F396652

General Info

Members Datasets Scaffolds Average Seq Length
302 189 301 163

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0180261|Ga0495580_0180261_856_1389
Length 177
Sequence MPNATHHYNVLFLCTGNSARSIMAEALMNFKGAPQFTAYSAGSHASGKVRPEALQRLEAAHIPVDGLRSKSWDEFALPDAPKMDFVFTVCDNAAKEVCPIWFPHPSKTAKDGAPGPLTAHWGVPDPAGVQGSPQEIDRTFREAFSILERRIGLLLSLPLASLDRLAIKKSVDEIGRQ

Samples

Sample ID Description Type Environment
1 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
186 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.32
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 9.27
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10133592 3300005328 Bacteria 1572
2 Ga0070683_100074064 3300005329 Bacteria 3180
3 Ga0070670_100865747 3300005331 Bacteria 818
4 Ga0070666_10164743 3300005335 Bacteria 1550
5 Ga0070682_100099502 3300005337 Bacteria 1917
6 Ga0068868_100032127 3300005338 Bacteria 4036
7 Ga0068868_100631029 3300005338 Bacteria 952
8 Ga0070668_100114967 3300005347 Bacteria 2145
9 Ga0070671_100165228 3300005355 Bacteria 1871
10 Ga0070674_100413428 3300005356 Bacteria 1105
11 Ga0070659_100011139 3300005366 Bacteria 6641
12 Ga0070667_100386913 3300005367 Bacteria 1271
13 Ga0070709_10118244 3300005434 Bacteria 1792
14 Ga0070709_10190667 3300005434 Bacteria 1445
15 Ga0070714_100124464 3300005435 Bacteria 2296
16 Ga0070714_100612699 3300005435 Bacteria 1046
17 Ga0070713_100028894 3300005436 Bacteria 4382
18 Ga0070713_100039588 3300005436 Bacteria 3826
19 Ga0070713_100085451 3300005436 Bacteria 2703
20 Ga0070713_100221859 3300005436 Bacteria 1715
21 Ga0070710_10029363 3300005437 Bacteria 2950
22 Ga0070711_100104330 3300005439 Bacteria 2068
23 Ga0070711_100330204 3300005439 Bacteria 1221
24 Ga0070711_100349881 3300005439 Bacteria 1188
25 Ga0070700_100117804 3300005441 Bacteria 1775
26 Ga0070700_100604018 3300005441 Bacteria 860
27 Ga0070708_100004936 3300005445 Bacteria 10549
28 Ga0070708_100007628 3300005445 Bacteria 8667
29 Ga0070708_100010288 3300005445 Bacteria 7574
30 Ga0070708_100022474 3300005445 Bacteria 5350
31 Ga0070663_101383791 3300005455 Bacteria 623
32 Ga0070662_100424298 3300005457 Bacteria 1101
33 Ga0068867_100680707 3300005459 Bacteria 906
34 Ga0070706_100000556 3300005467 Bacteria 43474
35 Ga0070706_100061956 3300005467 Bacteria 3455
36 Ga0070706_100183484 3300005467 Bacteria 1954
37 Ga0070707_100006391 3300005468 Bacteria 10955
38 Ga0070707_100046376 3300005468 Bacteria 4159
39 Ga0070707_100623294 3300005468 Unclassified 1041
40 Ga0070698_100002213 3300005471 Bacteria 21527
41 Ga0070698_100464186 3300005471 Bacteria 1202
42 Ga0070699_100002908 3300005518 Bacteria 15244
43 Ga0070699_100061649 3300005518 Bacteria 3250
44 Ga0070697_100001590 3300005536 Bacteria 17330
45 Ga0070697_100004925 3300005536 Bacteria 10243
46 Ga0070697_100041404 3300005536 Bacteria 3728
47 Ga0070697_100060353 3300005536 Bacteria 3091
48 Ga0070697_100098429 3300005536 Bacteria 2427
49 Ga0070665_100123886 3300005548 Bacteria 2587
50 Ga0070665_100325883 3300005548 Bacteria 1540
51 Ga0070665_100939729 3300005548 Bacteria 877
52 Ga0068854_100085863 3300005578 Bacteria 2331
53 Ga0068856_100019476 3300005614 Bacteria 6587
54 Ga0068856_100059049 3300005614 Bacteria 3788
55 Ga0068864_100079603 3300005618 Bacteria 2869
56 Ga0068866_10152884 3300005718 Bacteria 1338
57 Ga0068866_10251032 3300005718 Bacteria 1082
58 Ga0068861_100529477 3300005719 Bacteria 1070
59 Ga0068851_10013264 3300005834 Bacteria 3899
60 Ga0068863_100002412 3300005841 Bacteria 18565
61 Ga0068858_100169142 3300005842 Bacteria 2060
62 Ga0068858_100825259 3300005842 Bacteria 905
63 Ga0068860_100464457 3300005843 Bacteria 1260
64 Ga0068860_101357264 3300005843 Bacteria 732
65 Ga0068862_100006475 3300005844 Bacteria 9725
66 Ga0070717_10030339 3300006028 Bacteria 4343
67 Ga0070717_10453282 3300006028 Bacteria 1156
68 Ga0070715_10571440 3300006163 Unclassified 658
69 Ga0070715_10631095 3300006163 Unclassified 632
70 Ga0070716_100003978 3300006173 Bacteria 7014
71 Ga0070716_100059100 3300006173 Bacteria 2209
72 Ga0070716_100269463 3300006173 Bacteria 1169
73 Ga0070716_100762579 3300006173 Eukaryota 745
74 Ga0070716_100863566 3300006173 Unclassified 705
75 Ga0070716_101353330 3300006173 Bacteria 577
76 Ga0070712_100047992 3300006175 Bacteria 2958
77 Ga0070712_100636541 3300006175 Unclassified 905
78 Ga0097621_100006192 3300006237 Bacteria 8482
79 Ga0097621_100065110 3300006237 Bacteria 2999
80 Ga0068871_100005202 3300006358 Bacteria 9098
81 Ga0068871_100006041 3300006358 Bacteria 8522
82 Ga0068871_101018513 3300006358 Bacteria 772
83 Ga0075434_100015167 3300006871 Bacteria 7383
84 Ga0075435_100060738 3300007076 Bacteria 3065
85 Ga0105240_10201327 3300009093 Bacteria 2333
86 Ga0105245_10031617 3300009098 Bacteria 4685
87 Ga0105247_10565887 3300009101 Bacteria 838
88 Ga0114129_10051132 3300009147 Bacteria 5803
89 Ga0105241_10007197 3300009174 Bacteria 8190
90 Ga0105241_10053568 3300009174 Bacteria 3086
91 Ga0105241_10569660 3300009174 Bacteria 1019
92 Ga0105242_10281370 3300009176 Bacteria 1511
93 Ga0105248_10190624 3300009177 Bacteria 2310
94 Ga0105248_10658820 3300009177 Bacteria 1181
95 Ga0105248_11393985 3300009177 Bacteria 793
96 Ga0105237_10072895 3300009545 Bacteria 3427
97 Ga0105238_10045537 3300009551 Bacteria 4431
98 Ga0105238_10196335 3300009551 Bacteria 1994
99 Ga0105238_10935741 3300009551 Bacteria 886
100 Ga0105239_10079599 3300010375 Bacteria 3606
101 Ga0105239_11608819 3300010375 Bacteria 751
102 Ga0157373_10052246 3300013100 Bacteria 2909
103 Ga0157373_10074002 3300013100 Bacteria 2403
104 Ga0157371_10853580 3300013102 Bacteria 688
105 Ga0157369_10017115 3300013105 Bacteria 8146
106 Ga0157369_10380399 3300013105 Bacteria 1465
107 Ga0157374_10079786 3300013296 Bacteria 3102
108 Ga0157378_10003764 3300013297 Bacteria 13444
109 Ga0157378_10012189 3300013297 Bacteria 7529
110 Ga0157378_10019357 3300013297 Bacteria 5985
111 Ga0157378_10151652 3300013297 Bacteria 2160
112 Ga0163162_10071298 3300013306 Bacteria 3527
113 Ga0163162_10194879 3300013306 Bacteria 2154
114 Ga0157372_10014205 3300013307 Bacteria 8509
115 Ga0157375_10175592 3300013308 Bacteria 2291
116 Ga0157380_10802738 3300014326 Bacteria 958
117 Ga0182008_10014783 3300014497 Bacteria 4082
118 Ga0157376_10033125 3300014969 Bacteria 4156
119 Ga0157376_10367163 3300014969 Bacteria 1382
120 Ga0157376_10659978 3300014969 Bacteria 1047
121 Ga0182007_10003559 3300015262 Bacteria 7328
122 Ga0206350_11566209 3300020080 Bacteria 1941
123 Ga0228598_1003719 3300024227 Bacteria 3263
124 Ga0207656_10014967 3300025321 Bacteria 2998
125 Ga0207680_10153514 3300025903 Bacteria 1537
126 Ga0207680_10346617 3300025903 Bacteria 1043
127 Ga0207699_10194353 3300025906 Bacteria 1371
128 Ga0207699_10277367 3300025906 Bacteria 1164
129 Ga0207699_10325899 3300025906 Bacteria 1079
130 Ga0207705_10605104 3300025909 Bacteria 852
131 Ga0207684_10003347 3300025910 Bacteria 15715
132 Ga0207684_10053203 3300025910 Bacteria 3437
133 Ga0207684_10063833 3300025910 Bacteria 3126
134 Ga0207684_10298071 3300025910 Bacteria 1390
135 Ga0207654_10129784 3300025911 Bacteria 1594
136 Ga0207695_10075023 3300025913 Bacteria 3442
137 Ga0207671_10387555 3300025914 Unclassified 1111
138 Ga0207693_10085637 3300025915 Bacteria 2468
139 Ga0207693_10135872 3300025915 Bacteria 1933
140 Ga0207663_10298022 3300025916 Bacteria 1204
141 Ga0207663_10372688 3300025916 Bacteria 1086
142 Ga0207663_10983639 3300025916 Bacteria 676
143 Ga0207657_10000222 3300025919 Bacteria 59330
144 Ga0207646_10000341 3300025922 Bacteria 63056
145 Ga0207646_10005323 3300025922 Bacteria 13566
146 Ga0207646_10201461 3300025922 Bacteria 1798
147 Ga0207694_10195804 3300025924 Bacteria 1643
148 Ga0207659_10416896 3300025926 Bacteria 1125
149 Ga0207687_10337128 3300025927 Bacteria 1225
150 Ga0207700_10053975 3300025928 Bacteria 3014
151 Ga0207700_10065819 3300025928 Bacteria 2767
152 Ga0207700_10087874 3300025928 Bacteria 2445
153 Ga0207700_10311502 3300025928 Bacteria 1362
154 Ga0207700_10806080 3300025928 Bacteria 840
155 Ga0207700_10863312 3300025928 Bacteria 810
156 Ga0207664_10119606 3300025929 Bacteria 2202
157 Ga0207664_10548894 3300025929 Bacteria 1037
158 Ga0207690_10427764 3300025932 Bacteria 1060
159 Ga0207706_10222288 3300025933 Bacteria 1653
160 Ga0207665_10007473 3300025939 Bacteria 7223
161 Ga0207665_10095054 3300025939 Bacteria 2071
162 Ga0207665_10338796 3300025939 Bacteria 1133
163 Ga0207711_10207072 3300025941 Bacteria 1791
164 Ga0207668_10027678 3300025972 Bacteria 3696
165 Ga0207640_10164463 3300025981 Bacteria 1646
166 Ga0207640_10227847 3300025981 Bacteria 1431
167 Ga0207639_10356801 3300026041 Bacteria 1307
168 Ga0207708_10011540 3300026075 Bacteria 6583
169 Ga0207708_10810351 3300026075 Bacteria 806
170 Ga0207702_10067649 3300026078 Bacteria 3066
171 Ga0207641_10003924 3300026088 Bacteria 13006
172 Ga0207676_10057024 3300026095 Bacteria 3075
173 Ga0207675_100012314 3300026118 Bacteria 7990
174 Ga0207698_10071828 3300026142 Bacteria 2748
175 Ga0209970_1000200 3300027614 Bacteria 9568
176 Ga0209588_1016031 3300027671 Bacteria 2309
177 Ga0265356_1018134 3300028017 Bacteria 761
178 Ga0268266_10386540 3300028379 Bacteria 1321
179 Ga0268266_10664456 3300028379 Bacteria 1003
180 Ga0268266_11405345 3300028379 Bacteria 673
181 Ga0268265_10057434 3300028380 Bacteria 2966
182 Ga0268265_10676720 3300028380 Bacteria 994
183 Ga0268264_10764139 3300028381 Bacteria 964
184 Ga0265319_1061655 3300028563 Bacteria 1216
185 Ga0265319_1202261 3300028563 Bacteria 609
186 Ga0265318_10168229 3300028577 Bacteria 803
187 Ga0265338_10004414 3300028800 Bacteria 19018
188 Ga0265338_10094279 3300028800 Bacteria 2463
189 Ga0265338_10121318 3300028800 Bacteria 2083
190 Ga0265770_1009646 3300030878 Bacteria 1393
191 Ga0265760_10000219 3300031090 Bacteria 15517
192 Ga0265760_10002540 3300031090 Bacteria 5326
193 Ga0265332_10114643 3300031238 Bacteria 1134
194 Ga0265332_10152556 3300031238 Bacteria 966
195 Ga0265328_10006632 3300031239 Bacteria 4874
196 Ga0265320_10004428 3300031240 Bacteria 9210
197 Ga0265320_10006977 3300031240 Bacteria 7047
198 Ga0265325_10082079 3300031241 Bacteria 1600
199 Ga0265340_10494764 3300031247 Bacteria 538
200 Ga0265339_10505954 3300031249 Bacteria 557
201 Ga0265331_10000641 3300031250 Bacteria 30240
202 Ga0265327_10003316 3300031251 Bacteria 15582
203 Ga0265327_10086665 3300031251 Bacteria 1535
204 Ga0265316_10153745 3300031344 Bacteria 1722
205 Ga0265313_10167374 3300031595 Bacteria 930
206 Ga0265313_10255665 3300031595 Bacteria 713
207 Ga0265314_10010377 3300031711 Bacteria 7776
208 Ga0265314_10068145 3300031711 Bacteria 2393
209 Ga0265314_10141798 3300031711 Bacteria 1484
210 Ga0373934_0172701 3300035086 Bacteria 887
211 Ga0373936_0413466 3300035113 Unclassified 620
212 Ga0373943_0270485 3300035170 Unclassified 958
213 Ga0373935_0048221 3300035692 Bacteria 2697
214 Ga0373927_0011977 3300035695 Bacteria 5769
215 Ga0373933_0028176 3300035724 Bacteria 3239
216 Ga0373925_0000125 3300037068 Bacteria 83446
217 Ga0373925_0008406 3300037068 Bacteria 7515
218 Ga0400486_22391 3300038742 Bacteria 2527
219 Ga0436360_1367918 3300039438 Bacteria 708
220 Ga0439441_002240 3300042001 Bacteria 2698
221 Ga0451577_0248650 3300042876 Bacteria 1609
222 Ga0453684_0272155 3300044712 Bacteria 1935
223 Ga0453684_0840803 3300044712 Bacteria 987
224 Ga0495580_0004871 3300046472 Bacteria 11224
225 Ga0495580_0010700 3300046472 Bacteria 7126
226 Ga0495580_0098369 3300046472 Bacteria 2035
227 Ga0495580_0180261 3300046472 Bacteria 1459
228 Ga0495580_0213163 3300046472 Bacteria 1328
229 Ga0495580_0231770 3300046472 Bacteria 1268
230 Ga0495580_0493544 3300046472 Bacteria 818
231 Ga0495582_0833359 3300046473 Bacteria 533
232 Ga0495584_0024840 3300046491 Bacteria 3038
233 Ga0495630_0005588 3300046517 Bacteria 8878
234 Ga0495635_0296869 3300046663 Bacteria 1084
235 Ga0495669_0202931 3300046684 Bacteria 948
236 Ga0495669_0449821 3300046684 Bacteria 625
237 Ga0495600_0509806 3300046809 Bacteria 738
238 Ga0495681_0207218 3300047470 Bacteria 792
239 Ga0496100_0069126 3300048903 Bacteria 2351
240 Ga0496100_0084723 3300048903 Bacteria 2149
241 Ga0496100_0130534 3300048903 Bacteria 1769
242 Ga0496101_0005939 3300048904 Bacteria 7820
243 Ga0496102_0103735 3300048905 Bacteria 2644
244 Ga0496102_0537612 3300048905 Unclassified 1091
245 Ga0496104_0040753 3300048907 Bacteria 4354
246 Ga0496104_0214442 3300048907 Bacteria 1837
247 Ga0496104_0417673 3300048907 Bacteria 1254
248 Ga0496105_0168718 3300048908 Bacteria 1795
249 Ga0496105_0211612 3300048908 Bacteria 1580
250 Ga0496106_0122022 3300048909 Bacteria 2037
251 Ga0496107_0059445 3300048910 Bacteria 2766
252 Ga0496107_0312551 3300048910 Bacteria 1169
253 Ga0496108_0101872 3300048911 Bacteria 2450
254 Ga0496108_1720464 3300048911 Unclassified 516
255 Ga0496110_0042272 3300048913 Bacteria 3978
256 Ga0496110_1205985 3300048913 Bacteria 666
257 Ga0496111_0148133 3300048914 Bacteria 1740
258 Ga0496112_0130347 3300048915 Bacteria 2485
259 Ga0496112_0265179 3300048915 Bacteria 1666
260 Ga0496112_0680658 3300048915 Bacteria 957
261 Ga0496113_0185565 3300048916 Bacteria 1649
262 Ga0496114_0001136 3300048917 Bacteria 20130
263 Ga0496114_0146900 3300048917 Bacteria 2044
264 Ga0496115_0001411 3300048918 Bacteria 17189
265 Ga0496115_0027564 3300048918 Bacteria 4445
266 Ga0496115_0115541 3300048918 Bacteria 2207
267 Ga0501033_0034475 3300049570 Bacteria 3797
268 Ga0501039_0960344 3300049575 Bacteria 664
269 Ga0501040_0114203 3300049576 Bacteria 1890
270 Ga0501041_0002727 3300049577 Bacteria 10078
271 Ga0501042_0014640 3300049578 Bacteria 5357
272 Ga0501043_0239463 3300049579 Bacteria 1400
273 Ga0501046_0187095 3300049580 Bacteria 1546
274 Ga0501048_0233128 3300049582 Bacteria 1306
275 Ga0501071_0045186 3300049587 Bacteria 3161
276 Ga0501072_0006475 3300049588 Bacteria 8918
277 Ga0501073_0176196 3300049589 Bacteria 1480
278 Ga0501074_0127249 3300049590 Bacteria 1823
279 Ga0501075_0112082 3300049591 Bacteria 2074
280 Ga0501076_0022335 3300049592 Bacteria 4863
281 Ga0501077_0011392 3300049593 Bacteria 5553
282 Ga0501077_0456853 3300049593 Bacteria 818
283 Ga0501079_0053799 3300049741 Bacteria 3105
284 Ga0501080_0121858 3300049742 Bacteria 2416
285 Ga0501081_1308490 3300049743 Bacteria 550
286 Ga0501083_0163796 3300049744 Bacteria 1454
287 nmdc:mga05p37_52438_c1 3300050507 Bacteria 5016
288 nmdc:mga0n895_8863_c2 3300050512 Bacteria 6658
289 nmdc:mga0rr50_32147_c1 3300050513 Bacteria 3735
290 nmdc:mga0a205_11862_c1 3300050515 Bacteria 8043
291 nmdc:mga0a205_55307_c1 3300050515 Bacteria 3833
292 Ga0495601_0057103 3300053077 Bacteria 2473
293 Ga0495612_0139178 3300053078 Bacteria 1052
294 Ga0495655_0260865 3300053083 Bacteria 585
295 Ga0495595_0205473 3300053084 Bacteria 981
296 Ga0495619_0042064 3300053085 Bacteria 2991
297 Ga0500647_0024709 3300053091 Bacteria 2827
298 Ga0500590_089939 3300053148 Bacteria 1492
299 Ga0501084_0014173 3300054114 Bacteria 6601
300 Ga0501082_0031267 3300060353 Bacteria 4589
301 Ga0530510_0001427 3300061734 Bacteria 16004

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042001 Ga0439441_002240 Ga0439441_002240_790_1218 142
2 3300005455 Ga0070663_101383791 Ga0070663_1013837911 144
3 3300006173 Ga0070716_100762579 Ga0070716_1007625792 144
4 3300009093 Ga0105240_10201327 Ga0105240_102013273 144
5 3300009101 Ga0105247_10565887 Ga0105247_105658872 144
6 3300009174 Ga0105241_10007197 Ga0105241_100071977 144
7 3300009177 Ga0105248_10190624 Ga0105248_101906242 144
8 3300009551 Ga0105238_10045537 Ga0105238_100455372 144
9 3300010375 Ga0105239_11608819 Ga0105239_116088192 144
10 3300013100 Ga0157373_10074002 Ga0157373_100740022 144
11 3300013102 Ga0157371_10853580 Ga0157371_108535801 144
12 3300013105 Ga0157369_10017115 Ga0157369_100171154 144
13 3300013297 Ga0157378_10019357 Ga0157378_100193575 144
14 3300013306 Ga0163162_10194879 Ga0163162_101948792 144
15 3300014497 Ga0182008_10014783 Ga0182008_100147835 144
16 3300015262 Ga0182007_10003559 Ga0182007_100035591 144
17 3300025928 Ga0207700_10806080 Ga0207700_108060802 144
18 3300025928 Ga0207700_10863312 Ga0207700_108633121 144
19 3300035086 Ga0373934_0172701 Ga0373934_0172701_107_541 144
20 3300035113 Ga0373936_0413466 Ga0373936_0413466_16_450 144
21 3300035724 Ga0373933_0028176 Ga0373933_0028176_1397_1831 144
22 3300037068 Ga0373925_0008406 Ga0373925_0008406_7064_7498 144
23 3300039438 Ga0436360_1367918 Ga0436360_1367918_43_477 144
24 3300046472 Ga0495580_0098369 Ga0495580_0098369_24_458 144
25 3300048907 Ga0496104_0214442 Ga0496104_0214442_47_481 144
26 3300048908 Ga0496105_0168718 Ga0496105_0168718_1303_1737 144
27 3300048914 Ga0496111_0148133 Ga0496111_0148133_1219_1653 144
28 3300048915 Ga0496112_0130347 Ga0496112_0130347_1510_1944 144
29 3300048915 Ga0496112_0680658 Ga0496112_0680658_480_914 144
30 3300048916 Ga0496113_0185565 Ga0496113_0185565_38_472 144
31 3300050515 nmdc:mga0a205_55307_c1 nmdc:mga0a205_55307_c1_11_445 144
32 3300053077 Ga0495601_0057103 Ga0495601_0057103_29_463 144
33 3300048911 Ga0496108_1720464 Ga0496108_1720464_37_474 145
34 3300005434 Ga0070709_10190667 Ga0070709_101906672 148
35 3300005436 Ga0070713_100085451 Ga0070713_1000854512 148
36 3300014326 Ga0157380_10802738 Ga0157380_108027381 148
37 3300025939 Ga0207665_10095054 Ga0207665_100950542 148
38 3300028563 Ga0265319_1061655 Ga0265319_10616552 148
39 3300046473 Ga0495582_0833359 Ga0495582_0833359_37_492 148
40 3300046491 Ga0495584_0024840 Ga0495584_0024840_2522_2983 148
41 3300053083 Ga0495655_0260865 Ga0495655_0260865_87_548 148
42 3300031251 Ga0265327_10003316 Ga0265327_1000331611 149
43 3300028563 Ga0265319_1202261 Ga0265319_12022611 150
44 3300028577 Ga0265318_10168229 Ga0265318_101682291 150
45 3300031238 Ga0265332_10114643 Ga0265332_101146432 150
46 3300031238 Ga0265332_10152556 Ga0265332_101525562 150
47 3300031239 Ga0265328_10006632 Ga0265328_100066324 150
48 3300031240 Ga0265320_10004428 Ga0265320_1000442811 150
49 3300031240 Ga0265320_10006977 Ga0265320_100069776 150
50 3300031250 Ga0265331_10000641 Ga0265331_100006414 150
51 3300031251 Ga0265327_10086665 Ga0265327_100866653 150
52 3300031344 Ga0265316_10153745 Ga0265316_101537451 150
53 3300031595 Ga0265313_10167374 Ga0265313_101673742 150
54 3300031595 Ga0265313_10255665 Ga0265313_102556651 150
55 3300031711 Ga0265314_10010377 Ga0265314_100103773 150
56 3300031711 Ga0265314_10068145 Ga0265314_100681452 150
57 3300031711 Ga0265314_10141798 Ga0265314_101417982 150
58 3300038742 Ga0400486_22391 Ga0400486_22391_96_554 150
59 3300044712 Ga0453684_0840803 Ga0453684_0840803_183_641 150
60 3300049593 Ga0501077_0456853 Ga0501077_0456853_296_769 150
61 3300009147 Ga0114129_10051132 Ga0114129_100511326 156
62 3300050507 nmdc:mga05p37_52438_c1 nmdc:mga05p37_52438_c1_4186_4665 156
63 3300050515 nmdc:mga0a205_11862_c1 nmdc:mga0a205_11862_c1_4372_4851 156
64 3300005439 Ga0070711_100104330 Ga0070711_1001043302 160
65 3300005467 Ga0070706_100183484 Ga0070706_1001834842 160
66 3300005468 Ga0070707_100046376 Ga0070707_1000463764 160
67 3300005536 Ga0070697_100041404 Ga0070697_1000414043 160
68 3300005548 Ga0070665_100123886 Ga0070665_1001238863 160
69 3300006173 Ga0070716_100059100 Ga0070716_1000591003 160
70 3300006175 Ga0070712_100047992 Ga0070712_1000479924 160
71 3300025910 Ga0207684_10053203 Ga0207684_100532034 160
72 3300025916 Ga0207663_10372688 Ga0207663_103726882 160
73 3300025922 Ga0207646_10005323 Ga0207646_1000532312 160
74 3300025939 Ga0207665_10338796 Ga0207665_103387962 160
75 3300028379 Ga0268266_10386540 Ga0268266_103865402 160
76 3300028800 Ga0265338_10121318 Ga0265338_101213181 160
77 3300005436 Ga0070713_100039588 Ga0070713_1000395881 161
78 3300025928 Ga0207700_10087874 Ga0207700_100878743 161
79 3300046472 Ga0495580_0180261 Ga0495580_0180261_856_1389 161
80 3300005329 Ga0070683_100074064 Ga0070683_1000740644 162
81 3300005337 Ga0070682_100099502 Ga0070682_1000995023 162
82 3300005338 Ga0068868_100631029 Ga0068868_1006310291 162
83 3300005355 Ga0070671_100165228 Ga0070671_1001652282 162
84 3300005366 Ga0070659_100011139 Ga0070659_1000111394 162
85 3300005434 Ga0070709_10118244 Ga0070709_101182441 162
86 3300005435 Ga0070714_100612699 Ga0070714_1006126991 162
87 3300005436 Ga0070713_100221859 Ga0070713_1002218592 162
88 3300005439 Ga0070711_100330204 Ga0070711_1003302042 162
89 3300005439 Ga0070711_100349881 Ga0070711_1003498812 162
90 3300005445 Ga0070708_100004936 Ga0070708_1000049364 162
91 3300005445 Ga0070708_100007628 Ga0070708_1000076284 162
92 3300005457 Ga0070662_100424298 Ga0070662_1004242982 162
93 3300005467 Ga0070706_100061956 Ga0070706_1000619566 162
94 3300005468 Ga0070707_100623294 Ga0070707_1006232943 162
95 3300005471 Ga0070698_100464186 Ga0070698_1004641862 162
96 3300005518 Ga0070699_100061649 Ga0070699_1000616493 162
97 3300005536 Ga0070697_100001590 Ga0070697_1000015909 162
98 3300005548 Ga0070665_100325883 Ga0070665_1003258832 162
99 3300005548 Ga0070665_100939729 Ga0070665_1009397292 162
100 3300005614 Ga0068856_100019476 Ga0068856_1000194765 162
101 3300005614 Ga0068856_100059049 Ga0068856_1000590493 162
102 3300005618 Ga0068864_100079603 Ga0068864_1000796034 162
103 3300005718 Ga0068866_10251032 Ga0068866_102510322 162
104 3300005719 Ga0068861_100529477 Ga0068861_1005294772 162
105 3300005834 Ga0068851_10013264 Ga0068851_100132641 162
106 3300005841 Ga0068863_100002412 Ga0068863_1000024127 162
107 3300005843 Ga0068860_101357264 Ga0068860_1013572642 162
108 3300006028 Ga0070717_10453282 Ga0070717_104532821 162
109 3300006163 Ga0070715_10571440 Ga0070715_105714401 162
110 3300006163 Ga0070715_10631095 Ga0070715_106310951 162
111 3300006173 Ga0070716_100269463 Ga0070716_1002694632 162
112 3300006173 Ga0070716_100863566 Ga0070716_1008635661 162
113 3300006173 Ga0070716_101353330 Ga0070716_1013533301 162
114 3300006175 Ga0070712_100636541 Ga0070712_1006365412 162
115 3300006237 Ga0097621_100006192 Ga0097621_1000061924 162
116 3300006358 Ga0068871_100005202 Ga0068871_1000052029 162
117 3300006358 Ga0068871_101018513 Ga0068871_1010185132 162
118 3300006871 Ga0075434_100015167 Ga0075434_1000151675 162
119 3300007076 Ga0075435_100060738 Ga0075435_1000607383 162
120 3300009174 Ga0105241_10053568 Ga0105241_100535683 162
121 3300009174 Ga0105241_10569660 Ga0105241_105696602 162
122 3300009176 Ga0105242_10281370 Ga0105242_102813702 162
123 3300009177 Ga0105248_11393985 Ga0105248_113939851 162
124 3300009545 Ga0105237_10072895 Ga0105237_100728956 162
125 3300009551 Ga0105238_10196335 Ga0105238_101963352 162
126 3300013296 Ga0157374_10079786 Ga0157374_100797862 162
127 3300013297 Ga0157378_10012189 Ga0157378_1001218911 162
128 3300013297 Ga0157378_10151652 Ga0157378_101516522 162
129 3300013307 Ga0157372_10014205 Ga0157372_100142052 162
130 3300013308 Ga0157375_10175592 Ga0157375_101755922 162
131 3300014969 Ga0157376_10367163 Ga0157376_103671632 162
132 3300025321 Ga0207656_10014967 Ga0207656_100149672 162
133 3300025906 Ga0207699_10194353 Ga0207699_101943532 162
134 3300025906 Ga0207699_10277367 Ga0207699_102773672 162
135 3300025906 Ga0207699_10325899 Ga0207699_103258992 162
136 3300025910 Ga0207684_10063833 Ga0207684_100638332 162
137 3300025910 Ga0207684_10298071 Ga0207684_102980712 162
138 3300025911 Ga0207654_10129784 Ga0207654_101297842 162
139 3300025913 Ga0207695_10075023 Ga0207695_100750234 162
140 3300025914 Ga0207671_10387555 Ga0207671_103875552 162
141 3300025915 Ga0207693_10085637 Ga0207693_100856372 162
142 3300025915 Ga0207693_10135872 Ga0207693_101358721 162
143 3300025916 Ga0207663_10298022 Ga0207663_102980222 162
144 3300025916 Ga0207663_10983639 Ga0207663_109836392 162
145 3300025919 Ga0207657_10000222 Ga0207657_100002228 162
146 3300025922 Ga0207646_10201461 Ga0207646_102014612 162
147 3300025924 Ga0207694_10195804 Ga0207694_101958042 162
148 3300025927 Ga0207687_10337128 Ga0207687_103371282 162
149 3300025928 Ga0207700_10311502 Ga0207700_103115022 162
150 3300025941 Ga0207711_10207072 Ga0207711_102070722 162
151 3300025981 Ga0207640_10227847 Ga0207640_102278472 162
152 3300026041 Ga0207639_10356801 Ga0207639_103568011 162
153 3300026088 Ga0207641_10003924 Ga0207641_1000392412 162
154 3300026095 Ga0207676_10057024 Ga0207676_100570243 162
155 3300026142 Ga0207698_10071828 Ga0207698_100718282 162
156 3300027671 Ga0209588_1016031 Ga0209588_10160313 162
157 3300028379 Ga0268266_10664456 Ga0268266_106644562 162
158 3300028379 Ga0268266_11405345 Ga0268266_114053451 162
159 3300028800 Ga0265338_10004414 Ga0265338_1000441410 162
160 3300028800 Ga0265338_10094279 Ga0265338_100942792 162
161 3300031249 Ga0265339_10505954 Ga0265339_105059541 162
162 3300035170 Ga0373943_0270485 Ga0373943_0270485_411_902 162
163 3300035692 Ga0373935_0048221 Ga0373935_0048221_1875_2366 162
164 3300035695 Ga0373927_0011977 Ga0373927_0011977_2526_3017 162
165 3300037068 Ga0373925_0000125 Ga0373925_0000125_39836_40327 162
166 3300042876 Ga0451577_0248650 Ga0451577_0248650_141_635 162
167 3300044712 Ga0453684_0272155 Ga0453684_0272155_295_789 162
168 3300046472 Ga0495580_0010700 Ga0495580_0010700_1663_2202 162
169 3300046472 Ga0495580_0231770 Ga0495580_0231770_289_777 162
170 3300046472 Ga0495580_0493544 Ga0495580_0493544_115_606 162
171 3300046517 Ga0495630_0005588 Ga0495630_0005588_1023_1514 162
172 3300046663 Ga0495635_0296869 Ga0495635_0296869_369_860 162
173 3300046684 Ga0495669_0449821 Ga0495669_0449821_84_575 162
174 3300046809 Ga0495600_0509806 Ga0495600_0509806_126_617 162
175 3300048903 Ga0496100_0084723 Ga0496100_0084723_482_973 162
176 3300048903 Ga0496100_0130534 Ga0496100_0130534_1191_1679 162
177 3300048904 Ga0496101_0005939 Ga0496101_0005939_6500_6991 162
178 3300048905 Ga0496102_0103735 Ga0496102_0103735_606_1097 162
179 3300048905 Ga0496102_0537612 Ga0496102_0537612_338_826 162
180 3300048907 Ga0496104_0040753 Ga0496104_0040753_3119_3610 162
181 3300048907 Ga0496104_0417673 Ga0496104_0417673_325_813 162
182 3300048908 Ga0496105_0211612 Ga0496105_0211612_410_901 162
183 3300048909 Ga0496106_0122022 Ga0496106_0122022_38_526 162
184 3300048910 Ga0496107_0312551 Ga0496107_0312551_530_1021 162
185 3300048911 Ga0496108_0101872 Ga0496108_0101872_229_720 162
186 3300048913 Ga0496110_0042272 Ga0496110_0042272_2846_3334 162
187 3300048915 Ga0496112_0265179 Ga0496112_0265179_683_1174 162
188 3300048917 Ga0496114_0001136 Ga0496114_0001136_9286_9777 162
189 3300048917 Ga0496114_0146900 Ga0496114_0146900_37_528 162
190 3300048918 Ga0496115_0001411 Ga0496115_0001411_5656_6147 162
191 3300048918 Ga0496115_0027564 Ga0496115_0027564_1388_1879 162
192 3300049743 Ga0501081_1308490 Ga0501081_1308490_42_536 162
193 3300050512 nmdc:mga0n895_8863_c2 nmdc:mga0n895_8863_c2_3499_3990 162
194 3300050513 nmdc:mga0rr50_32147_c1 nmdc:mga0rr50_32147_c1_41_532 162
195 3300053078 Ga0495612_0139178 Ga0495612_0139178_407_898 162
196 3300053084 Ga0495595_0205473 Ga0495595_0205473_40_531 162
197 3300053085 Ga0495619_0042064 Ga0495619_0042064_2096_2587 162
198 3300053091 Ga0500647_0024709 Ga0500647_0024709_1206_1709 162
199 3300026078 Ga0207702_10067649 Ga0207702_100676493 163
200 3300031241 Ga0265325_10082079 Ga0265325_100820792 163
201 3300031247 Ga0265340_10494764 Ga0265340_104947641 163
202 3300047470 Ga0495681_0207218 Ga0495681_0207218_203_694 163
203 3300048913 Ga0496110_1205985 Ga0496110_1205985_64_555 163
204 3300005437 Ga0070710_10029363 Ga0070710_100293634 164
205 3300006173 Ga0070716_100003978 Ga0070716_1000039788 164
206 3300025939 Ga0207665_10007473 Ga0207665_100074737 164
207 iso_pu_bacteria 2897803580 2897807791 164
208 3300005328 Ga0070676_10133592 Ga0070676_101335922 166
209 3300005331 Ga0070670_100865747 Ga0070670_1008657471 166
210 3300005335 Ga0070666_10164743 Ga0070666_101647432 166
211 3300005338 Ga0068868_100032127 Ga0068868_1000321273 166
212 3300005347 Ga0070668_100114967 Ga0070668_1001149673 166
213 3300005356 Ga0070674_100413428 Ga0070674_1004134282 166
214 3300005367 Ga0070667_100386913 Ga0070667_1003869133 166
215 3300005435 Ga0070714_100124464 Ga0070714_1001244643 166
216 3300005436 Ga0070713_100028894 Ga0070713_1000288946 166
217 3300005441 Ga0070700_100117804 Ga0070700_1001178042 166
218 3300005441 Ga0070700_100604018 Ga0070700_1006040181 166
219 3300005445 Ga0070708_100010288 Ga0070708_1000102884 166
220 3300005445 Ga0070708_100022474 Ga0070708_1000224744 166
221 3300005459 Ga0068867_100680707 Ga0068867_1006807071 166
222 3300005467 Ga0070706_100000556 Ga0070706_1000005565 166
223 3300005468 Ga0070707_100006391 Ga0070707_10000639113 166
224 3300005471 Ga0070698_100002213 Ga0070698_10000221324 166
225 3300005518 Ga0070699_100002908 Ga0070699_1000029088 166
226 3300005536 Ga0070697_100004925 Ga0070697_1000049257 166
227 3300005536 Ga0070697_100060353 Ga0070697_1000603532 166
228 3300005536 Ga0070697_100098429 Ga0070697_1000984293 166
229 3300005578 Ga0068854_100085863 Ga0068854_1000858634 166
230 3300005718 Ga0068866_10152884 Ga0068866_101528843 166
231 3300005842 Ga0068858_100169142 Ga0068858_1001691423 166
232 3300005842 Ga0068858_100825259 Ga0068858_1008252592 166
233 3300005843 Ga0068860_100464457 Ga0068860_1004644572 166
234 3300005844 Ga0068862_100006475 Ga0068862_1000064756 166
235 3300006028 Ga0070717_10030339 Ga0070717_100303394 166
236 3300006237 Ga0097621_100065110 Ga0097621_1000651103 166
237 3300006358 Ga0068871_100006041 Ga0068871_1000060413 166
238 3300009098 Ga0105245_10031617 Ga0105245_100316173 166
239 3300009177 Ga0105248_10658820 Ga0105248_106588202 166
240 3300009551 Ga0105238_10935741 Ga0105238_109357412 166
241 3300010375 Ga0105239_10079599 Ga0105239_100795992 166
242 3300013100 Ga0157373_10052246 Ga0157373_100522464 166
243 3300013105 Ga0157369_10380399 Ga0157369_103803992 166
244 3300013297 Ga0157378_10003764 Ga0157378_100037649 166
245 3300013306 Ga0163162_10071298 Ga0163162_100712982 166
246 3300014969 Ga0157376_10033125 Ga0157376_100331252 166
247 3300014969 Ga0157376_10659978 Ga0157376_106599782 166
248 3300020080 Ga0206350_11566209 Ga0206350_115662092 166
249 3300024227 Ga0228598_1003719 Ga0228598_10037192 166
250 3300025903 Ga0207680_10153514 Ga0207680_101535142 166
251 3300025903 Ga0207680_10346617 Ga0207680_103466172 166
252 3300025909 Ga0207705_10605104 Ga0207705_106051041 166
253 3300025910 Ga0207684_10003347 Ga0207684_100033473 166
254 3300025922 Ga0207646_10000341 Ga0207646_1000034125 166
255 3300025926 Ga0207659_10416896 Ga0207659_104168962 166
256 3300025928 Ga0207700_10053975 Ga0207700_100539753 166
257 3300025928 Ga0207700_10065819 Ga0207700_100658194 166
258 3300025929 Ga0207664_10119606 Ga0207664_101196062 166
259 3300025929 Ga0207664_10548894 Ga0207664_105488942 166
260 3300025932 Ga0207690_10427764 Ga0207690_104277641 166
261 3300025933 Ga0207706_10222288 Ga0207706_102222882 166
262 3300025972 Ga0207668_10027678 Ga0207668_100276784 166
263 3300025981 Ga0207640_10164463 Ga0207640_101644632 166
264 3300026075 Ga0207708_10011540 Ga0207708_100115406 166
265 3300026075 Ga0207708_10810351 Ga0207708_108103512 166
266 3300026118 Ga0207675_100012314 Ga0207675_1000123143 166
267 3300027614 Ga0209970_1000200 Ga0209970_10002005 166
268 3300028017 Ga0265356_1018134 Ga0265356_10181342 166
269 3300028380 Ga0268265_10057434 Ga0268265_100574344 166
270 3300028380 Ga0268265_10676720 Ga0268265_106767202 166
271 3300028381 Ga0268264_10764139 Ga0268264_107641392 166
272 3300030878 Ga0265770_1009646 Ga0265770_10096461 166
273 3300031090 Ga0265760_10000219 Ga0265760_100002194 166
274 3300031090 Ga0265760_10002540 Ga0265760_100025406 166
275 3300046472 Ga0495580_0004871 Ga0495580_0004871_7001_7513 166
276 3300046472 Ga0495580_0213163 Ga0495580_0213163_236_751 166
277 3300046684 Ga0495669_0202931 Ga0495669_0202931_246_758 166
278 3300048903 Ga0496100_0069126 Ga0496100_0069126_205_729 166
279 3300048910 Ga0496107_0059445 Ga0496107_0059445_1943_2467 166
280 3300048918 Ga0496115_0115541 Ga0496115_0115541_1158_1682 166
281 3300049570 Ga0501033_0034475 Ga0501033_0034475_1072_1608 166
282 3300049575 Ga0501039_0960344 Ga0501039_0960344_91_627 166
283 3300049576 Ga0501040_0114203 Ga0501040_0114203_338_874 166
284 3300049577 Ga0501041_0002727 Ga0501041_0002727_3869_4405 166
285 3300049578 Ga0501042_0014640 Ga0501042_0014640_4782_5318 166
286 3300049579 Ga0501043_0239463 Ga0501043_0239463_847_1383 166
287 3300049580 Ga0501046_0187095 Ga0501046_0187095_984_1520 166
288 3300049582 Ga0501048_0233128 Ga0501048_0233128_259_795 166
289 3300049587 Ga0501071_0045186 Ga0501071_0045186_967_1503 166
290 3300049588 Ga0501072_0006475 Ga0501072_0006475_7867_8403 166
291 3300049589 Ga0501073_0176196 Ga0501073_0176196_159_695 166
292 3300049590 Ga0501074_0127249 Ga0501074_0127249_361_897 166
293 3300049591 Ga0501075_0112082 Ga0501075_0112082_1330_1866 166
294 3300049592 Ga0501076_0022335 Ga0501076_0022335_1528_2064 166
295 3300049593 Ga0501077_0011392 Ga0501077_0011392_4930_5466 166
296 3300049741 Ga0501079_0053799 Ga0501079_0053799_1628_2164 166
297 3300049742 Ga0501080_0121858 Ga0501080_0121858_615_1151 166
298 3300049744 Ga0501083_0163796 Ga0501083_0163796_639_1175 166
299 3300053148 Ga0500590_089939 Ga0500590_089939_24_536 166
300 3300054114 Ga0501084_0014173 Ga0501084_0014173_985_1521 166
301 3300060353 Ga0501082_0031267 Ga0501082_0031267_863_1399 166
302 3300061734 Ga0530510_0001427 Ga0530510_0001427_8401_8937 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

10

155

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9424 3 142
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9285 3 142
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9237 3 141
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9217 3 142
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9152 3 142
ID Description Score Start End Superfamily
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8708 5 141 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.863 6 142 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8574 4 140 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8563 5 140 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8501 6 142 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A511XQ01-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9926 3 161 GO:0004726
GO:0008794
GO:0030946
GO:0046685
GO:0140793
AF-A0A534H569-F1-model_v4 GNAT family N-acetyltransferase 0.9904 3 164 GO:0004726
GO:0016747
GO:0030946
GO:0046685
GO:0140793
AF-A0A317EFU8-F1-model_v4 ArsR family transcriptional regulator 0.9893 3 162 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A7U7EJV0-F1-model_v4 Arsenate reductase (EC 1.20.4.4) 0.9887 2 162 GO:0016491
GO:0046685
AF-A0A534HPT7-F1-model_v4 GNAT family N-acetyltransferase 0.9887 3 163 GO:0004726
GO:0016747
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
92.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map