F396625

General Info

Members Datasets Scaffolds Average Seq Length
302 157 604 215

Family's Representative Sequence

Representative Sequence 3300042001|Ga0439441_006909|Ga0439441_006909_710_1378
Length 208
Sequence MRDRWATFDCYGTLVDWMTGIRGSLTDLWPGADGGALLTLYHQLEPAVQAGRGIPYREVMAEALAAVATLARLEIAPGDEDVLGASLPAWPVFPEVPAALAELRRRGWRLAILSNTDADLLDASLRAIGVPVDLRIVASDIGSYKPALRHWDAFFAQTGADRERHVHVAASLFHDVEPAHRLGLRCAWINRLAEESTLTLEALVPDRR

Samples

Sample ID Description Type Environment
1 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
88 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
157 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.33
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 13.25
Rhizosphere 85.76
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439441_006909 3300042001 Bacteria 1813
2 Ga0070683_100208201 3300005329 Bacteria 1857
3 Ga0070680_100144047 3300005336 Bacteria 1999
4 Ga0070682_100591747 3300005337 Bacteria 874
5 Ga0070660_100012639 3300005339 Bacteria 6033
6 Ga0070714_100012925 3300005435 Bacteria 6675
7 Ga0070714_100114325 3300005435 Bacteria 2394
8 Ga0070713_100032578 3300005436 Bacteria 4164
9 Ga0070713_100157559 3300005436 Bacteria 2025
10 Ga0070710_10004523 3300005437 Bacteria 6575
11 Ga0070710_10006096 3300005437 Bacteria 5768
12 Ga0070710_10106478 3300005437 Bacteria 1678
13 Ga0070711_100004075 3300005439 Bacteria 8592
14 Ga0070711_100017871 3300005439 Bacteria 4519
15 Ga0070711_100141123 3300005439 Bacteria 1807
16 Ga0070678_100138371 3300005456 Bacteria 1945
17 Ga0070707_100793807 3300005468 Bacteria 910
18 Ga0070679_100209062 3300005530 Bacteria 1916
19 Ga0070684_100055996 3300005535 Bacteria 3439
20 Ga0068853_100833623 3300005539 Bacteria 884
21 Ga0070686_100442964 3300005544 Bacteria 997
22 Ga0068855_100309291 3300005563 Bacteria 1749
23 Ga0068856_100189796 3300005614 Bacteria 2069
24 Ga0070702_100083392 3300005615 Bacteria 1920
25 Ga0068863_100316681 3300005841 Bacteria 1515
26 Ga0081538_10010409 3300005981 Bacteria 7625
27 Ga0081538_10010858 3300005981 Bacteria 7429
28 Ga0081538_10014235 3300005981 Bacteria 6239
29 Ga0081538_10031518 3300005981 Bacteria 3573
30 Ga0070717_10008116 3300006028 Bacteria 7833
31 Ga0070717_10014448 3300006028 Bacteria 6077
32 Ga0070717_10330594 3300006028 Bacteria 1359
33 Ga0070717_10489857 3300006028 Bacteria 1110
34 Ga0070715_10003646 3300006163 Bacteria 4945
35 Ga0070716_100000663 3300006173 Bacteria 14622
36 Ga0075433_10067303 3300006852 Bacteria 3144
37 Ga0075434_100002359 3300006871 Bacteria 16542
38 Ga0075435_100083593 3300007076 Bacteria 2625
39 Ga0105240_10893631 3300009093 Bacteria 956
40 Ga0105245_10059561 3300009098 Bacteria 3438
41 Ga0105245_10321493 3300009098 Unclassified 1524
42 Ga0105238_10144919 3300009551 Bacteria 2351
43 Ga0105238_10192492 3300009551 Bacteria 2015
44 Ga0105246_10714444 3300011119 Bacteria 880
45 Ga0157369_10058671 3300013105 Bacteria 4151
46 Ga0157374_11149027 3300013296 Bacteria 797
47 Ga0157372_11238252 3300013307 Bacteria 862
48 Ga0182008_10142199 3300014497 Bacteria 1201
49 Ga0206353_12047888 3300020082 Bacteria 1371
50 Ga0213876_10009907 3300021384 Bacteria 5124
51 Ga0207685_10004079 3300025905 Bacteria 3655
52 Ga0207699_10005456 3300025906 Bacteria 6086
53 Ga0207699_10065966 3300025906 Bacteria 2196
54 Ga0207654_10621597 3300025911 Bacteria 772
55 Ga0207707_10037142 3300025912 Bacteria 4256
56 Ga0207671_10247090 3300025914 Bacteria 1402
57 Ga0207693_10015815 3300025915 Bacteria 6045
58 Ga0207663_10009397 3300025916 Bacteria 5161
59 Ga0207663_10187111 3300025916 Bacteria 1484
60 Ga0207660_10119107 3300025917 Bacteria 1997
61 Ga0207657_10016524 3300025919 Bacteria 7116
62 Ga0207646_10003943 3300025922 Bacteria 16459
63 Ga0207694_10103888 3300025924 Bacteria 2254
64 Ga0207687_10091810 3300025927 Bacteria 2216
65 Ga0207700_10030303 3300025928 Bacteria 3829
66 Ga0207664_10003351 3300025929 Bacteria 10650
67 Ga0207664_10011840 3300025929 Bacteria 6221
68 Ga0207664_10112151 3300025929 Bacteria 2270
69 Ga0207664_10155865 3300025929 Bacteria 1944
70 Ga0207644_10653024 3300025931 Bacteria 876
71 Ga0207706_10639869 3300025933 Bacteria 911
72 Ga0207665_10001348 3300025939 Bacteria 16557
73 Ga0207667_10420297 3300025949 Bacteria 1360
74 Ga0207702_10228369 3300026078 Bacteria 1738
75 Ga0207641_10356116 3300026088 Bacteria 1396
76 Ga0207683_10158437 3300026121 Bacteria 2045
77 Ga0265334_10064257 3300028573 Bacteria 1378
78 Ga0265338_10001048 3300028800 Bacteria 46186
79 Ga0265338_10009164 3300028800 Bacteria 11875
80 Ga0265338_10058607 3300028800 Bacteria 3398
81 Ga0265325_10045475 3300031241 Unclassified 2281
82 Ga0265313_10017600 3300031595 Bacteria 4050
83 Ga0373932_0094319 3300035112 Unclassified 965
84 Ga0373956_0009895 3300035119 Bacteria 3887
85 Ga0373946_0011840 3300035171 Bacteria 3261
86 Ga0373931_0043283 3300035691 Bacteria 2370
87 Ga0373931_0324695 3300035691 Unclassified 957
88 Ga0373935_0114460 3300035692 Bacteria 1794
89 Ga0373947_0003034 3300035725 Bacteria 9988
90 Ga0373937_0003051 3300036401 Bacteria 14020
91 Ga0373937_0134396 3300036401 Bacteria 2312
92 Ga0373937_0550406 3300036401 Bacteria 1096
93 Ga0373937_0709253 3300036401 Unclassified 953
94 Ga0373925_0001320 3300037068 Bacteria 21707
95 Ga0466965_0003656 3300044683 Bacteria 6784
96 Ga0466965_0076044 3300044683 Bacteria 1694
97 Ga0466965_0413376 3300044683 Bacteria 747
98 Ga0466966_0014162 3300044684 Bacteria 5279
99 Ga0466961_0000819 3300044693 Bacteria 19417
100 Ga0466961_0081816 3300044693 Bacteria 2043
101 Ga0466963_0003641 3300044694 Bacteria 8854
102 Ga0466963_0008418 3300044694 Bacteria 6181
103 Ga0466963_0065198 3300044694 Bacteria 2441
104 Ga0466963_0092685 3300044694 Bacteria 2058
105 Ga0466963_0138061 3300044694 Bacteria 1687
106 Ga0466964_0003451 3300044706 Bacteria 5767
107 Ga0466964_0012737 3300044706 Bacteria 3184
108 Ga0466964_0070970 3300044706 Unclassified 1473
109 Ga0466971_0000170 3300044719 Bacteria 24398
110 Ga0466971_0010418 3300044719 Bacteria 4062
111 Ga0466971_0019026 3300044719 Bacteria 3048
112 Ga0466971_0215746 3300044719 Bacteria 908
113 Ga0466968_0032856 3300044735 Bacteria 2160
114 Ga0466968_0037599 3300044735 Bacteria 2031
115 Ga0466970_0004467 3300044765 Bacteria 6894
116 Ga0466957_0006828 3300044842 Bacteria 6449
117 Ga0466957_0030916 3300044842 Bacteria 3198
118 Ga0466957_0032768 3300044842 Bacteria 3113
119 Ga0466957_0048104 3300044842 Bacteria 2592
120 Ga0466960_0005693 3300044901 Bacteria 4949
121 Ga0466959_0000274 3300045049 Bacteria 31486
122 Ga0466959_0039086 3300045049 Bacteria 3506
123 Ga0466958_0008768 3300045836 Bacteria 5616
124 Ga0466958_0013473 3300045836 Bacteria 4655
125 Ga0466958_0016559 3300045836 Bacteria 4246
126 Ga0466958_0109901 3300045836 Bacteria 1720
127 Ga0466967_0000828 3300045976 Bacteria 16293
128 Ga0466967_0010698 3300045976 Bacteria 6897
129 Ga0466967_0032800 3300045976 Bacteria 4390
130 Ga0466967_0036953 3300045976 Bacteria 4174
131 Ga0466967_0075349 3300045976 Bacteria 3033
132 Ga0466967_0076737 3300045976 Bacteria 3006
133 Ga0466967_0114968 3300045976 Bacteria 2477
134 Ga0466967_0129347 3300045976 Bacteria 2342
135 Ga0466967_0167398 3300045976 Bacteria 2066
136 Ga0466967_0235756 3300045976 Unclassified 1744
137 Ga0466967_0261874 3300045976 Bacteria 1654
138 Ga0466967_0444441 3300045976 Bacteria 1266
139 Ga0466967_0531284 3300045976 Bacteria 1156
140 Ga0495592_0000198 3300046454 Bacteria 51379
141 Ga0495592_0164037 3300046454 Bacteria 1526
142 Ga0495592_0201918 3300046454 Bacteria 1341
143 Ga0495629_0001816 3300046459 Bacteria 16725
144 Ga0495629_0046966 3300046459 Bacteria 3028
145 Ga0495629_0082673 3300046459 Bacteria 2241
146 Ga0495641_0007480 3300046461 Bacteria 6809
147 Ga0495641_0083766 3300046461 Bacteria 1428
148 Ga0495651_0000064 3300046462 Bacteria 78474
149 Ga0495651_0011734 3300046462 Bacteria 6733
150 Ga0495651_0161861 3300046462 Bacteria 1602
151 Ga0495653_0052446 3300046463 Bacteria 3125
152 Ga0495653_0076546 3300046463 Bacteria 2487
153 Ga0495653_0199637 3300046463 Bacteria 1358
154 Ga0495580_0110262 3300046472 Bacteria 1911
155 Ga0495582_0024700 3300046473 Bacteria 3289
156 Ga0495582_0220266 3300046473 Bacteria 1086
157 Ga0495639_0000630 3300046475 Bacteria 16276
158 Ga0495639_0191089 3300046475 Bacteria 1000
159 Ga0495662_0001339 3300046476 Bacteria 12171
160 Ga0495664_0009107 3300046477 Bacteria 5548
161 Ga0495664_0098971 3300046477 Bacteria 1756
162 Ga0495594_0192185 3300046499 Bacteria 1163
163 Ga0495608_0026241 3300046511 Bacteria 3973
164 Ga0495608_0120509 3300046511 Bacteria 1683
165 Ga0495608_0256256 3300046511 Bacteria 1090
166 Ga0495618_0002604 3300046514 Bacteria 11561
167 Ga0495618_0098501 3300046514 Bacteria 1870
168 Ga0495628_0000069 3300046516 Bacteria 82366
169 Ga0495628_0044708 3300046516 Bacteria 3522
170 Ga0495628_0067348 3300046516 Bacteria 2796
171 Ga0495630_0101164 3300046517 Bacteria 2180
172 Ga0495630_0313764 3300046517 Bacteria 1198
173 Ga0495630_0686615 3300046517 Bacteria 783
174 Ga0495666_0000145 3300046526 Bacteria 29818
175 Ga0495642_0023642 3300046528 Bacteria 2427
176 Ga0495652_0041308 3300046529 Bacteria 3982
177 Ga0495652_0074885 3300046529 Bacteria 2814
178 Ga0495652_0279712 3300046529 Bacteria 1222
179 Ga0495652_0351700 3300046529 Bacteria 1055
180 Ga0495665_0005590 3300046531 Bacteria 6775
181 Ga0495640_0009273 3300046533 Bacteria 7670
182 Ga0495640_0040750 3300046533 Bacteria 3250
183 Ga0495640_0179190 3300046533 Bacteria 1351
184 Ga0495640_0316817 3300046533 Bacteria 967
185 Ga0495587_0005801 3300046536 Bacteria 8041
186 Ga0495587_0095491 3300046536 Bacteria 1716
187 Ga0495598_0052235 3300046537 Bacteria 1234
188 Ga0495645_0068628 3300046543 Bacteria 2559
189 Ga0495645_0137655 3300046543 Bacteria 1706
190 Ga0495645_0522688 3300046543 Bacteria 739
191 Ga0495667_0006358 3300046559 Bacteria 8013
192 Ga0495667_0302190 3300046559 Bacteria 1014
193 Ga0495634_0029909 3300046642 Bacteria 3766
194 Ga0495634_0060262 3300046642 Bacteria 2525
195 Ga0495611_0047906 3300046648 Bacteria 1919
196 Ga0495635_0040533 3300046663 Bacteria 3218
197 Ga0495635_0307864 3300046663 Bacteria 1061
198 Ga0495657_0011853 3300046675 Bacteria 6499
199 Ga0495657_0075601 3300046675 Bacteria 2189
200 Ga0495657_0125344 3300046675 Bacteria 1614
201 Ga0495599_0000716 3300046678 Bacteria 18725
202 Ga0495599_0062897 3300046678 Bacteria 2319
203 Ga0495599_0190119 3300046678 Bacteria 1263
204 Ga0495623_0000030 3300046679 Bacteria 85003
205 Ga0495623_0402566 3300046679 Bacteria 736
206 Ga0495646_0004988 3300046680 Bacteria 8385
207 Ga0495646_0054581 3300046680 Bacteria 2403
208 Ga0495647_0000560 3300046681 Bacteria 10950
209 Ga0495658_0032905 3300046683 Bacteria 2835
210 Ga0495658_0131611 3300046683 Bacteria 1523
211 Ga0495658_0360370 3300046683 Bacteria 924
212 Ga0495613_0032132 3300046689 Bacteria 3898
213 Ga0495613_0057391 3300046689 Bacteria 2858
214 Ga0495613_0306136 3300046689 Bacteria 1099
215 Ga0495624_0162337 3300046690 Bacteria 1365
216 Ga0495589_0022215 3300046794 Bacteria 3239
217 Ga0495600_0074624 3300046809 Bacteria 2215
218 Ga0495600_0159920 3300046809 Bacteria 1456
219 Ga0495581_0000407 3300047315 Bacteria 21707
220 Ga0495581_0051956 3300047315 Bacteria 2367
221 Ga0495581_0195198 3300047315 Bacteria 1184
222 Ga0495604_0000103 3300047317 Bacteria 71556
223 Ga0495604_0101814 3300047317 Bacteria 2109
224 Ga0495604_0417094 3300047317 Unclassified 882
225 Ga0495674_0071818 3300047319 Bacteria 2986
226 Ga0495674_0300763 3300047319 Bacteria 1310
227 Ga0495676_0023760 3300047321 Bacteria 5315
228 Ga0495680_0004424 3300047322 Bacteria 13428
229 Ga0495680_0009043 3300047322 Bacteria 8999
230 Ga0495680_0016809 3300047322 Bacteria 6271
231 Ga0495675_0000282 3300047444 Bacteria 36859
232 Ga0495675_0199928 3300047444 Bacteria 1217
233 Ga0495675_0309811 3300047444 Bacteria 936
234 Ga0495679_059033 3300047446 Bacteria 1130
235 Ga0495684_0012597 3300047471 Bacteria 6522
236 Ga0495684_0113665 3300047471 Bacteria 2041
237 Ga0495684_0151636 3300047471 Bacteria 1732
238 Ga0495684_0359067 3300047471 Bacteria 1032
239 Ga0495593_0000807 3300047673 Bacteria 18118
240 Ga0495602_0000080 3300048088 Bacteria 94171
241 Ga0495602_0139594 3300048088 Bacteria 1920
242 Ga0495614_0000642 3300048089 Bacteria 14613
243 Ga0496100_0014172 3300048903 Bacteria 4620
244 Ga0496100_0049312 3300048903 Bacteria 2722
245 Ga0496100_0059401 3300048903 Bacteria 2513
246 Ga0496101_0151640 3300048904 Bacteria 1773
247 Ga0496102_0007604 3300048905 Bacteria 9258
248 Ga0496102_0184309 3300048905 Bacteria 1967
249 Ga0496103_0195806 3300048906 Bacteria 1299
250 Ga0496104_0014077 3300048907 Bacteria 7220
251 Ga0496104_0111990 3300048907 Bacteria 2617
252 Ga0496104_0125315 3300048907 Bacteria 2466
253 Ga0496104_0159559 3300048907 Bacteria 2163
254 Ga0496104_0232455 3300048907 Bacteria 1755
255 Ga0496104_0236639 3300048907 Bacteria 1738
256 Ga0496104_0306609 3300048907 Bacteria 1500
257 Ga0496105_0007843 3300048908 Bacteria 8287
258 Ga0496105_0036445 3300048908 Bacteria 4052
259 Ga0496106_0012693 3300048909 Bacteria 6223
260 Ga0496106_0855280 3300048909 Bacteria 720
261 Ga0496107_0011878 3300048910 Bacteria 6083
262 Ga0496107_0038281 3300048910 Bacteria 3442
263 Ga0496108_0019053 3300048911 Bacteria 5630
264 Ga0496108_0638099 3300048911 Bacteria 926
265 Ga0496109_0012739 3300048912 Bacteria 7266
266 Ga0496109_0057848 3300048912 Bacteria 3540
267 Ga0496109_0257152 3300048912 Bacteria 1645
268 Ga0496110_0014622 3300048913 Bacteria 6521
269 Ga0496110_0090720 3300048913 Bacteria 2732
270 Ga0496110_0829288 3300048913 Unclassified 830
271 Ga0496111_0163474 3300048914 Bacteria 1653
272 Ga0496111_0646194 3300048914 Bacteria 772
273 Ga0496112_0084262 3300048915 Bacteria 3144
274 Ga0496112_0210909 3300048915 Bacteria 1899
275 Ga0496112_0425379 3300048915 Bacteria 1267
276 Ga0496112_0688381 3300048915 Bacteria 951
277 Ga0496113_0401831 3300048916 Bacteria 1100
278 Ga0496114_0017991 3300048917 Bacteria 5710
279 Ga0496114_0025558 3300048917 Bacteria 4827
280 Ga0496114_0177221 3300048917 Bacteria 1860
281 Ga0496115_0029647 3300048918 Bacteria 4298
282 Ga0496115_0057685 3300048918 Bacteria 3123
283 Ga0501047_0435893 3300049581 Bacteria 1141
284 Ga0501083_0029657 3300049744 Bacteria 3760
285 nmdc:mga0n895_469_c1 3300050512 Bacteria 27118
286 nmdc:mga0n895_780198_c1 3300050512 Bacteria 947
287 Ga0495601_0000163 3300053077 Bacteria 36562
288 Ga0495601_0012025 3300053077 Bacteria 5186
289 Ga0495601_0031960 3300053077 Bacteria 3274
290 Ga0495601_0038615 3300053077 Bacteria 2986
291 Ga0495601_0300555 3300053077 Bacteria 1045
292 Ga0495612_0019781 3300053078 Bacteria 2697
293 Ga0495612_0042069 3300053078 Bacteria 1864
294 Ga0495595_0007604 3300053084 Bacteria 4437
295 Ga0495619_0001783 3300053085 Bacteria 14316
296 Ga0495619_0356986 3300053085 Bacteria 1011
297 Ga0500566_0025580 3300053094 Bacteria 3459
298 Ga0500566_0224809 3300053094 Bacteria 930
299 Ga0466962_0000436 3300061719 Bacteria 18149
300 Ga0466962_0083492 3300061719 Unclassified 1528
301 2883296601 2883291878 Bacteria 5894118
302 2883359325 2883354860 Bacteria 5865246
303 Ga0439441_006909
304 Ga0070683_100208201
305 Ga0070680_100144047
306 Ga0070682_100591747
307 Ga0070660_100012639
308 Ga0070714_100012925
309 Ga0070714_100114325
310 Ga0070713_100032578
311 Ga0070713_100157559
312 Ga0070710_10004523
313 Ga0070710_10006096
314 Ga0070710_10106478
315 Ga0070711_100004075
316 Ga0070711_100017871
317 Ga0070711_100141123
318 Ga0070678_100138371
319 Ga0070707_100793807
320 Ga0070679_100209062
321 Ga0070684_100055996
322 Ga0068853_100833623
323 Ga0070686_100442964
324 Ga0068855_100309291
325 Ga0068856_100189796
326 Ga0070702_100083392
327 Ga0068863_100316681
328 Ga0081538_10010409
329 Ga0081538_10010858
330 Ga0081538_10014235
331 Ga0081538_10031518
332 Ga0070717_10008116
333 Ga0070717_10014448
334 Ga0070717_10330594
335 Ga0070717_10489857
336 Ga0070715_10003646
337 Ga0070716_100000663
338 Ga0075433_10067303
339 Ga0075434_100002359
340 Ga0075435_100083593
341 Ga0105240_10893631
342 Ga0105245_10059561
343 Ga0105245_10321493
344 Ga0105238_10144919
345 Ga0105238_10192492
346 Ga0105246_10714444
347 Ga0157369_10058671
348 Ga0157374_11149027
349 Ga0157372_11238252
350 Ga0182008_10142199
351 Ga0206353_12047888
352 Ga0213876_10009907
353 Ga0207685_10004079
354 Ga0207699_10005456
355 Ga0207699_10065966
356 Ga0207654_10621597
357 Ga0207707_10037142
358 Ga0207671_10247090
359 Ga0207693_10015815
360 Ga0207663_10009397
361 Ga0207663_10187111
362 Ga0207660_10119107
363 Ga0207657_10016524
364 Ga0207646_10003943
365 Ga0207694_10103888
366 Ga0207687_10091810
367 Ga0207700_10030303
368 Ga0207664_10003351
369 Ga0207664_10011840
370 Ga0207664_10112151
371 Ga0207664_10155865
372 Ga0207644_10653024
373 Ga0207706_10639869
374 Ga0207665_10001348
375 Ga0207667_10420297
376 Ga0207702_10228369
377 Ga0207641_10356116
378 Ga0207683_10158437
379 Ga0265334_10064257
380 Ga0265338_10001048
381 Ga0265338_10009164
382 Ga0265338_10058607
383 Ga0265325_10045475
384 Ga0265313_10017600
385 Ga0373932_0094319
386 Ga0373956_0009895
387 Ga0373946_0011840
388 Ga0373931_0043283
389 Ga0373931_0324695
390 Ga0373935_0114460
391 Ga0373947_0003034
392 Ga0373937_0003051
393 Ga0373937_0134396
394 Ga0373937_0550406
395 Ga0373937_0709253
396 Ga0373925_0001320
397 Ga0466965_0003656
398 Ga0466965_0076044
399 Ga0466965_0413376
400 Ga0466966_0014162
401 Ga0466961_0000819
402 Ga0466961_0081816
403 Ga0466963_0003641
404 Ga0466963_0008418
405 Ga0466963_0065198
406 Ga0466963_0092685
407 Ga0466963_0138061
408 Ga0466964_0003451
409 Ga0466964_0012737
410 Ga0466964_0070970
411 Ga0466971_0000170
412 Ga0466971_0010418
413 Ga0466971_0019026
414 Ga0466971_0215746
415 Ga0466968_0032856
416 Ga0466968_0037599
417 Ga0466970_0004467
418 Ga0466957_0006828
419 Ga0466957_0030916
420 Ga0466957_0032768
421 Ga0466957_0048104
422 Ga0466960_0005693
423 Ga0466959_0000274
424 Ga0466959_0039086
425 Ga0466958_0008768
426 Ga0466958_0013473
427 Ga0466958_0016559
428 Ga0466958_0109901
429 Ga0466967_0000828
430 Ga0466967_0010698
431 Ga0466967_0032800
432 Ga0466967_0036953
433 Ga0466967_0075349
434 Ga0466967_0076737
435 Ga0466967_0114968
436 Ga0466967_0129347
437 Ga0466967_0167398
438 Ga0466967_0235756
439 Ga0466967_0261874
440 Ga0466967_0444441
441 Ga0466967_0531284
442 Ga0495592_0000198
443 Ga0495592_0164037
444 Ga0495592_0201918
445 Ga0495629_0001816
446 Ga0495629_0046966
447 Ga0495629_0082673
448 Ga0495641_0007480
449 Ga0495641_0083766
450 Ga0495651_0000064
451 Ga0495651_0011734
452 Ga0495651_0161861
453 Ga0495653_0052446
454 Ga0495653_0076546
455 Ga0495653_0199637
456 Ga0495580_0110262
457 Ga0495582_0024700
458 Ga0495582_0220266
459 Ga0495639_0000630
460 Ga0495639_0191089
461 Ga0495662_0001339
462 Ga0495664_0009107
463 Ga0495664_0098971
464 Ga0495594_0192185
465 Ga0495608_0026241
466 Ga0495608_0120509
467 Ga0495608_0256256
468 Ga0495618_0002604
469 Ga0495618_0098501
470 Ga0495628_0000069
471 Ga0495628_0044708
472 Ga0495628_0067348
473 Ga0495630_0101164
474 Ga0495630_0313764
475 Ga0495630_0686615
476 Ga0495666_0000145
477 Ga0495642_0023642
478 Ga0495652_0041308
479 Ga0495652_0074885
480 Ga0495652_0279712
481 Ga0495652_0351700
482 Ga0495665_0005590
483 Ga0495640_0009273
484 Ga0495640_0040750
485 Ga0495640_0179190
486 Ga0495640_0316817
487 Ga0495587_0005801
488 Ga0495587_0095491
489 Ga0495598_0052235
490 Ga0495645_0068628
491 Ga0495645_0137655
492 Ga0495645_0522688
493 Ga0495667_0006358
494 Ga0495667_0302190
495 Ga0495634_0029909
496 Ga0495634_0060262
497 Ga0495611_0047906
498 Ga0495635_0040533
499 Ga0495635_0307864
500 Ga0495657_0011853
501 Ga0495657_0075601
502 Ga0495657_0125344
503 Ga0495599_0000716
504 Ga0495599_0062897
505 Ga0495599_0190119
506 Ga0495623_0000030
507 Ga0495623_0402566
508 Ga0495646_0004988
509 Ga0495646_0054581
510 Ga0495647_0000560
511 Ga0495658_0032905
512 Ga0495658_0131611
513 Ga0495658_0360370
514 Ga0495613_0032132
515 Ga0495613_0057391
516 Ga0495613_0306136
517 Ga0495624_0162337
518 Ga0495589_0022215
519 Ga0495600_0074624
520 Ga0495600_0159920
521 Ga0495581_0000407
522 Ga0495581_0051956
523 Ga0495581_0195198
524 Ga0495604_0000103
525 Ga0495604_0101814
526 Ga0495604_0417094
527 Ga0495674_0071818
528 Ga0495674_0300763
529 Ga0495676_0023760
530 Ga0495680_0004424
531 Ga0495680_0009043
532 Ga0495680_0016809
533 Ga0495675_0000282
534 Ga0495675_0199928
535 Ga0495675_0309811
536 Ga0495679_059033
537 Ga0495684_0012597
538 Ga0495684_0113665
539 Ga0495684_0151636
540 Ga0495684_0359067
541 Ga0495593_0000807
542 Ga0495602_0000080
543 Ga0495602_0139594
544 Ga0495614_0000642
545 Ga0496100_0014172
546 Ga0496100_0049312
547 Ga0496100_0059401
548 Ga0496101_0151640
549 Ga0496102_0007604
550 Ga0496102_0184309
551 Ga0496103_0195806
552 Ga0496104_0014077
553 Ga0496104_0111990
554 Ga0496104_0125315
555 Ga0496104_0159559
556 Ga0496104_0232455
557 Ga0496104_0236639
558 Ga0496104_0306609
559 Ga0496105_0007843
560 Ga0496105_0036445
561 Ga0496106_0012693
562 Ga0496106_0855280
563 Ga0496107_0011878
564 Ga0496107_0038281
565 Ga0496108_0019053
566 Ga0496108_0638099
567 Ga0496109_0012739
568 Ga0496109_0057848
569 Ga0496109_0257152
570 Ga0496110_0014622
571 Ga0496110_0090720
572 Ga0496110_0829288
573 Ga0496111_0163474
574 Ga0496111_0646194
575 Ga0496112_0084262
576 Ga0496112_0210909
577 Ga0496112_0425379
578 Ga0496112_0688381
579 Ga0496113_0401831
580 Ga0496114_0017991
581 Ga0496114_0025558
582 Ga0496114_0177221
583 Ga0496115_0029647
584 Ga0496115_0057685
585 Ga0501047_0435893
586 Ga0501083_0029657
587 nmdc:mga0n895_469_c1
588 nmdc:mga0n895_780198_c1
589 Ga0495601_0000163
590 Ga0495601_0012025
591 Ga0495601_0031960
592 Ga0495601_0038615
593 Ga0495601_0300555
594 Ga0495612_0019781
595 Ga0495612_0042069
596 Ga0495595_0007604
597 Ga0495619_0001783
598 Ga0495619_0356986
599 Ga0500566_0025580
600 Ga0500566_0224809
601 Ga0466962_0000436
602 Ga0466962_0083492
603 2883296601
604 2883359325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

84

189

0.96

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

4

183

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hp5-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase 0.8994 2 206
8hp7-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase k152a mutant trapped with (2r)-4-amino-2-hydroxybutanoic acid 0.8904 2 210
1zrm-assembly1.cif.gz_A crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate 0.8855 1 207
1jud-assembly1.cif.gz_A l-2-haloacid dehalogenase 0.8826 1 207
3umb-assembly1.cif.gz_A-2 crystal structure of the l-2-haloacid dehalogenase rsc1362 0.876 2 209
ID Description Score Start End Superfamily
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9296 83 204 3.40.50.1000
3i76A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.903 87 209 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8967 84 183 3.40.50.1000
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8966 1 207 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.895 83 206 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A534RM55-F1-model_v4 HAD family hydrolase 0.9875 91 214 GO:0016787
AF-A0A6I3BS84-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15) 0.9815 1 213 GO:0003989
GO:0005524
GO:0006633
GO:0008270
GO:0009317
GO:0016743
GO:0016787
GO:2001295
AF-A0A537VYZ9-F1-model_v4 HAD family hydrolase 0.9795 37 172
AF-A0A538CFH4-F1-model_v4 HAD family hydrolase 0.9791 1 214 GO:0016787
AF-A0A7W1N5E1-F1-model_v4 HAD-IA family hydrolase 0.979 1 214 GO:0016787

Map