300026088 Bacteria 3779
198 Ga0207676_10002620 3300026095 Bacteria 12828
199 Ga0207674_10000459 3300026116 Bacteria 53315
200 Ga0207698_10000007 3300026142 Bacteria 289457
201 Ga0207698_10057863 3300026142 Unclassified 3001
202 Ga0207698_10160192 3300026142 Bacteria 1967
203 Ga0207698_10275900 3300026142 Bacteria 1552
204 Ga0209971_1022446 3300027682 Unclassified 1503
205 Ga0209813_10018096 3300027866 Bacteria 1943
206 Ga0209813_10149331 3300027866 Bacteria 836
207 Ga0268266_10120396 3300028379 Bacteria 2335
208 Ga0268266_10220982 3300028379 Bacteria 1741
209 Ga0268265_10022751 3300028380 Bacteria 4408
210 Ga0268265_10037600 3300028380 Unclassified 3554
211 Ga0268264_10000920 3300028381 Bacteria 30745
212 Ga0265338_10003779 3300028800 Bacteria 21040
213 Ga0265338_10004819 3300028800 Bacteria 18037
214 Ga0265338_10012773 3300028800 Bacteria 9552
215 Ga0265338_10023642 3300028800 Bacteria 6308
216 Ga0265324_10048632 3300029957 Bacteria 1458
217 Ga0265330_10000852 3300031235 Bacteria 19100
218 Ga0265330_10034177 3300031235 Bacteria 2272
219 Ga0265330_10097644 3300031235 Bacteria 1259
220 Ga0265330_10107039 3300031235 Bacteria 1196
221 Ga0265332_10134985 3300031238 Bacteria 1035
222 Ga0265328_10022239 3300031239 Bacteria 2415
223 Ga0265328_10036439 3300031239 Bacteria 1817
224 Ga0265320_10018906 3300031240 Bacteria 3780
225 Ga0265320_10037191 3300031240 Bacteria 2453
226 Ga0265325_10002033 3300031241 Bacteria 13905
227 Ga0265325_10180398 3300031241 Bacteria 983
228 Ga0265329_10007122 3300031242 Bacteria 4355
229 Ga0265340_10022322 3300031247 Bacteria 3237
230 Ga0265339_10000204 3300031249 Bacteria 48602
231 Ga0265339_10004335 3300031249 Bacteria 9688
232 Ga0265339_10062959 3300031249 Unclassified 1993
233 Ga0265316_10002998 3300031344 Bacteria 17267
234 Ga0265316_10015825 3300031344 Bacteria 6571
235 Ga0307408_100068249 3300031548 Bacteria 2618
236 Ga0265313_10001614 3300031595 Bacteria 20940
237 Ga0265314_10000139 3300031711 Bacteria 108861
238 Ga0265314_10002635 3300031711 Bacteria 18083
239 Ga0265314_10038367 3300031711 Bacteria 3461
240 Ga0265314_10119539 3300031711 Bacteria 1661
241 Ga0265342_10002378 3300031712 Bacteria 16291
242 Ga0265342_10051757 3300031712 Bacteria 2449
243 Ga0265342_10155435 3300031712 Bacteria 1267
244 Ga0373957_0008243 3300035120 Bacteria 3368
245 Ga0373937_0002195 3300036401 Bacteria 16312
246 Ga0373937_1014187 3300036401 Bacteria 779
247 Ga0395900_0006353 3300037418 Bacteria 12320
248 Ga0395898_0198590 3300037466 Bacteria 1916
249 Ga0395905_0050322 3300037471 Bacteria 3904
250 Ga0395905_0238056 3300037471 Bacteria 1701
251 Ga0395905_0878186 3300037471 Bacteria 800
252 Ga0436360_0155361 3300039438 Bacteria 2125
253 Ga0436360_0871702 3300039438 Bacteria 3634
254 Ga0436360_1349001 3300039438 Bacteria 1240
255 Ga0436361_0224417 3300039447 Bacteria 20492
256 Ga0436361_0839710 3300039447 Bacteria 5631
257 Ga0436361_0864637 3300039447 Bacteria 1509
258 Ga0439464_0114843 3300042439 Bacteria 826
259 Ga0453683_0204344 3300044673 Bacteria 1254
260 Ga0466961_0019838 3300044693 Bacteria 4326
261 Ga0466963_0007458 3300044694 Bacteria 6523
262 Ga0451576_0544360 3300045051 Bacteria 1220
263 Ga0495617_048530 3300046452 Bacteria 1413
264 Ga0495629_0030811 3300046459 Bacteria 3800
265 Ga0495629_0412919 3300046459 Unclassified 916
266 Ga0495651_0153917 3300046462 Bacteria 1654
267 Ga0495580_0170027 3300046472 Unclassified 1507
268 Ga0495582_0138429 3300046473 Bacteria 1379
269 Ga0495639_0056227 3300046475 Bacteria 1796
270 Ga0495662_0092272 3300046476 Bacteria 1477
271 Ga0495583_0071553 3300046506 Bacteria 1523
272 Ga0495652_0021671 3300046529 Bacteria 5711
273 Ga0495665_0037854 3300046531 Bacteria 2573
274 Ga0495640_0224742 3300046533 Bacteria 1183
275 Ga0495587_0004453 3300046536 Bacteria 9230
276 Ga0495645_0001171 3300046543 Bacteria 17849
277 Ga0495667_0100457 3300046559 Bacteria 1872
278 Ga0495625_0004435 3300046660 Bacteria 13281
279 Ga0495623_0176350 3300046679 Unclassified 1245
280 Ga0495646_0199298 3300046680 Unclassified 1091
281 Ga0495669_0017980 3300046684 Unclassified 3036
282 Ga0495613_0015595 3300046689 Bacteria 5653
283 Ga0495613_0047756 3300046689 Bacteria 3162
284 Ga0495600_0015924 3300046809 Bacteria 4764
285 Ga0495604_0266359 3300047317 Bacteria 1163
286 Ga0495675_0335215 3300047444 Unclassified 892
287 Ga0495679_036531 3300047446 Bacteria 1551
288 Ga0495684_0016800 3300047471 Bacteria 5639
289 Ga0495602_0492135 3300048088 Bacteria 859
290 Ga0496109_0585166 3300048912 Unclassified 1052
291 Ga0496114_0376711 3300048917 Bacteria 1256
292 Ga0496126_0305971 3300048929 Bacteria 1310
293 Ga0495682_0024432 3300049460 Bacteria 2253
294 nmdc:mga03683_128875_c1 3300050489 Bacteria 1130
295 nmdc:mga03n38_129424_c1 3300050490 Bacteria 1249
296 nmdc:mga03n38_64623_c1 3300050490 Bacteria 1675
297 nmdc:mga0k408_10498_c1 3300050493 Bacteria 5010
298 nmdc:mga0k408_5582_c1 3300050493 Bacteria 6692
299 nmdc:mga06z11_29867_c1 3300050494 Bacteria 2631
300 nmdc:mga04h51_127769_c1 3300050495 Bacteria 953
301 nmdc:mga07m45_1997_c1 3300050496 Bacteria 9450
302 Ga0495601_0009859 3300053077 Bacteria 5656
303 Ga0500595_000423 3300053119 Bacteria 26615
304 Ga0070713_100031461
305 JGI24743J22301_10010254
306 Ga0070658_10049177
307 Ga0070658_10083245
308 Ga0070683_100000210
309 Ga0070683_100080474
310 Ga0070683_100100766
311 Ga0070683_100496444
312 Ga0070670_100002071
313 Ga0068869_100000308
314 Ga0068868_100000046
315 Ga0068868_100004012
316 Ga0068868_100026074
317 Ga0070661_100003076
318 Ga0070661_100016135
319 Ga0070669_100595766
320 Ga0070671_100006477
321 Ga0070671_100093079
322 Ga0070667_100000728
323 Ga0070714_100103814
324 Ga0070714_100302534
325 Ga0070714_100477309
326 Ga0070694_100410249
327 Ga0070678_100021520
328 Ga0070681_10192366
329 Ga0070684_100003273
330 Ga0070684_100050250
331 Ga0070684_100052183
332 Ga0068853_100005792
333 Ga0068853_100090096
334 Ga0070665_100029723
335 Ga0070665_100410876
336 Ga0068855_100000368
337 Ga0068855_100111154
338 Ga0068855_100127460
339 Ga0068855_100513116
340 Ga0068857_100000448
341 Ga0068854_100065013
342 Ga0068856_100010522
343 Ga0068856_100018092
344 Ga0068856_100026104
345 Ga0068856_100070621
346 Ga0068856_100243002
347 Ga0068856_100501401
348 Ga0068852_100000063
349 Ga0068852_100002149
350 Ga0068852_100027886
351 Ga0068852_100305163
352 Ga0068852_100526206
353 Ga0068859_100013491
354 Ga0068864_100017062
355 Ga0068861_100585287
356 Ga0068863_100022882
357 Ga0068863_100039577
358 Ga0068858_100077877
359 Ga0068860_100001032
360 Ga0068862_100049901
361 Ga0081540_1007130
362 Ga0081539_10222868
363 Ga0070717_10007402
364 Ga0075368_10157443
365 Ga0075363_100113332
366 Ga0075364_10163404
367 Ga0075367_10018447
368 Ga0075366_10004749
369 Ga0075366_10038604
370 Ga0075366_10177580
371 Ga0075366_10265017
372 Ga0097621_100006730
373 Ga0097621_100122260
374 Ga0075370_10012117
375 Ga0068871_100005075
376 Ga0097620_100013490
377 Ga0097620_100347026
378 Ga0105240_10000187
379 Ga0105240_10000663
380 Ga0105240_10019106
381 Ga0105240_10019935
382 Ga0105240_10102912
383 Ga0105240_10139614
384 Ga0105245_10002815
385 Ga0105245_10169435
386 Ga0105247_10004217
387 Ga0105241_10003217
388 Ga0105241_10005170
389 Ga0105241_10143679
390 Ga0105248_10010289
391 Ga0105248_10102587
392 Ga0105237_10007213
393 Ga0105237_10314581
394 Ga0105237_10361562
395 Ga0105237_10487092
396 Ga0105237_10818810
397 Ga0105238_10000657
398 Ga0105238_10005713
399 Ga0105238_10006697
400 Ga0105238_10014670
401 Ga0105238_10257738
402 Ga0105238_10416048
403 Ga0105238_10564694
404 Ga0105249_10025755
405 Ga0105239_10010212
406 Ga0105239_10015201
407 Ga0105239_10017866
408 Ga0105239_10135423
409 Ga0105246_10037370
410 Ga0157373_10149907
411 Ga0157370_10000066
412 Ga0157370_10049045
413 Ga0157369_10000188
414 Ga0157369_10015595
415 Ga0157369_10031690
416 Ga0157369_10032561
417 Ga0157369_10050281
418 Ga0157369_10777495
419 Ga0157374_10005560
420 Ga0157374_10008655
421 Ga0157374_10036420
422 Ga0157378_10013370
423 Ga0157378_10311607
424 Ga0163162_10032004
425 Ga0157372_10000114
426 Ga0157372_10021218
427 Ga0157372_10044476
428 Ga0157372_10048639
429 Ga0157372_10059882
430 Ga0157372_10084136
431 Ga0157372_10116880
432 Ga0157375_10046557
433 Ga0163163_10009625
434 Ga0157379_10005193
435 Ga0157379_10381839
436 Ga0157376_10000173
437 Ga0157376_10173061
438 Ga0213872_10004039
439 Ga0213872_10016026
440 Ga0209233_1002973
441 Ga0207656_10023355
442 Ga0207656_10077104
443 Ga0207710_10002782
444 Ga0207705_10037862
445 Ga0207705_10105281
446 Ga0207654_10005127
447 Ga0207654_10028592
448 Ga0207654_10034343
449 Ga0207654_10090547
450 Ga0207707_10253919
451 Ga0207695_10000052
452 Ga0207695_10000253
453 Ga0207695_10001120
454 Ga0207695_10013281
455 Ga0207695_10109810
456 Ga0207695_10302759
457 Ga0207671_10000081
458 Ga0207671_10005934
459 Ga0207671_10098279
460 Ga0207671_10330859
461 Ga0207693_10605131
462 Ga0207663_10291079
463 Ga0207649_10002341
464 Ga0207649_10505298
465 Ga0207694_10000108
466 Ga0207694_10006127
467 Ga0207694_10054980
468 Ga0207694_10294085
469 Ga0207650_10001335
470 Ga0207659_10571308
471 Ga0207687_10076395
472 Ga0207664_10047053
473 Ga0207664_10143410
474 Ga0207644_10002796
475 Ga0207711_10004803
476 Ga0207711_10016153
477 Ga0207689_10019346
478 Ga0207661_10002024
479 Ga0207661_10022132
480 Ga0207661_10077602
481 Ga0207661_10317730
482 Ga0207667_10001441
483 Ga0207667_10096050
484 Ga0207667_10152503
485 Ga0207640_10373890
486 Ga0207658_10000416
487 Ga0207677_10000025
488 Ga0207677_10019800
489 Ga0207677_10061465
490 Ga0207703_10048591
491 Ga0207639_10000055
492 Ga0207639_10004182
493 Ga0207639_10148685
494 Ga0207678_10648468
495 Ga0207702_10010722
496 Ga0207702_10033198
497 Ga0207702_10095169
498 Ga0207702_10357751
499 Ga0207641_10010405
500 Ga0207641_10043335
501 Ga0207676_10002620
502 Ga0207674_10000459
503 Ga0207698_10000007
504 Ga0207698_10057863
505 Ga0207698_10160192
506 Ga0207698_10275900
507 Ga0209971_1022446
508 Ga0209813_10018096
509 Ga0209813_10149331
510 Ga0268266_10120396
511 Ga0268266_10220982
512 Ga0268265_10022751
513 Ga0268265_10037600
514 Ga0268264_10000920
515 Ga0265338_10003779
516 Ga0265338_10004819
517 Ga0265338_10012773
518 Ga0265338_10023642
519 Ga0265324_10048632
520 Ga0265330_10000852
521 Ga0265330_10034177
522 Ga0265330_10097644
523 Ga0265330_10107039
524 Ga0265332_10134985
525 Ga0265328_10022239
526 Ga0265328_10036439
527 Ga0265320_10018906
528 Ga0265320_10037191
529 Ga0265325_10002033
530 Ga0265325_10180398
531 Ga0265329_10007122
532 Ga0265340_10022322
533 Ga0265339_10000204
534 Ga0265339_10004335
535 Ga0265339_10062959
536 Ga0265316_10002998
537 Ga0265316_10015825
538 Ga0307408_100068249
539 Ga0265313_10001614
540 Ga0265314_10000139
541 Ga0265314_10002635
542 Ga0265314_10038367
543 Ga0265314_10119539
544 Ga0265342_10002378
545 Ga0265342_10051757
546 Ga0265342_10155435
547 Ga0373957_0008243
548 Ga0373937_0002195
549 Ga0373937_1014187
550 Ga0395900_0006353
551 Ga0395898_0198590
552 Ga0395905_0050322
553 Ga0395905_0238056
554 Ga0395905_0878186
555 Ga0436360_0155361
556 Ga0436360_0871702
557 Ga0436360_1349001
558 Ga0436361_0224417
559 Ga0436361_0839710
560 Ga0436361_0864637
561 Ga0439464_0114843
562 Ga0453683_0204344
563 Ga0466961_0019838
564 Ga0466963_0007458
565 Ga0451576_0544360
566 Ga0495617_048530
567 Ga0495629_0030811
568 Ga0495629_0412919
569 Ga0495651_0153917
570 Ga0495580_0170027
571 Ga0495582_0138429
572 Ga0495639_0056227
573 Ga0495662_0092272
574 Ga0495583_0071553
575 Ga0495652_0021671
576 Ga0495665_0037854
577 Ga0495640_0224742
578 Ga0495587_0004453
579 Ga0495645_0001171
580 Ga0495667_0100457
581 Ga0495625_0004435
582 Ga0495623_0176350
583 Ga0495646_0199298
584 Ga0495669_0017980
585 Ga0495613_0015595
586 Ga0495613_0047756
587 Ga0495600_0015924
588 Ga0495604_0266359
589 Ga0495675_0335215
590 Ga0495679_036531
591 Ga0495684_0016800
592 Ga0495602_0492135
593 Ga0496109_0585166
594 Ga0496114_0376711
595 Ga0496126_0305971
596 Ga0495682_0024432
597 nmdc:mga03683_128875_c1
598 nmdc:mga03n38_129424_c1
599 nmdc:mga03n38_64623_c1
600 nmdc:mga0k408_10498_c1
601 nmdc:mga0k408_5582_c1
602 nmdc:mga06z11_29867_c1
603 nmdc:mga04h51_127769_c1
604 nmdc:mga07m45_1997_c1
605 Ga0495601_0009859
606 Ga0500595_000423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

30

210

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9521 10 208
3tqr-assembly1.cif.gz_A structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii 0.9468 9 207
3av3-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus 0.9465 11 194
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9454 7 209
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9425 11 207
ID Description Score Start End Superfamily
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.953 10 193 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9481 10 208 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9454 7 209 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9424 8 196 3.40.50.170
3av3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9408 11 193 3.40.50.170
ID Description Score Start End GO Terms
AF-E6W594-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9728 9 208 GO:0004644
GO:0005737
GO:0006189
AF-A0A662L6X4-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9682 10 209 GO:0004644
GO:0005737
GO:0006189
AF-A0A497IJY7-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9652 11 208 GO:0004644
GO:0005737
GO:0006189
AF-A0A1U9L1P6-F1-model_v4 deleted 0.9649 38 195
AF-A0A7X0JAL5-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9636 7 195 GO:0004644
GO:0005829
GO:0006189

Map