F396574

General Info

Members Datasets Scaffolds Average Seq Length
302 182 604 160

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10550196|Ga0307413_105501962
Length 180
Sequence MGRGRAKQETSAGGVVYRMVTGPDGAVRPLFLLIRDSYRNWGFPKGHLENGEAPEAAALREVAEETGLAGVELRGAIETIDWYFRFRGRLIHKVCHFYLMETASADTCPQRAEGITACHWVPFDDAVQMTSYANAREVLRRAHQMVGGVLPRAEADSSLAAAPWPGTGVDGRRQEQXQER

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 2.32
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10550196 3300031824 Bacteria 936
2 Ga0070658_10070873 3300005327 Bacteria 2854
3 Ga0070658_10115520 3300005327 Bacteria 2226
4 Ga0070676_10016983 3300005328 Bacteria 4024
5 Ga0070683_100004379 3300005329 Bacteria 11616
6 Ga0070683_100010415 3300005329 Bacteria 7996
7 Ga0070666_10933150 3300005335 Bacteria 642
8 Ga0070680_100001974 3300005336 Bacteria 15088
9 Ga0070680_100003671 3300005336 Bacteria 11464
10 Ga0070680_100501154 3300005336 Bacteria 1039
11 Ga0070660_100784779 3300005339 Bacteria 801
12 Ga0070661_100230660 3300005344 Unclassified 1423
13 Ga0070668_100018950 3300005347 Bacteria 5170
14 Ga0070671_100472694 3300005355 Bacteria 1077
15 Ga0070674_100444623 3300005356 Bacteria 1068
16 Ga0070673_101191805 3300005364 Bacteria 713
17 Ga0070659_100020262 3300005366 Bacteria 5049
18 Ga0070659_100192038 3300005366 Bacteria 1679
19 Ga0070659_100345431 3300005366 Bacteria 1248
20 Ga0070667_100031989 3300005367 Bacteria 4386
21 Ga0070667_100056938 3300005367 Bacteria 3303
22 Ga0070667_100334254 3300005367 Bacteria 1369
23 Ga0070703_10084132 3300005406 Bacteria 1090
24 Ga0070713_100310015 3300005436 Bacteria 1455
25 Ga0070663_101014352 3300005455 Unclassified 722
26 Ga0070678_101464153 3300005456 Unclassified 639
27 Ga0070681_10306864 3300005458 Bacteria 1496
28 Ga0070681_10727233 3300005458 Bacteria 909
29 Ga0070681_11189436 3300005458 Bacteria 684
30 Ga0070706_101095260 3300005467 Bacteria 733
31 Ga0070698_100002034 3300005471 Bacteria 22485
32 Ga0070699_100125415 3300005518 Bacteria 2260
33 Ga0070679_100000483 3300005530 Bacteria 34164
34 Ga0070684_100006177 3300005535 Bacteria 9240
35 Ga0070684_100276467 3300005535 Bacteria 1538
36 Ga0070684_100855900 3300005535 Unclassified 851
37 Ga0068853_100150974 3300005539 Bacteria 2092
38 Ga0070672_100087661 3300005543 Bacteria 2505
39 Ga0070672_100101890 3300005543 Bacteria 2330
40 Ga0070672_100496723 3300005543 Bacteria 1055
41 Ga0070672_101092673 3300005543 Bacteria 709
42 Ga0070686_100574200 3300005544 Bacteria 885
43 Ga0070695_100217765 3300005545 Bacteria 1374
44 Ga0070693_100520305 3300005547 Bacteria 847
45 Ga0070704_101337544 3300005549 Bacteria 656
46 Ga0068855_100306239 3300005563 Bacteria 1759
47 Ga0068855_101036834 3300005563 Bacteria 860
48 Ga0068855_101934387 3300005563 Unclassified 597
49 Ga0070664_100016526 3300005564 Bacteria 6050
50 Ga0070664_100571178 3300005564 Unclassified 1047
51 Ga0068857_100020623 3300005577 Bacteria 5799
52 Ga0068854_100099342 3300005578 Bacteria 2180
53 Ga0070702_100065183 3300005615 Bacteria 2133
54 Ga0068852_100769120 3300005616 Bacteria 976
55 Ga0068864_100092517 3300005618 Bacteria 2670
56 Ga0068851_10025339 3300005834 Bacteria 2909
57 Ga0068863_100195054 3300005841 Bacteria 1947
58 Ga0068858_100150314 3300005842 Bacteria 2189
59 Ga0068860_100069883 3300005843 Bacteria 3338
60 Ga0068860_100863232 3300005843 Bacteria 920
61 Ga0081539_10032509 3300005985 Bacteria 3195
62 Ga0075428_100307896 3300006844 Bacteria 1703
63 Ga0075430_100350959 3300006846 Bacteria 1218
64 Ga0075431_100020224 3300006847 Bacteria 6800
65 Ga0075429_100178556 3300006880 Bacteria 1861
66 Ga0068865_100001780 3300006881 Bacteria 12634
67 Ga0075436_100141143 3300006914 Bacteria 1693
68 Ga0105240_11132622 3300009093 Bacteria 831
69 Ga0111539_10023132 3300009094 Bacteria 7632
70 Ga0105245_10674804 3300009098 Bacteria 1065
71 Ga0114129_11012126 3300009147 Bacteria 1046
72 Ga0105243_10061060 3300009148 Bacteria 3013
73 Ga0105242_10018480 3300009176 Bacteria 5450
74 Ga0105248_10018132 3300009177 Bacteria 7772
75 Ga0105248_10495243 3300009177 Unclassified 1378
76 Ga0105248_11449411 3300009177 Bacteria 777
77 Ga0105238_10000276 3300009551 Bacteria 57183
78 Ga0105238_11922848 3300009551 Bacteria 625
79 Ga0105249_10166586 3300009553 Bacteria 2134
80 Ga0157373_10384111 3300013100 Bacteria 1005
81 Ga0157371_10060425 3300013102 Bacteria 2688
82 Ga0157369_10117352 3300013105 Bacteria 2825
83 Ga0157374_10653126 3300013296 Bacteria 1064
84 Ga0157372_10137712 3300013307 Bacteria 2812
85 Ga0157372_10205287 3300013307 Bacteria 2283
86 Ga0157372_10477678 3300013307 Unclassified 1453
87 Ga0157372_10640282 3300013307 Bacteria 1238
88 Ga0157372_10734770 3300013307 Bacteria 1148
89 Ga0157372_12730118 3300013307 Unclassified 566
90 Ga0157375_10034319 3300013308 Bacteria 4832
91 Ga0157375_10060493 3300013308 Bacteria 3756
92 Ga0163163_11140342 3300014325 Bacteria 842
93 Ga0157380_10448763 3300014326 Bacteria 1238
94 Ga0213875_10156057 3300021388 Bacteria 1070
95 Ga0207682_10075415 3300025893 Bacteria 1436
96 Ga0207645_10059539 3300025907 Bacteria 2439
97 Ga0207645_10164403 3300025907 Bacteria 1452
98 Ga0207645_10942065 3300025907 Bacteria 586
99 Ga0207705_10005218 3300025909 Bacteria 9740
100 Ga0207705_10011778 3300025909 Bacteria 6320
101 Ga0207705_10044994 3300025909 Bacteria 3173
102 Ga0207705_10328102 3300025909 Bacteria 1177
103 Ga0207707_10040390 3300025912 Bacteria 4075
104 Ga0207707_10509330 3300025912 Unclassified 1026
105 Ga0207660_10003774 3300025917 Bacteria 9866
106 Ga0207660_10017088 3300025917 Bacteria 4814
107 Ga0207660_10717182 3300025917 Bacteria 816
108 Ga0207681_10423144 3300025923 Bacteria 1079
109 Ga0207681_10512999 3300025923 Bacteria 983
110 Ga0207681_10823266 3300025923 Bacteria 776
111 Ga0207694_10443646 3300025924 Bacteria 1083
112 Ga0207644_10097089 3300025931 Unclassified 2207
113 Ga0207690_10083288 3300025932 Bacteria 2239
114 Ga0207690_10132635 3300025932 Bacteria 1825
115 Ga0207690_10235281 3300025932 Bacteria 1408
116 Ga0207706_10076669 3300025933 Bacteria 2940
117 Ga0207706_10080348 3300025933 Bacteria 2867
118 Ga0207686_10006762 3300025934 Bacteria 6174
119 Ga0207704_10017040 3300025938 Bacteria 3754
120 Ga0207691_10092451 3300025940 Bacteria 2709
121 Ga0207691_10125820 3300025940 Bacteria 2268
122 Ga0207691_10345996 3300025940 Bacteria 1272
123 Ga0207711_10025372 3300025941 Bacteria 4973
124 Ga0207711_10882611 3300025941 Bacteria 832
125 Ga0207661_10016120 3300025944 Bacteria 5507
126 Ga0207661_10029266 3300025944 Bacteria 4228
127 Ga0207679_10130173 3300025945 Bacteria 2017
128 Ga0207667_10838687 3300025949 Bacteria 914
129 Ga0207667_10928742 3300025949 Bacteria 861
130 Ga0207651_11278420 3300025960 Bacteria 659
131 Ga0207668_10763986 3300025972 Bacteria 853
132 Ga0207640_10162368 3300025981 Bacteria 1654
133 Ga0207658_10753673 3300025986 Bacteria 882
134 Ga0207677_10096267 3300026023 Bacteria 2165
135 Ga0207703_10049297 3300026035 Bacteria 3404
136 Ga0207639_10042896 3300026041 Bacteria 3393
137 Ga0207702_10119820 3300026078 Bacteria 2354
138 Ga0207641_10839019 3300026088 Bacteria 910
139 Ga0207648_10077479 3300026089 Bacteria 2898
140 Ga0207676_10636992 3300026095 Bacteria 1027
141 Ga0207674_10294578 3300026116 Bacteria 1571
142 Ga0207683_10147117 3300026121 Bacteria 2125
143 Ga0207683_10542788 3300026121 Bacteria 1075
144 Ga0207698_10686034 3300026142 Bacteria 1018
145 Ga0207698_10809494 3300026142 Bacteria 939
146 Ga0307408_100003832 3300031548 Bacteria 10235
147 Ga0307408_100007845 3300031548 Bacteria 7056
148 Ga0307408_100045716 3300031548 Bacteria 3128
149 Ga0307408_100107277 3300031548 Bacteria 2138
150 Ga0307405_10001877 3300031731 Bacteria 9022
151 Ga0307405_10007035 3300031731 Bacteria 5593
152 Ga0307405_10014034 3300031731 Bacteria 4294
153 Ga0307405_10139547 3300031731 Bacteria 1688
154 Ga0307405_10232317 3300031731 Bacteria 1360
155 Ga0307413_10002871 3300031824 Bacteria 7111
156 Ga0307413_10002970 3300031824 Bacteria 7020
157 Ga0307410_10000293 3300031852 Bacteria 19371
158 Ga0307410_10001675 3300031852 Bacteria 10192
159 Ga0307410_10002581 3300031852 Bacteria 8788
160 Ga0307410_10070354 3300031852 Bacteria 2423
161 Ga0307410_10615875 3300031852 Bacteria 907
162 Ga0307410_11763059 3300031852 Unclassified 549
163 Ga0307406_10001900 3300031901 Bacteria 11382
164 Ga0307406_10003596 3300031901 Bacteria 8453
165 Ga0307406_10005196 3300031901 Bacteria 7110
166 Ga0307406_10202836 3300031901 Bacteria 1461
167 Ga0307407_10001427 3300031903 Bacteria 8650
168 Ga0307407_10003034 3300031903 Bacteria 6757
169 Ga0307407_10019367 3300031903 Bacteria 3464
170 Ga0307407_10402094 3300031903 Unclassified 983
171 Ga0307412_10000509 3300031911 Bacteria 23239
172 Ga0307412_10288914 3300031911 Bacteria 1291
173 Ga0307409_100001270 3300031995 Bacteria 12181
174 Ga0307409_100001327 3300031995 Bacteria 12000
175 Ga0307409_100028881 3300031995 Bacteria 3960
176 Ga0307409_100098549 3300031995 Bacteria 2417
177 Ga0307409_100221218 3300031995 Bacteria 1709
178 Ga0307409_100541611 3300031995 Bacteria 1141
179 Ga0307409_100597436 3300031995 Bacteria 1090
180 Ga0307409_101427903 3300031995 Bacteria 719
181 Ga0307409_101778126 3300031995 Bacteria 645
182 Ga0307416_100004586 3300032002 Bacteria 8354
183 Ga0307416_100005823 3300032002 Bacteria 7642
184 Ga0307416_100054912 3300032002 Bacteria 3204
185 Ga0307416_100081033 3300032002 Bacteria 2742
186 Ga0307416_100154556 3300032002 Bacteria 2110
187 Ga0307416_100374327 3300032002 Bacteria 1451
188 Ga0307414_10004773 3300032004 Bacteria 7397
189 Ga0307414_10026346 3300032004 Bacteria 3741
190 Ga0307414_10058966 3300032004 Bacteria 2708
191 Ga0307414_11052416 3300032004 Bacteria 750
192 Ga0307411_10000890 3300032005 Bacteria 11305
193 Ga0307411_10002229 3300032005 Bacteria 8448
194 Ga0307411_10006251 3300032005 Bacteria 5939
195 Ga0307411_10083885 3300032005 Bacteria 2202
196 Ga0307411_10748729 3300032005 Bacteria 856
197 Ga0307415_100002626 3300032126 Bacteria 8951
198 Ga0307415_100005490 3300032126 Bacteria 6738
199 Ga0307415_100005565 3300032126 Bacteria 6703
200 Ga0307415_100006157 3300032126 Bacteria 6439
201 Ga0307415_100852594 3300032126 Bacteria 836
202 Ga0373933_0421934 3300035724 Unclassified 871
203 Ga0373937_0184541 3300036401 Bacteria 1959
204 Ga0373937_1196330 3300036401 Bacteria 708
205 Ga0395898_0160941 3300037466 Bacteria 2147
206 Ga0395905_0026515 3300037471 Bacteria 5463
207 Ga0436364_0903318 3300037853 Bacteria 2032
208 Ga0395901_0092799 3300038443 Bacteria 3160
209 Ga0436365_0413128 3300039437 Bacteria 692
210 Ga0436365_1869215 3300039437 Bacteria 608
211 Ga0450923_188498 3300042125 Bacteria 510
212 Ga0451577_1547749 3300042876 Bacteria 586
213 Ga0466966_0447160 3300044684 Bacteria 777
214 Ga0466960_0243896 3300044901 Bacteria 996
215 Ga0495638_0271747 3300046460 Unclassified 925
216 Ga0495651_0036085 3300046462 Bacteria 3848
217 Ga0495651_0074753 3300046462 Bacteria 2570
218 Ga0495653_0143678 3300046463 Bacteria 1675
219 Ga0495639_0217534 3300046475 Bacteria 938
220 Ga0495639_0222769 3300046475 Unclassified 928
221 Ga0495662_0124965 3300046476 Bacteria 1263
222 Ga0495662_0307855 3300046476 Bacteria 779
223 Ga0495584_0497600 3300046491 Bacteria 621
224 Ga0495594_0590996 3300046499 Unclassified 629
225 Ga0495618_0218211 3300046514 Bacteria 1204
226 Ga0495628_0138651 3300046516 Bacteria 1857
227 Ga0495628_0142579 3300046516 Bacteria 1828
228 Ga0495628_0190165 3300046516 Bacteria 1550
229 Ga0495630_0039660 3300046517 Bacteria 3520
230 Ga0495642_0238893 3300046528 Bacteria 794
231 Ga0495652_0357632 3300046529 Bacteria 1044
232 Ga0495665_0076954 3300046531 Bacteria 1756
233 Ga0495640_0019429 3300046533 Bacteria 5014
234 Ga0495640_0123069 3300046533 Bacteria 1684
235 Ga0495586_0014883 3300046535 Bacteria 4135
236 Ga0495587_0368434 3300046536 Bacteria 800
237 Ga0495645_0011640 3300046543 Bacteria 6196
238 Ga0495667_0007257 3300046559 Bacteria 7521
239 Ga0495667_0039352 3300046559 Bacteria 3144
240 Ga0495667_0162778 3300046559 Bacteria 1435
241 Ga0495634_0084129 3300046642 Bacteria 2075
242 Ga0495635_0034630 3300046663 Bacteria 3503
243 Ga0495635_0077247 3300046663 Bacteria 2281
244 Ga0495657_0045392 3300046675 Bacteria 2982
245 Ga0495599_0106129 3300046678 Bacteria 1750
246 Ga0495599_0466692 3300046678 Unclassified 746
247 Ga0495623_0319730 3300046679 Bacteria 853
248 Ga0495669_0175962 3300046684 Bacteria 1019
249 Ga0495613_0013492 3300046689 Bacteria 6069
250 Ga0495613_0036447 3300046689 Bacteria 3647
251 Ga0495624_0080311 3300046690 Bacteria 2021
252 Ga0495600_0064307 3300046809 Bacteria 2398
253 Ga0495600_0112127 3300046809 Bacteria 1776
254 Ga0495581_0107080 3300047315 Bacteria 1625
255 Ga0495604_0096337 3300047317 Bacteria 2184
256 Ga0495604_0302583 3300047317 Bacteria 1074
257 Ga0495674_0014538 3300047319 Bacteria 7364
258 Ga0495674_0036386 3300047319 Bacteria 4431
259 Ga0495680_0065800 3300047322 Bacteria 2775
260 Ga0495675_0082637 3300047444 Bacteria 2022
261 Ga0495675_0172255 3300047444 Bacteria 1329
262 Ga0495675_0245025 3300047444 Unclassified 1078
263 Ga0495675_0330654 3300047444 Bacteria 900
264 Ga0495677_0220484 3300047445 Bacteria 739
265 Ga0495684_0011958 3300047471 Bacteria 6693
266 Ga0495684_0253451 3300047471 Bacteria 1279
267 Ga0495602_0260081 3300048088 Bacteria 1288
268 Ga0495602_0927632 3300048088 Bacteria 578
269 Ga0496101_0503974 3300048904 Bacteria 956
270 Ga0496106_0148843 3300048909 Unclassified 1846
271 Ga0496106_0374038 3300048909 Bacteria 1145
272 Ga0496109_0108598 3300048912 Bacteria 2579
273 Ga0496113_0057041 3300048916 Bacteria 2933
274 Ga0496115_0235526 3300048918 Bacteria 1509
275 Ga0496115_0258003 3300048918 Bacteria 1434
276 Ga0501033_0009200 3300049570 Bacteria 7608
277 Ga0501036_0157723 3300049572 Bacteria 1914
278 Ga0501037_0203005 3300049573 Bacteria 1400
279 Ga0501038_0208231 3300049574 Unclassified 1566
280 Ga0501039_0942725 3300049575 Unclassified 671
281 Ga0501043_0192109 3300049579 Bacteria 1587
282 Ga0501046_0252038 3300049580 Bacteria 1299
283 Ga0501047_0052892 3300049581 Bacteria 3925
284 Ga0501047_0259358 3300049581 Bacteria 1586
285 Ga0501074_0156376 3300049590 Bacteria 1629
286 Ga0501075_0334236 3300049591 Bacteria 1154
287 Ga0501076_1431860 3300049592 Bacteria 568
288 Ga0501242_040563 3300049674 Bacteria 657
289 Ga0501079_0044622 3300049741 Bacteria 3421
290 Ga0501270_093526 3300049767 Bacteria 617
291 Ga0501035_0005864 3300049822 Bacteria 11577
292 Ga0501035_0080761 3300049822 Bacteria 2871
293 Ga0501044_0023019 3300049823 Bacteria 6631
294 Ga0501044_0250470 3300049823 Bacteria 1712
295 nmdc:mga0qj67_185244_c1 3300050509 Unclassified 1691
296 nmdc:mga0qj67_318874_c1 3300050509 Bacteria 1258
297 nmdc:mga06r32_239749_c1 3300050510 Bacteria 1801
298 nmdc:mga08y16_4720_c1 3300050511 Bacteria 14204
299 nmdc:mga0rr50_89369_c1 3300050513 Bacteria 2395
300 nmdc:mga0a205_261447_c1 3300050515 Bacteria 1608
301 Ga0495619_0152214 3300053085 Bacteria 1596
302 Ga0500628_000669 3300053129 Bacteria 6175
303 Ga0307413_10550196
304 Ga0070658_10070873
305 Ga0070658_10115520
306 Ga0070676_10016983
307 Ga0070683_100004379
308 Ga0070683_100010415
309 Ga0070666_10933150
310 Ga0070680_100001974
311 Ga0070680_100003671
312 Ga0070680_100501154
313 Ga0070660_100784779
314 Ga0070661_100230660
315 Ga0070668_100018950
316 Ga0070671_100472694
317 Ga0070674_100444623
318 Ga0070673_101191805
319 Ga0070659_100020262
320 Ga0070659_100192038
321 Ga0070659_100345431
322 Ga0070667_100031989
323 Ga0070667_100056938
324 Ga0070667_100334254
325 Ga0070703_10084132
326 Ga0070713_100310015
327 Ga0070663_101014352
328 Ga0070678_101464153
329 Ga0070681_10306864
330 Ga0070681_10727233
331 Ga0070681_11189436
332 Ga0070706_101095260
333 Ga0070698_100002034
334 Ga0070699_100125415
335 Ga0070679_100000483
336 Ga0070684_100006177
337 Ga0070684_100276467
338 Ga0070684_100855900
339 Ga0068853_100150974
340 Ga0070672_100087661
341 Ga0070672_100101890
342 Ga0070672_100496723
343 Ga0070672_101092673
344 Ga0070686_100574200
345 Ga0070695_100217765
346 Ga0070693_100520305
347 Ga0070704_101337544
348 Ga0068855_100306239
349 Ga0068855_101036834
350 Ga0068855_101934387
351 Ga0070664_100016526
352 Ga0070664_100571178
353 Ga0068857_100020623
354 Ga0068854_100099342
355 Ga0070702_100065183
356 Ga0068852_100769120
357 Ga0068864_100092517
358 Ga0068851_10025339
359 Ga0068863_100195054
360 Ga0068858_100150314
361 Ga0068860_100069883
362 Ga0068860_100863232
363 Ga0081539_10032509
364 Ga0075428_100307896
365 Ga0075430_100350959
366 Ga0075431_100020224
367 Ga0075429_100178556
368 Ga0068865_100001780
369 Ga0075436_100141143
370 Ga0105240_11132622
371 Ga0111539_10023132
372 Ga0105245_10674804
373 Ga0114129_11012126
374 Ga0105243_10061060
375 Ga0105242_10018480
376 Ga0105248_10018132
377 Ga0105248_10495243
378 Ga0105248_11449411
379 Ga0105238_10000276
380 Ga0105238_11922848
381 Ga0105249_10166586
382 Ga0157373_10384111
383 Ga0157371_10060425
384 Ga0157369_10117352
385 Ga0157374_10653126
386 Ga0157372_10137712
387 Ga0157372_10205287
388 Ga0157372_10477678
389 Ga0157372_10640282
390 Ga0157372_10734770
391 Ga0157372_12730118
392 Ga0157375_10034319
393 Ga0157375_10060493
394 Ga0163163_11140342
395 Ga0157380_10448763
396 Ga0213875_10156057
397 Ga0207682_10075415
398 Ga0207645_10059539
399 Ga0207645_10164403
400 Ga0207645_10942065
401 Ga0207705_10005218
402 Ga0207705_10011778
403 Ga0207705_10044994
404 Ga0207705_10328102
405 Ga0207707_10040390
406 Ga0207707_10509330
407 Ga0207660_10003774
408 Ga0207660_10017088
409 Ga0207660_10717182
410 Ga0207681_10423144
411 Ga0207681_10512999
412 Ga0207681_10823266
413 Ga0207694_10443646
414 Ga0207644_10097089
415 Ga0207690_10083288
416 Ga0207690_10132635
417 Ga0207690_10235281
418 Ga0207706_10076669
419 Ga0207706_10080348
420 Ga0207686_10006762
421 Ga0207704_10017040
422 Ga0207691_10092451
423 Ga0207691_10125820
424 Ga0207691_10345996
425 Ga0207711_10025372
426 Ga0207711_10882611
427 Ga0207661_10016120
428 Ga0207661_10029266
429 Ga0207679_10130173
430 Ga0207667_10838687
431 Ga0207667_10928742
432 Ga0207651_11278420
433 Ga0207668_10763986
434 Ga0207640_10162368
435 Ga0207658_10753673
436 Ga0207677_10096267
437 Ga0207703_10049297
438 Ga0207639_10042896
439 Ga0207702_10119820
440 Ga0207641_10839019
441 Ga0207648_10077479
442 Ga0207676_10636992
443 Ga0207674_10294578
444 Ga0207683_10147117
445 Ga0207683_10542788
446 Ga0207698_10686034
447 Ga0207698_10809494
448 Ga0307408_100003832
449 Ga0307408_100007845
450 Ga0307408_100045716
451 Ga0307408_100107277
452 Ga0307405_10001877
453 Ga0307405_10007035
454 Ga0307405_10014034
455 Ga0307405_10139547
456 Ga0307405_10232317
457 Ga0307413_10002871
458 Ga0307413_10002970
459 Ga0307410_10000293
460 Ga0307410_10001675
461 Ga0307410_10002581
462 Ga0307410_10070354
463 Ga0307410_10615875
464 Ga0307410_11763059
465 Ga0307406_10001900
466 Ga0307406_10003596
467 Ga0307406_10005196
468 Ga0307406_10202836
469 Ga0307407_10001427
470 Ga0307407_10003034
471 Ga0307407_10019367
472 Ga0307407_10402094
473 Ga0307412_10000509
474 Ga0307412_10288914
475 Ga0307409_100001270
476 Ga0307409_100001327
477 Ga0307409_100028881
478 Ga0307409_100098549
479 Ga0307409_100221218
480 Ga0307409_100541611
481 Ga0307409_100597436
482 Ga0307409_101427903
483 Ga0307409_101778126
484 Ga0307416_100004586
485 Ga0307416_100005823
486 Ga0307416_100054912
487 Ga0307416_100081033
488 Ga0307416_100154556
489 Ga0307416_100374327
490 Ga0307414_10004773
491 Ga0307414_10026346
492 Ga0307414_10058966
493 Ga0307414_11052416
494 Ga0307411_10000890
495 Ga0307411_10002229
496 Ga0307411_10006251
497 Ga0307411_10083885
498 Ga0307411_10748729
499 Ga0307415_100002626
500 Ga0307415_100005490
501 Ga0307415_100005565
502 Ga0307415_100006157
503 Ga0307415_100852594
504 Ga0373933_0421934
505 Ga0373937_0184541
506 Ga0373937_1196330
507 Ga0395898_0160941
508 Ga0395905_0026515
509 Ga0436364_0903318
510 Ga0395901_0092799
511 Ga0436365_0413128
512 Ga0436365_1869215
513 Ga0450923_188498
514 Ga0451577_1547749
515 Ga0466966_0447160
516 Ga0466960_0243896
517 Ga0495638_0271747
518 Ga0495651_0036085
519 Ga0495651_0074753
520 Ga0495653_0143678
521 Ga0495639_0217534
522 Ga0495639_0222769
523 Ga0495662_0124965
524 Ga0495662_0307855
525 Ga0495584_0497600
526 Ga0495594_0590996
527 Ga0495618_0218211
528 Ga0495628_0138651
529 Ga0495628_0142579
530 Ga0495628_0190165
531 Ga0495630_0039660
532 Ga0495642_0238893
533 Ga0495652_0357632
534 Ga0495665_0076954
535 Ga0495640_0019429
536 Ga0495640_0123069
537 Ga0495586_0014883
538 Ga0495587_0368434
539 Ga0495645_0011640
540 Ga0495667_0007257
541 Ga0495667_0039352
542 Ga0495667_0162778
543 Ga0495634_0084129
544 Ga0495635_0034630
545 Ga0495635_0077247
546 Ga0495657_0045392
547 Ga0495599_0106129
548 Ga0495599_0466692
549 Ga0495623_0319730
550 Ga0495669_0175962
551 Ga0495613_0013492
552 Ga0495613_0036447
553 Ga0495624_0080311
554 Ga0495600_0064307
555 Ga0495600_0112127
556 Ga0495581_0107080
557 Ga0495604_0096337
558 Ga0495604_0302583
559 Ga0495674_0014538
560 Ga0495674_0036386
561 Ga0495680_0065800
562 Ga0495675_0082637
563 Ga0495675_0172255
564 Ga0495675_0245025
565 Ga0495675_0330654
566 Ga0495677_0220484
567 Ga0495684_0011958
568 Ga0495684_0253451
569 Ga0495602_0260081
570 Ga0495602_0927632
571 Ga0496101_0503974
572 Ga0496106_0148843
573 Ga0496106_0374038
574 Ga0496109_0108598
575 Ga0496113_0057041
576 Ga0496115_0235526
577 Ga0496115_0258003
578 Ga0501033_0009200
579 Ga0501036_0157723
580 Ga0501037_0203005
581 Ga0501038_0208231
582 Ga0501039_0942725
583 Ga0501043_0192109
584 Ga0501046_0252038
585 Ga0501047_0052892
586 Ga0501047_0259358
587 Ga0501074_0156376
588 Ga0501075_0334236
589 Ga0501076_1431860
590 Ga0501242_040563
591 Ga0501079_0044622
592 Ga0501270_093526
593 Ga0501035_0005864
594 Ga0501035_0080761
595 Ga0501044_0023019
596 Ga0501044_0250470
597 nmdc:mga0qj67_185244_c1
598 nmdc:mga0qj67_318874_c1
599 nmdc:mga06r32_239749_c1
600 nmdc:mga08y16_4720_c1
601 nmdc:mga0rr50_89369_c1
602 nmdc:mga0a205_261447_c1
603 Ga0495619_0152214
604 Ga0500628_000669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

11

142

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.8991 7 124
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.8882 7 124
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.8881 9 124
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.882 7 124
5gg7-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp, 8-oxo-dgmp and pyrophosphate (i) 0.8783 7 124
ID Description Score Start End Superfamily
af_P90840_171_337_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8981 74 92 3.40.50.300
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.887 11 124 3.90.79.10
af_D3ZM99_3_172_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8814 73 91 3.40.50.300
af_P9WIY3_15_154_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8715 7 124 3.90.79.10
af_A0A0R4IW29_2_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8461 73 89 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W0YMN8-F1-model_v4 NUDIX hydrolase 0.9644 1 124 GO:0004081
GO:0006167
GO:0006754
AF-A0A2Z3L9B8-F1-model_v4 Mutator protein MutT4 (EC 3.6.1.-) 0.959 6 126 GO:0004081
GO:0006167
GO:0006754
AF-A0A2V7PT45-F1-model_v4 Nudix hydrolase domain-containing protein 0.9388 1 105 GO:0004081
GO:0006167
GO:0006754
AF-X0ZID8-F1-model_v4 Nudix hydrolase domain-containing protein 0.9318 6 98 GO:0004081
GO:0006167
GO:0006754
AF-A0A7Y3MKA8-F1-model_v4 NUDIX domain-containing protein 0.9316 6 127 GO:0004081
GO:0006167
GO:0006754

Map