F396652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 189 | 301 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0180261|Ga0495580_0180261_856_1389 |
| Length | 177 |
| Sequence | MPNATHHYNVLFLCTGNSARSIMAEALMNFKGAPQFTAYSAGSHASGKVRPEALQRLEAAHIPVDGLRSKSWDEFALPDAPKMDFVFTVCDNAAKEVCPIWFPHPSKTAKDGAPGPLTAHWGVPDPAGVQGSPQEIDRTFREAFSILERRIGLLLSLPLASLDRLAIKKSVDEIGRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 71 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 125 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 128 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 131 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 132 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 133 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 134 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 135 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 147 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 186 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 1.32 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 9.27 |
| Rhizosphere | 89.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10133592 | 3300005328 | Bacteria | 1572 |
| 2 | Ga0070683_100074064 | 3300005329 | Bacteria | 3180 |
| 3 | Ga0070670_100865747 | 3300005331 | Bacteria | 818 |
| 4 | Ga0070666_10164743 | 3300005335 | Bacteria | 1550 |
| 5 | Ga0070682_100099502 | 3300005337 | Bacteria | 1917 |
| 6 | Ga0068868_100032127 | 3300005338 | Bacteria | 4036 |
| 7 | Ga0068868_100631029 | 3300005338 | Bacteria | 952 |
| 8 | Ga0070668_100114967 | 3300005347 | Bacteria | 2145 |
| 9 | Ga0070671_100165228 | 3300005355 | Bacteria | 1871 |
| 10 | Ga0070674_100413428 | 3300005356 | Bacteria | 1105 |
| 11 | Ga0070659_100011139 | 3300005366 | Bacteria | 6641 |
| 12 | Ga0070667_100386913 | 3300005367 | Bacteria | 1271 |
| 13 | Ga0070709_10118244 | 3300005434 | Bacteria | 1792 |
| 14 | Ga0070709_10190667 | 3300005434 | Bacteria | 1445 |
| 15 | Ga0070714_100124464 | 3300005435 | Bacteria | 2296 |
| 16 | Ga0070714_100612699 | 3300005435 | Bacteria | 1046 |
| 17 | Ga0070713_100028894 | 3300005436 | Bacteria | 4382 |
| 18 | Ga0070713_100039588 | 3300005436 | Bacteria | 3826 |
| 19 | Ga0070713_100085451 | 3300005436 | Bacteria | 2703 |
| 20 | Ga0070713_100221859 | 3300005436 | Bacteria | 1715 |
| 21 | Ga0070710_10029363 | 3300005437 | Bacteria | 2950 |
| 22 | Ga0070711_100104330 | 3300005439 | Bacteria | 2068 |
| 23 | Ga0070711_100330204 | 3300005439 | Bacteria | 1221 |
| 24 | Ga0070711_100349881 | 3300005439 | Bacteria | 1188 |
| 25 | Ga0070700_100117804 | 3300005441 | Bacteria | 1775 |
| 26 | Ga0070700_100604018 | 3300005441 | Bacteria | 860 |
| 27 | Ga0070708_100004936 | 3300005445 | Bacteria | 10549 |
| 28 | Ga0070708_100007628 | 3300005445 | Bacteria | 8667 |
| 29 | Ga0070708_100010288 | 3300005445 | Bacteria | 7574 |
| 30 | Ga0070708_100022474 | 3300005445 | Bacteria | 5350 |
| 31 | Ga0070663_101383791 | 3300005455 | Bacteria | 623 |
| 32 | Ga0070662_100424298 | 3300005457 | Bacteria | 1101 |
| 33 | Ga0068867_100680707 | 3300005459 | Bacteria | 906 |
| 34 | Ga0070706_100000556 | 3300005467 | Bacteria | 43474 |
| 35 | Ga0070706_100061956 | 3300005467 | Bacteria | 3455 |
| 36 | Ga0070706_100183484 | 3300005467 | Bacteria | 1954 |
| 37 | Ga0070707_100006391 | 3300005468 | Bacteria | 10955 |
| 38 | Ga0070707_100046376 | 3300005468 | Bacteria | 4159 |
| 39 | Ga0070707_100623294 | 3300005468 | Unclassified | 1041 |
| 40 | Ga0070698_100002213 | 3300005471 | Bacteria | 21527 |
| 41 | Ga0070698_100464186 | 3300005471 | Bacteria | 1202 |
| 42 | Ga0070699_100002908 | 3300005518 | Bacteria | 15244 |
| 43 | Ga0070699_100061649 | 3300005518 | Bacteria | 3250 |
| 44 | Ga0070697_100001590 | 3300005536 | Bacteria | 17330 |
| 45 | Ga0070697_100004925 | 3300005536 | Bacteria | 10243 |
| 46 | Ga0070697_100041404 | 3300005536 | Bacteria | 3728 |
| 47 | Ga0070697_100060353 | 3300005536 | Bacteria | 3091 |
| 48 | Ga0070697_100098429 | 3300005536 | Bacteria | 2427 |
| 49 | Ga0070665_100123886 | 3300005548 | Bacteria | 2587 |
| 50 | Ga0070665_100325883 | 3300005548 | Bacteria | 1540 |
| 51 | Ga0070665_100939729 | 3300005548 | Bacteria | 877 |
| 52 | Ga0068854_100085863 | 3300005578 | Bacteria | 2331 |
| 53 | Ga0068856_100019476 | 3300005614 | Bacteria | 6587 |
| 54 | Ga0068856_100059049 | 3300005614 | Bacteria | 3788 |
| 55 | Ga0068864_100079603 | 3300005618 | Bacteria | 2869 |
| 56 | Ga0068866_10152884 | 3300005718 | Bacteria | 1338 |
| 57 | Ga0068866_10251032 | 3300005718 | Bacteria | 1082 |
| 58 | Ga0068861_100529477 | 3300005719 | Bacteria | 1070 |
| 59 | Ga0068851_10013264 | 3300005834 | Bacteria | 3899 |
| 60 | Ga0068863_100002412 | 3300005841 | Bacteria | 18565 |
| 61 | Ga0068858_100169142 | 3300005842 | Bacteria | 2060 |
| 62 | Ga0068858_100825259 | 3300005842 | Bacteria | 905 |
| 63 | Ga0068860_100464457 | 3300005843 | Bacteria | 1260 |
| 64 | Ga0068860_101357264 | 3300005843 | Bacteria | 732 |
| 65 | Ga0068862_100006475 | 3300005844 | Bacteria | 9725 |
| 66 | Ga0070717_10030339 | 3300006028 | Bacteria | 4343 |
| 67 | Ga0070717_10453282 | 3300006028 | Bacteria | 1156 |
| 68 | Ga0070715_10571440 | 3300006163 | Unclassified | 658 |
| 69 | Ga0070715_10631095 | 3300006163 | Unclassified | 632 |
| 70 | Ga0070716_100003978 | 3300006173 | Bacteria | 7014 |
| 71 | Ga0070716_100059100 | 3300006173 | Bacteria | 2209 |
| 72 | Ga0070716_100269463 | 3300006173 | Bacteria | 1169 |
| 73 | Ga0070716_100762579 | 3300006173 | Eukaryota | 745 |
| 74 | Ga0070716_100863566 | 3300006173 | Unclassified | 705 |
| 75 | Ga0070716_101353330 | 3300006173 | Bacteria | 577 |
| 76 | Ga0070712_100047992 | 3300006175 | Bacteria | 2958 |
| 77 | Ga0070712_100636541 | 3300006175 | Unclassified | 905 |
| 78 | Ga0097621_100006192 | 3300006237 | Bacteria | 8482 |
| 79 | Ga0097621_100065110 | 3300006237 | Bacteria | 2999 |
| 80 | Ga0068871_100005202 | 3300006358 | Bacteria | 9098 |
| 81 | Ga0068871_100006041 | 3300006358 | Bacteria | 8522 |
| 82 | Ga0068871_101018513 | 3300006358 | Bacteria | 772 |
| 83 | Ga0075434_100015167 | 3300006871 | Bacteria | 7383 |
| 84 | Ga0075435_100060738 | 3300007076 | Bacteria | 3065 |
| 85 | Ga0105240_10201327 | 3300009093 | Bacteria | 2333 |
| 86 | Ga0105245_10031617 | 3300009098 | Bacteria | 4685 |
| 87 | Ga0105247_10565887 | 3300009101 | Bacteria | 838 |
| 88 | Ga0114129_10051132 | 3300009147 | Bacteria | 5803 |
| 89 | Ga0105241_10007197 | 3300009174 | Bacteria | 8190 |
| 90 | Ga0105241_10053568 | 3300009174 | Bacteria | 3086 |
| 91 | Ga0105241_10569660 | 3300009174 | Bacteria | 1019 |
| 92 | Ga0105242_10281370 | 3300009176 | Bacteria | 1511 |
| 93 | Ga0105248_10190624 | 3300009177 | Bacteria | 2310 |
| 94 | Ga0105248_10658820 | 3300009177 | Bacteria | 1181 |
| 95 | Ga0105248_11393985 | 3300009177 | Bacteria | 793 |
| 96 | Ga0105237_10072895 | 3300009545 | Bacteria | 3427 |
| 97 | Ga0105238_10045537 | 3300009551 | Bacteria | 4431 |
| 98 | Ga0105238_10196335 | 3300009551 | Bacteria | 1994 |
| 99 | Ga0105238_10935741 | 3300009551 | Bacteria | 886 |
| 100 | Ga0105239_10079599 | 3300010375 | Bacteria | 3606 |
| 101 | Ga0105239_11608819 | 3300010375 | Bacteria | 751 |
| 102 | Ga0157373_10052246 | 3300013100 | Bacteria | 2909 |
| 103 | Ga0157373_10074002 | 3300013100 | Bacteria | 2403 |
| 104 | Ga0157371_10853580 | 3300013102 | Bacteria | 688 |
| 105 | Ga0157369_10017115 | 3300013105 | Bacteria | 8146 |
| 106 | Ga0157369_10380399 | 3300013105 | Bacteria | 1465 |
| 107 | Ga0157374_10079786 | 3300013296 | Bacteria | 3102 |
| 108 | Ga0157378_10003764 | 3300013297 | Bacteria | 13444 |
| 109 | Ga0157378_10012189 | 3300013297 | Bacteria | 7529 |
| 110 | Ga0157378_10019357 | 3300013297 | Bacteria | 5985 |
| 111 | Ga0157378_10151652 | 3300013297 | Bacteria | 2160 |
| 112 | Ga0163162_10071298 | 3300013306 | Bacteria | 3527 |
| 113 | Ga0163162_10194879 | 3300013306 | Bacteria | 2154 |
| 114 | Ga0157372_10014205 | 3300013307 | Bacteria | 8509 |
| 115 | Ga0157375_10175592 | 3300013308 | Bacteria | 2291 |
| 116 | Ga0157380_10802738 | 3300014326 | Bacteria | 958 |
| 117 | Ga0182008_10014783 | 3300014497 | Bacteria | 4082 |
| 118 | Ga0157376_10033125 | 3300014969 | Bacteria | 4156 |
| 119 | Ga0157376_10367163 | 3300014969 | Bacteria | 1382 |
| 120 | Ga0157376_10659978 | 3300014969 | Bacteria | 1047 |
| 121 | Ga0182007_10003559 | 3300015262 | Bacteria | 7328 |
| 122 | Ga0206350_11566209 | 3300020080 | Bacteria | 1941 |
| 123 | Ga0228598_1003719 | 3300024227 | Bacteria | 3263 |
| 124 | Ga0207656_10014967 | 3300025321 | Bacteria | 2998 |
| 125 | Ga0207680_10153514 | 3300025903 | Bacteria | 1537 |
| 126 | Ga0207680_10346617 | 3300025903 | Bacteria | 1043 |
| 127 | Ga0207699_10194353 | 3300025906 | Bacteria | 1371 |
| 128 | Ga0207699_10277367 | 3300025906 | Bacteria | 1164 |
| 129 | Ga0207699_10325899 | 3300025906 | Bacteria | 1079 |
| 130 | Ga0207705_10605104 | 3300025909 | Bacteria | 852 |
| 131 | Ga0207684_10003347 | 3300025910 | Bacteria | 15715 |
| 132 | Ga0207684_10053203 | 3300025910 | Bacteria | 3437 |
| 133 | Ga0207684_10063833 | 3300025910 | Bacteria | 3126 |
| 134 | Ga0207684_10298071 | 3300025910 | Bacteria | 1390 |
| 135 | Ga0207654_10129784 | 3300025911 | Bacteria | 1594 |
| 136 | Ga0207695_10075023 | 3300025913 | Bacteria | 3442 |
| 137 | Ga0207671_10387555 | 3300025914 | Unclassified | 1111 |
| 138 | Ga0207693_10085637 | 3300025915 | Bacteria | 2468 |
| 139 | Ga0207693_10135872 | 3300025915 | Bacteria | 1933 |
| 140 | Ga0207663_10298022 | 3300025916 | Bacteria | 1204 |
| 141 | Ga0207663_10372688 | 3300025916 | Bacteria | 1086 |
| 142 | Ga0207663_10983639 | 3300025916 | Bacteria | 676 |
| 143 | Ga0207657_10000222 | 3300025919 | Bacteria | 59330 |
| 144 | Ga0207646_10000341 | 3300025922 | Bacteria | 63056 |
| 145 | Ga0207646_10005323 | 3300025922 | Bacteria | 13566 |
| 146 | Ga0207646_10201461 | 3300025922 | Bacteria | 1798 |
| 147 | Ga0207694_10195804 | 3300025924 | Bacteria | 1643 |
| 148 | Ga0207659_10416896 | 3300025926 | Bacteria | 1125 |
| 149 | Ga0207687_10337128 | 3300025927 | Bacteria | 1225 |
| 150 | Ga0207700_10053975 | 3300025928 | Bacteria | 3014 |
| 151 | Ga0207700_10065819 | 3300025928 | Bacteria | 2767 |
| 152 | Ga0207700_10087874 | 3300025928 | Bacteria | 2445 |
| 153 | Ga0207700_10311502 | 3300025928 | Bacteria | 1362 |
| 154 | Ga0207700_10806080 | 3300025928 | Bacteria | 840 |
| 155 | Ga0207700_10863312 | 3300025928 | Bacteria | 810 |
| 156 | Ga0207664_10119606 | 3300025929 | Bacteria | 2202 |
| 157 | Ga0207664_10548894 | 3300025929 | Bacteria | 1037 |
| 158 | Ga0207690_10427764 | 3300025932 | Bacteria | 1060 |
| 159 | Ga0207706_10222288 | 3300025933 | Bacteria | 1653 |
| 160 | Ga0207665_10007473 | 3300025939 | Bacteria | 7223 |
| 161 | Ga0207665_10095054 | 3300025939 | Bacteria | 2071 |
| 162 | Ga0207665_10338796 | 3300025939 | Bacteria | 1133 |
| 163 | Ga0207711_10207072 | 3300025941 | Bacteria | 1791 |
| 164 | Ga0207668_10027678 | 3300025972 | Bacteria | 3696 |
| 165 | Ga0207640_10164463 | 3300025981 | Bacteria | 1646 |
| 166 | Ga0207640_10227847 | 3300025981 | Bacteria | 1431 |
| 167 | Ga0207639_10356801 | 3300026041 | Bacteria | 1307 |
| 168 | Ga0207708_10011540 | 3300026075 | Bacteria | 6583 |
| 169 | Ga0207708_10810351 | 3300026075 | Bacteria | 806 |
| 170 | Ga0207702_10067649 | 3300026078 | Bacteria | 3066 |
| 171 | Ga0207641_10003924 | 3300026088 | Bacteria | 13006 |
| 172 | Ga0207676_10057024 | 3300026095 | Bacteria | 3075 |
| 173 | Ga0207675_100012314 | 3300026118 | Bacteria | 7990 |
| 174 | Ga0207698_10071828 | 3300026142 | Bacteria | 2748 |
| 175 | Ga0209970_1000200 | 3300027614 | Bacteria | 9568 |
| 176 | Ga0209588_1016031 | 3300027671 | Bacteria | 2309 |
| 177 | Ga0265356_1018134 | 3300028017 | Bacteria | 761 |
| 178 | Ga0268266_10386540 | 3300028379 | Bacteria | 1321 |
| 179 | Ga0268266_10664456 | 3300028379 | Bacteria | 1003 |
| 180 | Ga0268266_11405345 | 3300028379 | Bacteria | 673 |
| 181 | Ga0268265_10057434 | 3300028380 | Bacteria | 2966 |
| 182 | Ga0268265_10676720 | 3300028380 | Bacteria | 994 |
| 183 | Ga0268264_10764139 | 3300028381 | Bacteria | 964 |
| 184 | Ga0265319_1061655 | 3300028563 | Bacteria | 1216 |
| 185 | Ga0265319_1202261 | 3300028563 | Bacteria | 609 |
| 186 | Ga0265318_10168229 | 3300028577 | Bacteria | 803 |
| 187 | Ga0265338_10004414 | 3300028800 | Bacteria | 19018 |
| 188 | Ga0265338_10094279 | 3300028800 | Bacteria | 2463 |
| 189 | Ga0265338_10121318 | 3300028800 | Bacteria | 2083 |
| 190 | Ga0265770_1009646 | 3300030878 | Bacteria | 1393 |
| 191 | Ga0265760_10000219 | 3300031090 | Bacteria | 15517 |
| 192 | Ga0265760_10002540 | 3300031090 | Bacteria | 5326 |
| 193 | Ga0265332_10114643 | 3300031238 | Bacteria | 1134 |
| 194 | Ga0265332_10152556 | 3300031238 | Bacteria | 966 |
| 195 | Ga0265328_10006632 | 3300031239 | Bacteria | 4874 |
| 196 | Ga0265320_10004428 | 3300031240 | Bacteria | 9210 |
| 197 | Ga0265320_10006977 | 3300031240 | Bacteria | 7047 |
| 198 | Ga0265325_10082079 | 3300031241 | Bacteria | 1600 |
| 199 | Ga0265340_10494764 | 3300031247 | Bacteria | 538 |
| 200 | Ga0265339_10505954 | 3300031249 | Bacteria | 557 |
| 201 | Ga0265331_10000641 | 3300031250 | Bacteria | 30240 |
| 202 | Ga0265327_10003316 | 3300031251 | Bacteria | 15582 |
| 203 | Ga0265327_10086665 | 3300031251 | Bacteria | 1535 |
| 204 | Ga0265316_10153745 | 3300031344 | Bacteria | 1722 |
| 205 | Ga0265313_10167374 | 3300031595 | Bacteria | 930 |
| 206 | Ga0265313_10255665 | 3300031595 | Bacteria | 713 |
| 207 | Ga0265314_10010377 | 3300031711 | Bacteria | 7776 |
| 208 | Ga0265314_10068145 | 3300031711 | Bacteria | 2393 |
| 209 | Ga0265314_10141798 | 3300031711 | Bacteria | 1484 |
| 210 | Ga0373934_0172701 | 3300035086 | Bacteria | 887 |
| 211 | Ga0373936_0413466 | 3300035113 | Unclassified | 620 |
| 212 | Ga0373943_0270485 | 3300035170 | Unclassified | 958 |
| 213 | Ga0373935_0048221 | 3300035692 | Bacteria | 2697 |
| 214 | Ga0373927_0011977 | 3300035695 | Bacteria | 5769 |
| 215 | Ga0373933_0028176 | 3300035724 | Bacteria | 3239 |
| 216 | Ga0373925_0000125 | 3300037068 | Bacteria | 83446 |
| 217 | Ga0373925_0008406 | 3300037068 | Bacteria | 7515 |
| 218 | Ga0400486_22391 | 3300038742 | Bacteria | 2527 |
| 219 | Ga0436360_1367918 | 3300039438 | Bacteria | 708 |
| 220 | Ga0439441_002240 | 3300042001 | Bacteria | 2698 |
| 221 | Ga0451577_0248650 | 3300042876 | Bacteria | 1609 |
| 222 | Ga0453684_0272155 | 3300044712 | Bacteria | 1935 |
| 223 | Ga0453684_0840803 | 3300044712 | Bacteria | 987 |
| 224 | Ga0495580_0004871 | 3300046472 | Bacteria | 11224 |
| 225 | Ga0495580_0010700 | 3300046472 | Bacteria | 7126 |
| 226 | Ga0495580_0098369 | 3300046472 | Bacteria | 2035 |
| 227 | Ga0495580_0180261 | 3300046472 | Bacteria | 1459 |
| 228 | Ga0495580_0213163 | 3300046472 | Bacteria | 1328 |
| 229 | Ga0495580_0231770 | 3300046472 | Bacteria | 1268 |
| 230 | Ga0495580_0493544 | 3300046472 | Bacteria | 818 |
| 231 | Ga0495582_0833359 | 3300046473 | Bacteria | 533 |
| 232 | Ga0495584_0024840 | 3300046491 | Bacteria | 3038 |
| 233 | Ga0495630_0005588 | 3300046517 | Bacteria | 8878 |
| 234 | Ga0495635_0296869 | 3300046663 | Bacteria | 1084 |
| 235 | Ga0495669_0202931 | 3300046684 | Bacteria | 948 |
| 236 | Ga0495669_0449821 | 3300046684 | Bacteria | 625 |
| 237 | Ga0495600_0509806 | 3300046809 | Bacteria | 738 |
| 238 | Ga0495681_0207218 | 3300047470 | Bacteria | 792 |
| 239 | Ga0496100_0069126 | 3300048903 | Bacteria | 2351 |
| 240 | Ga0496100_0084723 | 3300048903 | Bacteria | 2149 |
| 241 | Ga0496100_0130534 | 3300048903 | Bacteria | 1769 |
| 242 | Ga0496101_0005939 | 3300048904 | Bacteria | 7820 |
| 243 | Ga0496102_0103735 | 3300048905 | Bacteria | 2644 |
| 244 | Ga0496102_0537612 | 3300048905 | Unclassified | 1091 |
| 245 | Ga0496104_0040753 | 3300048907 | Bacteria | 4354 |
| 246 | Ga0496104_0214442 | 3300048907 | Bacteria | 1837 |
| 247 | Ga0496104_0417673 | 3300048907 | Bacteria | 1254 |
| 248 | Ga0496105_0168718 | 3300048908 | Bacteria | 1795 |
| 249 | Ga0496105_0211612 | 3300048908 | Bacteria | 1580 |
| 250 | Ga0496106_0122022 | 3300048909 | Bacteria | 2037 |
| 251 | Ga0496107_0059445 | 3300048910 | Bacteria | 2766 |
| 252 | Ga0496107_0312551 | 3300048910 | Bacteria | 1169 |
| 253 | Ga0496108_0101872 | 3300048911 | Bacteria | 2450 |
| 254 | Ga0496108_1720464 | 3300048911 | Unclassified | 516 |
| 255 | Ga0496110_0042272 | 3300048913 | Bacteria | 3978 |
| 256 | Ga0496110_1205985 | 3300048913 | Bacteria | 666 |
| 257 | Ga0496111_0148133 | 3300048914 | Bacteria | 1740 |
| 258 | Ga0496112_0130347 | 3300048915 | Bacteria | 2485 |
| 259 | Ga0496112_0265179 | 3300048915 | Bacteria | 1666 |
| 260 | Ga0496112_0680658 | 3300048915 | Bacteria | 957 |
| 261 | Ga0496113_0185565 | 3300048916 | Bacteria | 1649 |
| 262 | Ga0496114_0001136 | 3300048917 | Bacteria | 20130 |
| 263 | Ga0496114_0146900 | 3300048917 | Bacteria | 2044 |
| 264 | Ga0496115_0001411 | 3300048918 | Bacteria | 17189 |
| 265 | Ga0496115_0027564 | 3300048918 | Bacteria | 4445 |
| 266 | Ga0496115_0115541 | 3300048918 | Bacteria | 2207 |
| 267 | Ga0501033_0034475 | 3300049570 | Bacteria | 3797 |
| 268 | Ga0501039_0960344 | 3300049575 | Bacteria | 664 |
| 269 | Ga0501040_0114203 | 3300049576 | Bacteria | 1890 |
| 270 | Ga0501041_0002727 | 3300049577 | Bacteria | 10078 |
| 271 | Ga0501042_0014640 | 3300049578 | Bacteria | 5357 |
| 272 | Ga0501043_0239463 | 3300049579 | Bacteria | 1400 |
| 273 | Ga0501046_0187095 | 3300049580 | Bacteria | 1546 |
| 274 | Ga0501048_0233128 | 3300049582 | Bacteria | 1306 |
| 275 | Ga0501071_0045186 | 3300049587 | Bacteria | 3161 |
| 276 | Ga0501072_0006475 | 3300049588 | Bacteria | 8918 |
| 277 | Ga0501073_0176196 | 3300049589 | Bacteria | 1480 |
| 278 | Ga0501074_0127249 | 3300049590 | Bacteria | 1823 |
| 279 | Ga0501075_0112082 | 3300049591 | Bacteria | 2074 |
| 280 | Ga0501076_0022335 | 3300049592 | Bacteria | 4863 |
| 281 | Ga0501077_0011392 | 3300049593 | Bacteria | 5553 |
| 282 | Ga0501077_0456853 | 3300049593 | Bacteria | 818 |
| 283 | Ga0501079_0053799 | 3300049741 | Bacteria | 3105 |
| 284 | Ga0501080_0121858 | 3300049742 | Bacteria | 2416 |
| 285 | Ga0501081_1308490 | 3300049743 | Bacteria | 550 |
| 286 | Ga0501083_0163796 | 3300049744 | Bacteria | 1454 |
| 287 | nmdc:mga05p37_52438_c1 | 3300050507 | Bacteria | 5016 |
| 288 | nmdc:mga0n895_8863_c2 | 3300050512 | Bacteria | 6658 |
| 289 | nmdc:mga0rr50_32147_c1 | 3300050513 | Bacteria | 3735 |
| 290 | nmdc:mga0a205_11862_c1 | 3300050515 | Bacteria | 8043 |
| 291 | nmdc:mga0a205_55307_c1 | 3300050515 | Bacteria | 3833 |
| 292 | Ga0495601_0057103 | 3300053077 | Bacteria | 2473 |
| 293 | Ga0495612_0139178 | 3300053078 | Bacteria | 1052 |
| 294 | Ga0495655_0260865 | 3300053083 | Bacteria | 585 |
| 295 | Ga0495595_0205473 | 3300053084 | Bacteria | 981 |
| 296 | Ga0495619_0042064 | 3300053085 | Bacteria | 2991 |
| 297 | Ga0500647_0024709 | 3300053091 | Bacteria | 2827 |
| 298 | Ga0500590_089939 | 3300053148 | Bacteria | 1492 |
| 299 | Ga0501084_0014173 | 3300054114 | Bacteria | 6601 |
| 300 | Ga0501082_0031267 | 3300060353 | Bacteria | 4589 |
| 301 | Ga0530510_0001427 | 3300061734 | Bacteria | 16004 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042001 | Ga0439441_002240 | Ga0439441_002240_790_1218 | 142 |
| 2 | 3300005455 | Ga0070663_101383791 | Ga0070663_1013837911 | 144 |
| 3 | 3300006173 | Ga0070716_100762579 | Ga0070716_1007625792 | 144 |
| 4 | 3300009093 | Ga0105240_10201327 | Ga0105240_102013273 | 144 |
| 5 | 3300009101 | Ga0105247_10565887 | Ga0105247_105658872 | 144 |
| 6 | 3300009174 | Ga0105241_10007197 | Ga0105241_100071977 | 144 |
| 7 | 3300009177 | Ga0105248_10190624 | Ga0105248_101906242 | 144 |
| 8 | 3300009551 | Ga0105238_10045537 | Ga0105238_100455372 | 144 |
| 9 | 3300010375 | Ga0105239_11608819 | Ga0105239_116088192 | 144 |
| 10 | 3300013100 | Ga0157373_10074002 | Ga0157373_100740022 | 144 |
| 11 | 3300013102 | Ga0157371_10853580 | Ga0157371_108535801 | 144 |
| 12 | 3300013105 | Ga0157369_10017115 | Ga0157369_100171154 | 144 |
| 13 | 3300013297 | Ga0157378_10019357 | Ga0157378_100193575 | 144 |
| 14 | 3300013306 | Ga0163162_10194879 | Ga0163162_101948792 | 144 |
| 15 | 3300014497 | Ga0182008_10014783 | Ga0182008_100147835 | 144 |
| 16 | 3300015262 | Ga0182007_10003559 | Ga0182007_100035591 | 144 |
| 17 | 3300025928 | Ga0207700_10806080 | Ga0207700_108060802 | 144 |
| 18 | 3300025928 | Ga0207700_10863312 | Ga0207700_108633121 | 144 |
| 19 | 3300035086 | Ga0373934_0172701 | Ga0373934_0172701_107_541 | 144 |
| 20 | 3300035113 | Ga0373936_0413466 | Ga0373936_0413466_16_450 | 144 |
| 21 | 3300035724 | Ga0373933_0028176 | Ga0373933_0028176_1397_1831 | 144 |
| 22 | 3300037068 | Ga0373925_0008406 | Ga0373925_0008406_7064_7498 | 144 |
| 23 | 3300039438 | Ga0436360_1367918 | Ga0436360_1367918_43_477 | 144 |
| 24 | 3300046472 | Ga0495580_0098369 | Ga0495580_0098369_24_458 | 144 |
| 25 | 3300048907 | Ga0496104_0214442 | Ga0496104_0214442_47_481 | 144 |
| 26 | 3300048908 | Ga0496105_0168718 | Ga0496105_0168718_1303_1737 | 144 |
| 27 | 3300048914 | Ga0496111_0148133 | Ga0496111_0148133_1219_1653 | 144 |
| 28 | 3300048915 | Ga0496112_0130347 | Ga0496112_0130347_1510_1944 | 144 |
| 29 | 3300048915 | Ga0496112_0680658 | Ga0496112_0680658_480_914 | 144 |
| 30 | 3300048916 | Ga0496113_0185565 | Ga0496113_0185565_38_472 | 144 |
| 31 | 3300050515 | nmdc:mga0a205_55307_c1 | nmdc:mga0a205_55307_c1_11_445 | 144 |
| 32 | 3300053077 | Ga0495601_0057103 | Ga0495601_0057103_29_463 | 144 |
| 33 | 3300048911 | Ga0496108_1720464 | Ga0496108_1720464_37_474 | 145 |
| 34 | 3300005434 | Ga0070709_10190667 | Ga0070709_101906672 | 148 |
| 35 | 3300005436 | Ga0070713_100085451 | Ga0070713_1000854512 | 148 |
| 36 | 3300014326 | Ga0157380_10802738 | Ga0157380_108027381 | 148 |
| 37 | 3300025939 | Ga0207665_10095054 | Ga0207665_100950542 | 148 |
| 38 | 3300028563 | Ga0265319_1061655 | Ga0265319_10616552 | 148 |
| 39 | 3300046473 | Ga0495582_0833359 | Ga0495582_0833359_37_492 | 148 |
| 40 | 3300046491 | Ga0495584_0024840 | Ga0495584_0024840_2522_2983 | 148 |
| 41 | 3300053083 | Ga0495655_0260865 | Ga0495655_0260865_87_548 | 148 |
| 42 | 3300031251 | Ga0265327_10003316 | Ga0265327_1000331611 | 149 |
| 43 | 3300028563 | Ga0265319_1202261 | Ga0265319_12022611 | 150 |
| 44 | 3300028577 | Ga0265318_10168229 | Ga0265318_101682291 | 150 |
| 45 | 3300031238 | Ga0265332_10114643 | Ga0265332_101146432 | 150 |
| 46 | 3300031238 | Ga0265332_10152556 | Ga0265332_101525562 | 150 |
| 47 | 3300031239 | Ga0265328_10006632 | Ga0265328_100066324 | 150 |
| 48 | 3300031240 | Ga0265320_10004428 | Ga0265320_1000442811 | 150 |
| 49 | 3300031240 | Ga0265320_10006977 | Ga0265320_100069776 | 150 |
| 50 | 3300031250 | Ga0265331_10000641 | Ga0265331_100006414 | 150 |
| 51 | 3300031251 | Ga0265327_10086665 | Ga0265327_100866653 | 150 |
| 52 | 3300031344 | Ga0265316_10153745 | Ga0265316_101537451 | 150 |
| 53 | 3300031595 | Ga0265313_10167374 | Ga0265313_101673742 | 150 |
| 54 | 3300031595 | Ga0265313_10255665 | Ga0265313_102556651 | 150 |
| 55 | 3300031711 | Ga0265314_10010377 | Ga0265314_100103773 | 150 |
| 56 | 3300031711 | Ga0265314_10068145 | Ga0265314_100681452 | 150 |
| 57 | 3300031711 | Ga0265314_10141798 | Ga0265314_101417982 | 150 |
| 58 | 3300038742 | Ga0400486_22391 | Ga0400486_22391_96_554 | 150 |
| 59 | 3300044712 | Ga0453684_0840803 | Ga0453684_0840803_183_641 | 150 |
| 60 | 3300049593 | Ga0501077_0456853 | Ga0501077_0456853_296_769 | 150 |
| 61 | 3300009147 | Ga0114129_10051132 | Ga0114129_100511326 | 156 |
| 62 | 3300050507 | nmdc:mga05p37_52438_c1 | nmdc:mga05p37_52438_c1_4186_4665 | 156 |
| 63 | 3300050515 | nmdc:mga0a205_11862_c1 | nmdc:mga0a205_11862_c1_4372_4851 | 156 |
| 64 | 3300005439 | Ga0070711_100104330 | Ga0070711_1001043302 | 160 |
| 65 | 3300005467 | Ga0070706_100183484 | Ga0070706_1001834842 | 160 |
| 66 | 3300005468 | Ga0070707_100046376 | Ga0070707_1000463764 | 160 |
| 67 | 3300005536 | Ga0070697_100041404 | Ga0070697_1000414043 | 160 |
| 68 | 3300005548 | Ga0070665_100123886 | Ga0070665_1001238863 | 160 |
| 69 | 3300006173 | Ga0070716_100059100 | Ga0070716_1000591003 | 160 |
| 70 | 3300006175 | Ga0070712_100047992 | Ga0070712_1000479924 | 160 |
| 71 | 3300025910 | Ga0207684_10053203 | Ga0207684_100532034 | 160 |
| 72 | 3300025916 | Ga0207663_10372688 | Ga0207663_103726882 | 160 |
| 73 | 3300025922 | Ga0207646_10005323 | Ga0207646_1000532312 | 160 |
| 74 | 3300025939 | Ga0207665_10338796 | Ga0207665_103387962 | 160 |
| 75 | 3300028379 | Ga0268266_10386540 | Ga0268266_103865402 | 160 |
| 76 | 3300028800 | Ga0265338_10121318 | Ga0265338_101213181 | 160 |
| 77 | 3300005436 | Ga0070713_100039588 | Ga0070713_1000395881 | 161 |
| 78 | 3300025928 | Ga0207700_10087874 | Ga0207700_100878743 | 161 |
| 79 | 3300046472 | Ga0495580_0180261 | Ga0495580_0180261_856_1389 | 161 |
| 80 | 3300005329 | Ga0070683_100074064 | Ga0070683_1000740644 | 162 |
| 81 | 3300005337 | Ga0070682_100099502 | Ga0070682_1000995023 | 162 |
| 82 | 3300005338 | Ga0068868_100631029 | Ga0068868_1006310291 | 162 |
| 83 | 3300005355 | Ga0070671_100165228 | Ga0070671_1001652282 | 162 |
| 84 | 3300005366 | Ga0070659_100011139 | Ga0070659_1000111394 | 162 |
| 85 | 3300005434 | Ga0070709_10118244 | Ga0070709_101182441 | 162 |
| 86 | 3300005435 | Ga0070714_100612699 | Ga0070714_1006126991 | 162 |
| 87 | 3300005436 | Ga0070713_100221859 | Ga0070713_1002218592 | 162 |
| 88 | 3300005439 | Ga0070711_100330204 | Ga0070711_1003302042 | 162 |
| 89 | 3300005439 | Ga0070711_100349881 | Ga0070711_1003498812 | 162 |
| 90 | 3300005445 | Ga0070708_100004936 | Ga0070708_1000049364 | 162 |
| 91 | 3300005445 | Ga0070708_100007628 | Ga0070708_1000076284 | 162 |
| 92 | 3300005457 | Ga0070662_100424298 | Ga0070662_1004242982 | 162 |
| 93 | 3300005467 | Ga0070706_100061956 | Ga0070706_1000619566 | 162 |
| 94 | 3300005468 | Ga0070707_100623294 | Ga0070707_1006232943 | 162 |
| 95 | 3300005471 | Ga0070698_100464186 | Ga0070698_1004641862 | 162 |
| 96 | 3300005518 | Ga0070699_100061649 | Ga0070699_1000616493 | 162 |
| 97 | 3300005536 | Ga0070697_100001590 | Ga0070697_1000015909 | 162 |
| 98 | 3300005548 | Ga0070665_100325883 | Ga0070665_1003258832 | 162 |
| 99 | 3300005548 | Ga0070665_100939729 | Ga0070665_1009397292 | 162 |
| 100 | 3300005614 | Ga0068856_100019476 | Ga0068856_1000194765 | 162 |
| 101 | 3300005614 | Ga0068856_100059049 | Ga0068856_1000590493 | 162 |
| 102 | 3300005618 | Ga0068864_100079603 | Ga0068864_1000796034 | 162 |
| 103 | 3300005718 | Ga0068866_10251032 | Ga0068866_102510322 | 162 |
| 104 | 3300005719 | Ga0068861_100529477 | Ga0068861_1005294772 | 162 |
| 105 | 3300005834 | Ga0068851_10013264 | Ga0068851_100132641 | 162 |
| 106 | 3300005841 | Ga0068863_100002412 | Ga0068863_1000024127 | 162 |
| 107 | 3300005843 | Ga0068860_101357264 | Ga0068860_1013572642 | 162 |
| 108 | 3300006028 | Ga0070717_10453282 | Ga0070717_104532821 | 162 |
| 109 | 3300006163 | Ga0070715_10571440 | Ga0070715_105714401 | 162 |
| 110 | 3300006163 | Ga0070715_10631095 | Ga0070715_106310951 | 162 |
| 111 | 3300006173 | Ga0070716_100269463 | Ga0070716_1002694632 | 162 |
| 112 | 3300006173 | Ga0070716_100863566 | Ga0070716_1008635661 | 162 |
| 113 | 3300006173 | Ga0070716_101353330 | Ga0070716_1013533301 | 162 |
| 114 | 3300006175 | Ga0070712_100636541 | Ga0070712_1006365412 | 162 |
| 115 | 3300006237 | Ga0097621_100006192 | Ga0097621_1000061924 | 162 |
| 116 | 3300006358 | Ga0068871_100005202 | Ga0068871_1000052029 | 162 |
| 117 | 3300006358 | Ga0068871_101018513 | Ga0068871_1010185132 | 162 |
| 118 | 3300006871 | Ga0075434_100015167 | Ga0075434_1000151675 | 162 |
| 119 | 3300007076 | Ga0075435_100060738 | Ga0075435_1000607383 | 162 |
| 120 | 3300009174 | Ga0105241_10053568 | Ga0105241_100535683 | 162 |
| 121 | 3300009174 | Ga0105241_10569660 | Ga0105241_105696602 | 162 |
| 122 | 3300009176 | Ga0105242_10281370 | Ga0105242_102813702 | 162 |
| 123 | 3300009177 | Ga0105248_11393985 | Ga0105248_113939851 | 162 |
| 124 | 3300009545 | Ga0105237_10072895 | Ga0105237_100728956 | 162 |
| 125 | 3300009551 | Ga0105238_10196335 | Ga0105238_101963352 | 162 |
| 126 | 3300013296 | Ga0157374_10079786 | Ga0157374_100797862 | 162 |
| 127 | 3300013297 | Ga0157378_10012189 | Ga0157378_1001218911 | 162 |
| 128 | 3300013297 | Ga0157378_10151652 | Ga0157378_101516522 | 162 |
| 129 | 3300013307 | Ga0157372_10014205 | Ga0157372_100142052 | 162 |
| 130 | 3300013308 | Ga0157375_10175592 | Ga0157375_101755922 | 162 |
| 131 | 3300014969 | Ga0157376_10367163 | Ga0157376_103671632 | 162 |
| 132 | 3300025321 | Ga0207656_10014967 | Ga0207656_100149672 | 162 |
| 133 | 3300025906 | Ga0207699_10194353 | Ga0207699_101943532 | 162 |
| 134 | 3300025906 | Ga0207699_10277367 | Ga0207699_102773672 | 162 |
| 135 | 3300025906 | Ga0207699_10325899 | Ga0207699_103258992 | 162 |
| 136 | 3300025910 | Ga0207684_10063833 | Ga0207684_100638332 | 162 |
| 137 | 3300025910 | Ga0207684_10298071 | Ga0207684_102980712 | 162 |
| 138 | 3300025911 | Ga0207654_10129784 | Ga0207654_101297842 | 162 |
| 139 | 3300025913 | Ga0207695_10075023 | Ga0207695_100750234 | 162 |
| 140 | 3300025914 | Ga0207671_10387555 | Ga0207671_103875552 | 162 |
| 141 | 3300025915 | Ga0207693_10085637 | Ga0207693_100856372 | 162 |
| 142 | 3300025915 | Ga0207693_10135872 | Ga0207693_101358721 | 162 |
| 143 | 3300025916 | Ga0207663_10298022 | Ga0207663_102980222 | 162 |
| 144 | 3300025916 | Ga0207663_10983639 | Ga0207663_109836392 | 162 |
| 145 | 3300025919 | Ga0207657_10000222 | Ga0207657_100002228 | 162 |
| 146 | 3300025922 | Ga0207646_10201461 | Ga0207646_102014612 | 162 |
| 147 | 3300025924 | Ga0207694_10195804 | Ga0207694_101958042 | 162 |
| 148 | 3300025927 | Ga0207687_10337128 | Ga0207687_103371282 | 162 |
| 149 | 3300025928 | Ga0207700_10311502 | Ga0207700_103115022 | 162 |
| 150 | 3300025941 | Ga0207711_10207072 | Ga0207711_102070722 | 162 |
| 151 | 3300025981 | Ga0207640_10227847 | Ga0207640_102278472 | 162 |
| 152 | 3300026041 | Ga0207639_10356801 | Ga0207639_103568011 | 162 |
| 153 | 3300026088 | Ga0207641_10003924 | Ga0207641_1000392412 | 162 |
| 154 | 3300026095 | Ga0207676_10057024 | Ga0207676_100570243 | 162 |
| 155 | 3300026142 | Ga0207698_10071828 | Ga0207698_100718282 | 162 |
| 156 | 3300027671 | Ga0209588_1016031 | Ga0209588_10160313 | 162 |
| 157 | 3300028379 | Ga0268266_10664456 | Ga0268266_106644562 | 162 |
| 158 | 3300028379 | Ga0268266_11405345 | Ga0268266_114053451 | 162 |
| 159 | 3300028800 | Ga0265338_10004414 | Ga0265338_1000441410 | 162 |
| 160 | 3300028800 | Ga0265338_10094279 | Ga0265338_100942792 | 162 |
| 161 | 3300031249 | Ga0265339_10505954 | Ga0265339_105059541 | 162 |
| 162 | 3300035170 | Ga0373943_0270485 | Ga0373943_0270485_411_902 | 162 |
| 163 | 3300035692 | Ga0373935_0048221 | Ga0373935_0048221_1875_2366 | 162 |
| 164 | 3300035695 | Ga0373927_0011977 | Ga0373927_0011977_2526_3017 | 162 |
| 165 | 3300037068 | Ga0373925_0000125 | Ga0373925_0000125_39836_40327 | 162 |
| 166 | 3300042876 | Ga0451577_0248650 | Ga0451577_0248650_141_635 | 162 |
| 167 | 3300044712 | Ga0453684_0272155 | Ga0453684_0272155_295_789 | 162 |
| 168 | 3300046472 | Ga0495580_0010700 | Ga0495580_0010700_1663_2202 | 162 |
| 169 | 3300046472 | Ga0495580_0231770 | Ga0495580_0231770_289_777 | 162 |
| 170 | 3300046472 | Ga0495580_0493544 | Ga0495580_0493544_115_606 | 162 |
| 171 | 3300046517 | Ga0495630_0005588 | Ga0495630_0005588_1023_1514 | 162 |
| 172 | 3300046663 | Ga0495635_0296869 | Ga0495635_0296869_369_860 | 162 |
| 173 | 3300046684 | Ga0495669_0449821 | Ga0495669_0449821_84_575 | 162 |
| 174 | 3300046809 | Ga0495600_0509806 | Ga0495600_0509806_126_617 | 162 |
| 175 | 3300048903 | Ga0496100_0084723 | Ga0496100_0084723_482_973 | 162 |
| 176 | 3300048903 | Ga0496100_0130534 | Ga0496100_0130534_1191_1679 | 162 |
| 177 | 3300048904 | Ga0496101_0005939 | Ga0496101_0005939_6500_6991 | 162 |
| 178 | 3300048905 | Ga0496102_0103735 | Ga0496102_0103735_606_1097 | 162 |
| 179 | 3300048905 | Ga0496102_0537612 | Ga0496102_0537612_338_826 | 162 |
| 180 | 3300048907 | Ga0496104_0040753 | Ga0496104_0040753_3119_3610 | 162 |
| 181 | 3300048907 | Ga0496104_0417673 | Ga0496104_0417673_325_813 | 162 |
| 182 | 3300048908 | Ga0496105_0211612 | Ga0496105_0211612_410_901 | 162 |
| 183 | 3300048909 | Ga0496106_0122022 | Ga0496106_0122022_38_526 | 162 |
| 184 | 3300048910 | Ga0496107_0312551 | Ga0496107_0312551_530_1021 | 162 |
| 185 | 3300048911 | Ga0496108_0101872 | Ga0496108_0101872_229_720 | 162 |
| 186 | 3300048913 | Ga0496110_0042272 | Ga0496110_0042272_2846_3334 | 162 |
| 187 | 3300048915 | Ga0496112_0265179 | Ga0496112_0265179_683_1174 | 162 |
| 188 | 3300048917 | Ga0496114_0001136 | Ga0496114_0001136_9286_9777 | 162 |
| 189 | 3300048917 | Ga0496114_0146900 | Ga0496114_0146900_37_528 | 162 |
| 190 | 3300048918 | Ga0496115_0001411 | Ga0496115_0001411_5656_6147 | 162 |
| 191 | 3300048918 | Ga0496115_0027564 | Ga0496115_0027564_1388_1879 | 162 |
| 192 | 3300049743 | Ga0501081_1308490 | Ga0501081_1308490_42_536 | 162 |
| 193 | 3300050512 | nmdc:mga0n895_8863_c2 | nmdc:mga0n895_8863_c2_3499_3990 | 162 |
| 194 | 3300050513 | nmdc:mga0rr50_32147_c1 | nmdc:mga0rr50_32147_c1_41_532 | 162 |
| 195 | 3300053078 | Ga0495612_0139178 | Ga0495612_0139178_407_898 | 162 |
| 196 | 3300053084 | Ga0495595_0205473 | Ga0495595_0205473_40_531 | 162 |
| 197 | 3300053085 | Ga0495619_0042064 | Ga0495619_0042064_2096_2587 | 162 |
| 198 | 3300053091 | Ga0500647_0024709 | Ga0500647_0024709_1206_1709 | 162 |
| 199 | 3300026078 | Ga0207702_10067649 | Ga0207702_100676493 | 163 |
| 200 | 3300031241 | Ga0265325_10082079 | Ga0265325_100820792 | 163 |
| 201 | 3300031247 | Ga0265340_10494764 | Ga0265340_104947641 | 163 |
| 202 | 3300047470 | Ga0495681_0207218 | Ga0495681_0207218_203_694 | 163 |
| 203 | 3300048913 | Ga0496110_1205985 | Ga0496110_1205985_64_555 | 163 |
| 204 | 3300005437 | Ga0070710_10029363 | Ga0070710_100293634 | 164 |
| 205 | 3300006173 | Ga0070716_100003978 | Ga0070716_1000039788 | 164 |
| 206 | 3300025939 | Ga0207665_10007473 | Ga0207665_100074737 | 164 |
| 207 | iso_pu_bacteria | 2897803580 | 2897807791 | 164 |
| 208 | 3300005328 | Ga0070676_10133592 | Ga0070676_101335922 | 166 |
| 209 | 3300005331 | Ga0070670_100865747 | Ga0070670_1008657471 | 166 |
| 210 | 3300005335 | Ga0070666_10164743 | Ga0070666_101647432 | 166 |
| 211 | 3300005338 | Ga0068868_100032127 | Ga0068868_1000321273 | 166 |
| 212 | 3300005347 | Ga0070668_100114967 | Ga0070668_1001149673 | 166 |
| 213 | 3300005356 | Ga0070674_100413428 | Ga0070674_1004134282 | 166 |
| 214 | 3300005367 | Ga0070667_100386913 | Ga0070667_1003869133 | 166 |
| 215 | 3300005435 | Ga0070714_100124464 | Ga0070714_1001244643 | 166 |
| 216 | 3300005436 | Ga0070713_100028894 | Ga0070713_1000288946 | 166 |
| 217 | 3300005441 | Ga0070700_100117804 | Ga0070700_1001178042 | 166 |
| 218 | 3300005441 | Ga0070700_100604018 | Ga0070700_1006040181 | 166 |
| 219 | 3300005445 | Ga0070708_100010288 | Ga0070708_1000102884 | 166 |
| 220 | 3300005445 | Ga0070708_100022474 | Ga0070708_1000224744 | 166 |
| 221 | 3300005459 | Ga0068867_100680707 | Ga0068867_1006807071 | 166 |
| 222 | 3300005467 | Ga0070706_100000556 | Ga0070706_1000005565 | 166 |
| 223 | 3300005468 | Ga0070707_100006391 | Ga0070707_10000639113 | 166 |
| 224 | 3300005471 | Ga0070698_100002213 | Ga0070698_10000221324 | 166 |
| 225 | 3300005518 | Ga0070699_100002908 | Ga0070699_1000029088 | 166 |
| 226 | 3300005536 | Ga0070697_100004925 | Ga0070697_1000049257 | 166 |
| 227 | 3300005536 | Ga0070697_100060353 | Ga0070697_1000603532 | 166 |
| 228 | 3300005536 | Ga0070697_100098429 | Ga0070697_1000984293 | 166 |
| 229 | 3300005578 | Ga0068854_100085863 | Ga0068854_1000858634 | 166 |
| 230 | 3300005718 | Ga0068866_10152884 | Ga0068866_101528843 | 166 |
| 231 | 3300005842 | Ga0068858_100169142 | Ga0068858_1001691423 | 166 |
| 232 | 3300005842 | Ga0068858_100825259 | Ga0068858_1008252592 | 166 |
| 233 | 3300005843 | Ga0068860_100464457 | Ga0068860_1004644572 | 166 |
| 234 | 3300005844 | Ga0068862_100006475 | Ga0068862_1000064756 | 166 |
| 235 | 3300006028 | Ga0070717_10030339 | Ga0070717_100303394 | 166 |
| 236 | 3300006237 | Ga0097621_100065110 | Ga0097621_1000651103 | 166 |
| 237 | 3300006358 | Ga0068871_100006041 | Ga0068871_1000060413 | 166 |
| 238 | 3300009098 | Ga0105245_10031617 | Ga0105245_100316173 | 166 |
| 239 | 3300009177 | Ga0105248_10658820 | Ga0105248_106588202 | 166 |
| 240 | 3300009551 | Ga0105238_10935741 | Ga0105238_109357412 | 166 |
| 241 | 3300010375 | Ga0105239_10079599 | Ga0105239_100795992 | 166 |
| 242 | 3300013100 | Ga0157373_10052246 | Ga0157373_100522464 | 166 |
| 243 | 3300013105 | Ga0157369_10380399 | Ga0157369_103803992 | 166 |
| 244 | 3300013297 | Ga0157378_10003764 | Ga0157378_100037649 | 166 |
| 245 | 3300013306 | Ga0163162_10071298 | Ga0163162_100712982 | 166 |
| 246 | 3300014969 | Ga0157376_10033125 | Ga0157376_100331252 | 166 |
| 247 | 3300014969 | Ga0157376_10659978 | Ga0157376_106599782 | 166 |
| 248 | 3300020080 | Ga0206350_11566209 | Ga0206350_115662092 | 166 |
| 249 | 3300024227 | Ga0228598_1003719 | Ga0228598_10037192 | 166 |
| 250 | 3300025903 | Ga0207680_10153514 | Ga0207680_101535142 | 166 |
| 251 | 3300025903 | Ga0207680_10346617 | Ga0207680_103466172 | 166 |
| 252 | 3300025909 | Ga0207705_10605104 | Ga0207705_106051041 | 166 |
| 253 | 3300025910 | Ga0207684_10003347 | Ga0207684_100033473 | 166 |
| 254 | 3300025922 | Ga0207646_10000341 | Ga0207646_1000034125 | 166 |
| 255 | 3300025926 | Ga0207659_10416896 | Ga0207659_104168962 | 166 |
| 256 | 3300025928 | Ga0207700_10053975 | Ga0207700_100539753 | 166 |
| 257 | 3300025928 | Ga0207700_10065819 | Ga0207700_100658194 | 166 |
| 258 | 3300025929 | Ga0207664_10119606 | Ga0207664_101196062 | 166 |
| 259 | 3300025929 | Ga0207664_10548894 | Ga0207664_105488942 | 166 |
| 260 | 3300025932 | Ga0207690_10427764 | Ga0207690_104277641 | 166 |
| 261 | 3300025933 | Ga0207706_10222288 | Ga0207706_102222882 | 166 |
| 262 | 3300025972 | Ga0207668_10027678 | Ga0207668_100276784 | 166 |
| 263 | 3300025981 | Ga0207640_10164463 | Ga0207640_101644632 | 166 |
| 264 | 3300026075 | Ga0207708_10011540 | Ga0207708_100115406 | 166 |
| 265 | 3300026075 | Ga0207708_10810351 | Ga0207708_108103512 | 166 |
| 266 | 3300026118 | Ga0207675_100012314 | Ga0207675_1000123143 | 166 |
| 267 | 3300027614 | Ga0209970_1000200 | Ga0209970_10002005 | 166 |
| 268 | 3300028017 | Ga0265356_1018134 | Ga0265356_10181342 | 166 |
| 269 | 3300028380 | Ga0268265_10057434 | Ga0268265_100574344 | 166 |
| 270 | 3300028380 | Ga0268265_10676720 | Ga0268265_106767202 | 166 |
| 271 | 3300028381 | Ga0268264_10764139 | Ga0268264_107641392 | 166 |
| 272 | 3300030878 | Ga0265770_1009646 | Ga0265770_10096461 | 166 |
| 273 | 3300031090 | Ga0265760_10000219 | Ga0265760_100002194 | 166 |
| 274 | 3300031090 | Ga0265760_10002540 | Ga0265760_100025406 | 166 |
| 275 | 3300046472 | Ga0495580_0004871 | Ga0495580_0004871_7001_7513 | 166 |
| 276 | 3300046472 | Ga0495580_0213163 | Ga0495580_0213163_236_751 | 166 |
| 277 | 3300046684 | Ga0495669_0202931 | Ga0495669_0202931_246_758 | 166 |
| 278 | 3300048903 | Ga0496100_0069126 | Ga0496100_0069126_205_729 | 166 |
| 279 | 3300048910 | Ga0496107_0059445 | Ga0496107_0059445_1943_2467 | 166 |
| 280 | 3300048918 | Ga0496115_0115541 | Ga0496115_0115541_1158_1682 | 166 |
| 281 | 3300049570 | Ga0501033_0034475 | Ga0501033_0034475_1072_1608 | 166 |
| 282 | 3300049575 | Ga0501039_0960344 | Ga0501039_0960344_91_627 | 166 |
| 283 | 3300049576 | Ga0501040_0114203 | Ga0501040_0114203_338_874 | 166 |
| 284 | 3300049577 | Ga0501041_0002727 | Ga0501041_0002727_3869_4405 | 166 |
| 285 | 3300049578 | Ga0501042_0014640 | Ga0501042_0014640_4782_5318 | 166 |
| 286 | 3300049579 | Ga0501043_0239463 | Ga0501043_0239463_847_1383 | 166 |
| 287 | 3300049580 | Ga0501046_0187095 | Ga0501046_0187095_984_1520 | 166 |
| 288 | 3300049582 | Ga0501048_0233128 | Ga0501048_0233128_259_795 | 166 |
| 289 | 3300049587 | Ga0501071_0045186 | Ga0501071_0045186_967_1503 | 166 |
| 290 | 3300049588 | Ga0501072_0006475 | Ga0501072_0006475_7867_8403 | 166 |
| 291 | 3300049589 | Ga0501073_0176196 | Ga0501073_0176196_159_695 | 166 |
| 292 | 3300049590 | Ga0501074_0127249 | Ga0501074_0127249_361_897 | 166 |
| 293 | 3300049591 | Ga0501075_0112082 | Ga0501075_0112082_1330_1866 | 166 |
| 294 | 3300049592 | Ga0501076_0022335 | Ga0501076_0022335_1528_2064 | 166 |
| 295 | 3300049593 | Ga0501077_0011392 | Ga0501077_0011392_4930_5466 | 166 |
| 296 | 3300049741 | Ga0501079_0053799 | Ga0501079_0053799_1628_2164 | 166 |
| 297 | 3300049742 | Ga0501080_0121858 | Ga0501080_0121858_615_1151 | 166 |
| 298 | 3300049744 | Ga0501083_0163796 | Ga0501083_0163796_639_1175 | 166 |
| 299 | 3300053148 | Ga0500590_089939 | Ga0500590_089939_24_536 | 166 |
| 300 | 3300054114 | Ga0501084_0014173 | Ga0501084_0014173_985_1521 | 166 |
| 301 | 3300060353 | Ga0501082_0031267 | Ga0501082_0031267_863_1399 | 166 |
| 302 | 3300061734 | Ga0530510_0001427 | Ga0530510_0001427_8401_8937 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p6m-assembly1.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus | 0.9424 | 3 | 142 |
| 8p6m-assembly1.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus | 0.9285 | 3 | 142 |
| 8p6m-assembly1.cif.gz_A | arsenate reductase (arsc2) from deinococcus indicus | 0.9237 | 3 | 141 |
| 8p5n-assembly2.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate | 0.9217 | 3 | 142 |
| 8p5n-assembly2.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate | 0.9152 | 3 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2myuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8708 | 5 | 141 | 3.40.50.2300 |
| 1y1lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.863 | 6 | 142 | 3.40.50.2300 |
| 1jl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8574 | 4 | 140 | 3.40.50.2300 |
| 1jl3C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8563 | 5 | 140 | 3.40.50.2300 |
| 1y1lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8501 | 6 | 142 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A511XQ01-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 0.9926 | 3 | 161 |
GO:0004726
GO:0008794 GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A534H569-F1-model_v4 | GNAT family N-acetyltransferase | 0.9904 | 3 | 164 |
GO:0004726
GO:0016747 GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A317EFU8-F1-model_v4 | ArsR family transcriptional regulator | 0.9893 | 3 | 162 |
GO:0003700
GO:0004726 GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A7U7EJV0-F1-model_v4 | Arsenate reductase (EC 1.20.4.4) | 0.9887 | 2 | 162 |
GO:0016491
GO:0046685 |
| AF-A0A534HPT7-F1-model_v4 | GNAT family N-acetyltransferase | 0.9887 | 3 | 163 |
GO:0004726
GO:0016747 GO:0030946 GO:0046685 GO:0140793 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar