F396568

General Info

Members Datasets Scaffolds Average Seq Length
302 163 604 139

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10015120|Ga0265340_100151202
Length 144
Sequence MRWIEWSVGPEPAVRDAGDRGAAIVDFALIGAFLTLLFVAVLQLALVLHVRNTLIDCAGEGARFGALADRSPQAGVARTRVLIRAELNARYAEQVSGRSARVDGLDTVEIRVQAPIPLIGLIGRTRMLSVTGHALAEPQPEGFR

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
68 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
69 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
72 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
75 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
76 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
77 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
78 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
81 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
82 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
83 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
84 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
139 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
140 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
141 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
142 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
143 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
144 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
145 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
146 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
147 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
148 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
149 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
150 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
151 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
152 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
153 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
154 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
155 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
156 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
157 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
158 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
159 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
160 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
161 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
162 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
163 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0
Isolates 8.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 15.89
Rhizosphere 76.49
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10015120 3300031247 Bacteria 4015
2 LJQas_1002160 3300000549 Bacteria 2775
3 JGI25151J46595_10010546 3300003187 Bacteria 4284
4 Ga0065714_10019548 3300005288 Bacteria 1538
5 Ga0065714_10326973 3300005288 Bacteria 661
6 Ga0065714_10483403 3300005288 Bacteria 533
7 Ga0065712_10553855 3300005290 Bacteria 616
8 Ga0070676_10282704 3300005328 Bacteria 1119
9 Ga0070670_100314868 3300005331 Bacteria 1370
10 Ga0070666_10431943 3300005335 Bacteria 950
11 Ga0070682_100477055 3300005337 Unclassified 961
12 Ga0070668_100233682 3300005347 Bacteria 1521
13 Ga0070675_100301938 3300005354 Bacteria 1411
14 Ga0070671_100270360 3300005355 Bacteria 1445
15 Ga0070667_100068468 3300005367 Bacteria 3020
16 Ga0070678_100223652 3300005456 Bacteria 1565
17 Ga0070672_100022738 3300005543 Bacteria 4611
18 Ga0081539_10290274 3300005985 Bacteria 708
19 Ga0075432_10014324 3300006058 Bacteria 2701
20 Ga0075432_10031492 3300006058 Bacteria 1836
21 Ga0105251_10018914 3300009011 Bacteria 3651
22 Ga0105245_10201756 3300009098 Bacteria 1910
23 Ga0105243_10055471 3300009148 Bacteria 3149
24 Ga0105243_10381411 3300009148 Bacteria 1304
25 Ga0105246_10005399 3300011119 Bacteria 7781
26 Ga0105246_10595746 3300011119 Bacteria 954
27 Ga0157373_10006775 3300013100 Bacteria 8531
28 Ga0157371_10170566 3300013102 Bacteria 1555
29 Ga0157369_10210778 3300013105 Bacteria 2036
30 Ga0157374_10167928 3300013296 Bacteria 2139
31 Ga0157378_10155463 3300013297 Bacteria 2135
32 Ga0163162_10130233 3300013306 Bacteria 2624
33 Ga0157375_10144877 3300013308 Bacteria 2505
34 Ga0157375_10563916 3300013308 Bacteria 1300
35 Ga0157380_13091414 3300014326 Bacteria 531
36 Ga0209148_1005458 3300025254 Bacteria 2914
37 Ga0209129_1000028 3300025258 Bacteria 405451
38 Ga0209025_1003151 3300025294 Bacteria 16083
39 Ga0209051_1025171 3300025303 Bacteria 2429
40 Ga0207697_10028814 3300025315 Bacteria 2271
41 Ga0207655_1006828 3300025728 Bacteria 7499
42 Ga0207713_1066670 3300025735 Bacteria 1346
43 Ga0207682_10003984 3300025893 Bacteria 6287
44 Ga0207688_10658169 3300025901 Bacteria 661
45 Ga0207680_10105747 3300025903 Bacteria 1816
46 Ga0207645_10009070 3300025907 Bacteria 6903
47 Ga0207650_10621621 3300025925 Bacteria 909
48 Ga0207644_10449801 3300025931 Bacteria 1058
49 Ga0207709_10029375 3300025935 Bacteria 3188
50 Ga0207709_10091864 3300025935 Bacteria 1986
51 Ga0207691_10015137 3300025940 Bacteria 7339
52 Ga0207651_10010033 3300025960 Bacteria 5225
53 Ga0207668_10104636 3300025972 Bacteria 2111
54 Ga0207658_10132045 3300025986 Bacteria 2008
55 Ga0207683_10000852 3300026121 Bacteria 27982
56 Ga0207428_10003294 3300027907 Bacteria 15705
57 Ga0307408_100044217 3300031548 Bacteria 3172
58 Ga0307408_100059415 3300031548 Bacteria 2782
59 Ga0307408_100068407 3300031548 Bacteria 2615
60 Ga0307408_100072378 3300031548 Bacteria 2551
61 Ga0307408_100085806 3300031548 Bacteria 2365
62 Ga0307408_100125137 3300031548 Bacteria 1997
63 Ga0307408_100130378 3300031548 Bacteria 1960
64 Ga0307408_100186628 3300031548 Bacteria 1667
65 Ga0307408_100448662 3300031548 Bacteria 1118
66 Ga0307408_101226450 3300031548 Bacteria 700
67 Ga0307405_10008214 3300031731 Bacteria 5278
68 Ga0307405_10009778 3300031731 Bacteria 4933
69 Ga0307405_10031234 3300031731 Bacteria 3133
70 Ga0307405_10046404 3300031731 Bacteria 2669
71 Ga0307405_10050152 3300031731 Bacteria 2583
72 Ga0307405_10157494 3300031731 Bacteria 1604
73 Ga0307405_10179019 3300031731 Bacteria 1520
74 Ga0307405_10384847 3300031731 Bacteria 1093
75 Ga0307405_10385514 3300031731 Bacteria 1092
76 Ga0307413_10002647 3300031824 Bacteria 7331
77 Ga0307413_10026996 3300031824 Bacteria 3174
78 Ga0307413_10053966 3300031824 Bacteria 2436
79 Ga0307413_10273668 3300031824 Bacteria 1266
80 Ga0307413_10616805 3300031824 Bacteria 890
81 Ga0307410_10003523 3300031852 Bacteria 7867
82 Ga0307410_10010788 3300031852 Bacteria 5197
83 Ga0307410_10014364 3300031852 Bacteria 4657
84 Ga0307410_10054907 3300031852 Bacteria 2702
85 Ga0307410_10079608 3300031852 Bacteria 2296
86 Ga0307410_10102490 3300031852 Bacteria 2054
87 Ga0307410_10298070 3300031852 Bacteria 1271
88 Ga0307410_10833902 3300031852 Bacteria 786
89 Ga0307410_10838254 3300031852 Bacteria 784
90 Ga0307406_10082954 3300031901 Bacteria 2137
91 Ga0307406_10366639 3300031901 Bacteria 1131
92 Ga0307406_10673662 3300031901 Bacteria 861
93 Ga0307406_10736506 3300031901 Bacteria 826
94 Ga0307406_11250095 3300031901 Bacteria 646
95 Ga0307407_10008468 3300031903 Bacteria 4726
96 Ga0307407_10018181 3300031903 Bacteria 3549
97 Ga0307407_10125886 3300031903 Bacteria 1632
98 Ga0307407_10149697 3300031903 Bacteria 1515
99 Ga0307407_10190704 3300031903 Unclassified 1366
100 Ga0307407_10255859 3300031903 Bacteria 1202
101 Ga0307407_10439535 3300031903 Bacteria 944
102 Ga0307407_10921994 3300031903 Bacteria 671
103 Ga0307412_10002485 3300031911 Bacteria 10265
104 Ga0307412_10004859 3300031911 Bacteria 7501
105 Ga0307412_10006531 3300031911 Bacteria 6600
106 Ga0307412_10008693 3300031911 Bacteria 5807
107 Ga0307412_10009054 3300031911 Bacteria 5704
108 Ga0307412_10016673 3300031911 Bacteria 4381
109 Ga0307412_10042313 3300031911 Bacteria 2959
110 Ga0307412_10051664 3300031911 Bacteria 2717
111 Ga0307412_10059256 3300031911 Bacteria 2565
112 Ga0307412_10187100 3300031911 Bacteria 1563
113 Ga0307412_10189144 3300031911 Bacteria 1555
114 Ga0307412_10421492 3300031911 Bacteria 1092
115 Ga0307412_10430741 3300031911 Bacteria 1081
116 Ga0307412_10528610 3300031911 Unclassified 987
117 Ga0307412_10588803 3300031911 Bacteria 940
118 Ga0307409_100006258 3300031995 Bacteria 6974
119 Ga0307409_100009116 3300031995 Bacteria 6076
120 Ga0307409_100168631 3300031995 Bacteria 1924
121 Ga0307409_100229950 3300031995 Bacteria 1680
122 Ga0307409_100603125 3300031995 Bacteria 1085
123 Ga0307409_101006338 3300031995 Bacteria 852
124 Ga0307409_101228033 3300031995 Bacteria 773
125 Ga0307409_101393980 3300031995 Bacteria 727
126 Ga0307409_101789499 3300031995 Bacteria 643
127 Ga0307416_100054811 3300032002 Bacteria 3207
128 Ga0307416_100115012 3300032002 Bacteria 2381
129 Ga0307416_100200153 3300032002 Bacteria 1894
130 Ga0307416_100230235 3300032002 Bacteria 1786
131 Ga0307416_100327169 3300032002 Bacteria 1538
132 Ga0307416_100358428 3300032002 Bacteria 1479
133 Ga0307416_100430473 3300032002 Bacteria 1366
134 Ga0307416_100963263 3300032002 Bacteria 955
135 Ga0307416_101054068 3300032002 Bacteria 917
136 Ga0307416_101638283 3300032002 Bacteria 748
137 Ga0307416_101777186 3300032002 Bacteria 721
138 Ga0307416_102010695 3300032002 Bacteria 680
139 Ga0307414_10060127 3300032004 Bacteria 2686
140 Ga0307414_10568216 3300032004 Bacteria 1013
141 Ga0307414_11072449 3300032004 Bacteria 743
142 Ga0307414_11199620 3300032004 Bacteria 703
143 Ga0307414_11293601 3300032004 Bacteria 676
144 Ga0307411_10041951 3300032005 Bacteria 2916
145 Ga0307411_11495177 3300032005 Bacteria 620
146 Ga0307415_100084286 3300032126 Bacteria 2280
147 Ga0307415_100112152 3300032126 Bacteria 2026
148 Ga0307415_100429255 3300032126 Bacteria 1136
149 Ga0307415_100692328 3300032126 Bacteria 919
150 Ga0307415_102046121 3300032126 Bacteria 558
151 Ga0395899_0035070 3300037312 Bacteria 3767
152 Ga0395899_0044179 3300037312 Bacteria 3321
153 Ga0395900_0014548 3300037418 Bacteria 8030
154 Ga0395900_0217876 3300037418 Bacteria 1925
155 Ga0395898_0024944 3300037466 Bacteria 6028
156 Ga0395898_0126604 3300037466 Bacteria 2447
157 Ga0395901_0056493 3300038443 Bacteria 4083
158 Ga0395901_0245275 3300038443 Bacteria 1867
159 Ga0436365_1831952 3300039437 Bacteria 757
160 Ga0439436_0002846 3300041404 Bacteria 5244
161 Ga0439439_0073445 3300041406 Bacteria 918
162 Ga0439466_0042461 3300041411 Bacteria 1514
163 Ga0439466_0053220 3300041411 Bacteria 1321
164 Ga0439465_0005540 3300041413 Bacteria 4023
165 Ga0451787_755741 3300041441 Bacteria 1007
166 Ga0451789_0809446 3300041443 Bacteria 2450
167 Ga0451793_0330720 3300041452 Bacteria 534
168 Ga0451793_0796630 3300041452 Unclassified 1165
169 Ga0451797_0697816 3300041453 Unclassified 1282
170 Ga0451847_0701437 3300041503 Unclassified 557
171 Ga0439433_0000479 3300041999 Bacteria 7395
172 Ga0439442_000001 3300042002 Bacteria 161142
173 Ga0439442_010935 3300042002 Bacteria 1844
174 Ga0439432_055716 3300042006 Bacteria 1226
175 Ga0439449_0000147 3300042007 Bacteria 23936
176 Ga0439449_0004769 3300042007 Bacteria 5234
177 Ga0439449_0011479 3300042007 Bacteria 3333
178 Ga0439452_096379 3300042010 Bacteria 637
179 Ga0439457_006357 3300042014 Bacteria 2900
180 Ga0439457_143704 3300042014 Bacteria 572
181 Ga0439462_0046947 3300042015 Bacteria 1157
182 Ga0439462_0072295 3300042015 Bacteria 937
183 Ga0450920_000706 3300042122 Bacteria 5368
184 Ga0450907_000102 3300042146 Bacteria 32710
185 Ga0439434_0000022 3300042435 Bacteria 37374
186 Ga0439434_0010838 3300042435 Bacteria 2691
187 Ga0450918_000354 3300042531 Bacteria 10131
188 Ga0450918_040352 3300042531 Bacteria 837
189 Ga0495580_0018489 3300046472 Bacteria 5189
190 Ga0495582_0080354 3300046473 Bacteria 1810
191 Ga0495639_0005171 3300046475 Bacteria 5605
192 Ga0495594_0185971 3300046499 Bacteria 1183
193 Ga0495608_0229552 3300046511 Unclassified 1162
194 Ga0495631_0209322 3300046518 Bacteria 833
195 Ga0495663_0073470 3300046525 Bacteria 1092
196 Ga0495642_0038622 3300046528 Bacteria 1935
197 Ga0495665_0098215 3300046531 Bacteria 1537
198 Ga0495640_0425762 3300046533 Unclassified 813
199 Ga0495586_0002737 3300046535 Bacteria 9540
200 Ga0495586_0030298 3300046535 Bacteria 2895
201 Ga0495645_0111340 3300046543 Bacteria 1937
202 Ga0495633_0205341 3300046558 Bacteria 904
203 Ga0495656_0000444 3300046615 Bacteria 13534
204 Ga0495635_0351687 3300046663 Bacteria 983
205 Ga0495588_0000656 3300046674 Bacteria 16020
206 Ga0495588_0044392 3300046674 Bacteria 2276
207 Ga0495588_0048422 3300046674 Bacteria 2183
208 Ga0495670_0001138 3300046691 Bacteria 12922
209 Ga0495581_0002466 3300047315 Bacteria 10464
210 Ga0495581_0028028 3300047315 Bacteria 3265
211 Ga0495636_0018098 3300047318 Bacteria 2826
212 Ga0495680_0423760 3300047322 Bacteria 915
213 Ga0495675_0434819 3300047444 Bacteria 761
214 Ga0495677_0013135 3300047445 Bacteria 3014
215 Ga0495593_0004684 3300047673 Bacteria 8132
216 Ga0496101_0006125 3300048904 Bacteria 7719
217 Ga0496101_0105336 3300048904 Bacteria 2116
218 Ga0496101_0554402 3300048904 Bacteria 909
219 Ga0496101_1492360 3300048904 Bacteria 526
220 Ga0496102_0002123 3300048905 Bacteria 17053
221 Ga0496102_0041933 3300048905 Bacteria 4146
222 Ga0496102_0142078 3300048905 Bacteria 2251
223 Ga0496102_0186586 3300048905 Bacteria 1954
224 Ga0496102_0330174 3300048905 Bacteria 1436
225 Ga0496102_0371745 3300048905 Bacteria 1345
226 Ga0496102_0421138 3300048905 Bacteria 1254
227 Ga0496102_0562896 3300048905 Bacteria 1062
228 Ga0496102_0822695 3300048905 Bacteria 851
229 Ga0496103_0001053 3300048906 Bacteria 19227
230 Ga0496103_0022096 3300048906 Bacteria 3830
231 Ga0496103_0059358 3300048906 Bacteria 2376
232 Ga0496103_0123018 3300048906 Bacteria 1653
233 Ga0496103_0607323 3300048906 Bacteria 696
234 Ga0496104_0191348 3300048907 Bacteria 1957
235 Ga0496104_0633401 3300048907 Bacteria 978
236 Ga0496105_0060492 3300048908 Bacteria 3125
237 Ga0496105_0969624 3300048908 Bacteria 637
238 Ga0496106_0002122 3300048909 Bacteria 14837
239 Ga0496106_0606498 3300048909 Bacteria 876
240 Ga0496107_0024718 3300048910 Bacteria 4250
241 Ga0496107_0075798 3300048910 Bacteria 2449
242 Ga0496107_0677046 3300048910 Bacteria 759
243 Ga0496108_0205670 3300048911 Bacteria 1708
244 Ga0496108_0491738 3300048911 Bacteria 1071
245 Ga0496108_0669000 3300048911 Bacteria 902
246 Ga0496109_0046386 3300048912 Bacteria 3947
247 Ga0496109_0523099 3300048912 Bacteria 1119
248 Ga0496110_0005967 3300048913 Bacteria 9593
249 Ga0496110_0151830 3300048913 Bacteria 2098
250 Ga0496110_0697477 3300048913 Bacteria 916
251 Ga0496110_1345525 3300048913 Bacteria 623
252 Ga0496111_0039972 3300048914 Bacteria 3364
253 Ga0496111_0116619 3300048914 Bacteria 1969
254 Ga0496112_0334282 3300048915 Bacteria 1459
255 Ga0496113_1137124 3300048916 Bacteria 611
256 Ga0496114_0087152 3300048917 Bacteria 2647
257 Ga0496114_0279214 3300048917 Bacteria 1472
258 Ga0496114_1591075 3300048917 Bacteria 541
259 Ga0496121_0464664 3300048924 Unclassified 812
260 Ga0496121_0493834 3300048924 Bacteria 779
261 Ga0496122_0241007 3300048925 Bacteria 1020
262 Ga0496124_0245608 3300048927 Bacteria 1328
263 Ga0496125_0338588 3300048928 Bacteria 904
264 Ga0501032_0000370 3300049569 Bacteria 37322
265 Ga0501032_0405429 3300049569 Bacteria 875
266 Ga0501037_0004874 3300049573 Bacteria 9762
267 Ga0501038_0113814 3300049574 Bacteria 2238
268 Ga0501038_0174804 3300049574 Bacteria 1736
269 Ga0501039_0021363 3300049575 Bacteria 4966
270 Ga0501043_0101294 3300049579 Bacteria 2263
271 Ga0501043_0240694 3300049579 Bacteria 1395
272 Ga0501067_0490631 3300049583 Unclassified 687
273 Ga0501044_0034983 3300049823 Bacteria 5263
274 Ga0501212_117885 3300049851 Bacteria 513
275 nmdc:mga06z11_454238_c1 3300050494 Bacteria 774
276 Ga0495595_0363453 3300053084 Unclassified 731
277 2537898991 2537561592 Bacteria 4348607
278 2775655121 2775506735 Bacteria 4556596
279 2808827628 2808606357 Bacteria 4466944
280 2808852997 2808606360 Bacteria 4404006
281 2808878492 2808606366 Bacteria 4415912
282 2808891872 2808606370 Bacteria 4942454
283 2808896990 2808606371 Bacteria 4251511
284 2810364179 2808606700 Bacteria 3482157
285 2812320584 2811994871 Bacteria 4497550
286 2844849489 2844849076 Bacteria 4091819
287 2857741373 2857740372 Bacteria 4782044
288 2904499908 2904497146 Bacteria 4731781
289 2905929146 2905926851 Bacteria 4423176
290 2919037706 2919034639 Bacteria 4763403
291 2919542097 2919538618 Bacteria 4677069
292 2933420673 2933418574 Bacteria 4476724
293 2939598601 2939598168 Bacteria 4687164
294 2939648923 2939647034 Bacteria 4681660
295 2945918343 2945916053 Bacteria 4555517
296 2945921365 2945920336 Bacteria 4501603
297 2945959781 2945956166 Bacteria 5110334
298 2946005313 2946003308 Bacteria 3857229
299 2946038390 2946037020 Bacteria 4900426
300 2946062200 2946059875 Bacteria 4386623
301 2974306374 2974302888 Bacteria 4369871
302 8054111083 8054107350 Bacteria 5022511
303 Ga0265340_10015120
304 LJQas_1002160
305 JGI25151J46595_10010546
306 Ga0065714_10019548
307 Ga0065714_10326973
308 Ga0065714_10483403
309 Ga0065712_10553855
310 Ga0070676_10282704
311 Ga0070670_100314868
312 Ga0070666_10431943
313 Ga0070682_100477055
314 Ga0070668_100233682
315 Ga0070675_100301938
316 Ga0070671_100270360
317 Ga0070667_100068468
318 Ga0070678_100223652
319 Ga0070672_100022738
320 Ga0081539_10290274
321 Ga0075432_10014324
322 Ga0075432_10031492
323 Ga0105251_10018914
324 Ga0105245_10201756
325 Ga0105243_10055471
326 Ga0105243_10381411
327 Ga0105246_10005399
328 Ga0105246_10595746
329 Ga0157373_10006775
330 Ga0157371_10170566
331 Ga0157369_10210778
332 Ga0157374_10167928
333 Ga0157378_10155463
334 Ga0163162_10130233
335 Ga0157375_10144877
336 Ga0157375_10563916
337 Ga0157380_13091414
338 Ga0209148_1005458
339 Ga0209129_1000028
340 Ga0209025_1003151
341 Ga0209051_1025171
342 Ga0207697_10028814
343 Ga0207655_1006828
344 Ga0207713_1066670
345 Ga0207682_10003984
346 Ga0207688_10658169
347 Ga0207680_10105747
348 Ga0207645_10009070
349 Ga0207650_10621621
350 Ga0207644_10449801
351 Ga0207709_10029375
352 Ga0207709_10091864
353 Ga0207691_10015137
354 Ga0207651_10010033
355 Ga0207668_10104636
356 Ga0207658_10132045
357 Ga0207683_10000852
358 Ga0207428_10003294
359 Ga0307408_100044217
360 Ga0307408_100059415
361 Ga0307408_100068407
362 Ga0307408_100072378
363 Ga0307408_100085806
364 Ga0307408_100125137
365 Ga0307408_100130378
366 Ga0307408_100186628
367 Ga0307408_100448662
368 Ga0307408_101226450
369 Ga0307405_10008214
370 Ga0307405_10009778
371 Ga0307405_10031234
372 Ga0307405_10046404
373 Ga0307405_10050152
374 Ga0307405_10157494
375 Ga0307405_10179019
376 Ga0307405_10384847
377 Ga0307405_10385514
378 Ga0307413_10002647
379 Ga0307413_10026996
380 Ga0307413_10053966
381 Ga0307413_10273668
382 Ga0307413_10616805
383 Ga0307410_10003523
384 Ga0307410_10010788
385 Ga0307410_10014364
386 Ga0307410_10054907
387 Ga0307410_10079608
388 Ga0307410_10102490
389 Ga0307410_10298070
390 Ga0307410_10833902
391 Ga0307410_10838254
392 Ga0307406_10082954
393 Ga0307406_10366639
394 Ga0307406_10673662
395 Ga0307406_10736506
396 Ga0307406_11250095
397 Ga0307407_10008468
398 Ga0307407_10018181
399 Ga0307407_10125886
400 Ga0307407_10149697
401 Ga0307407_10190704
402 Ga0307407_10255859
403 Ga0307407_10439535
404 Ga0307407_10921994
405 Ga0307412_10002485
406 Ga0307412_10004859
407 Ga0307412_10006531
408 Ga0307412_10008693
409 Ga0307412_10009054
410 Ga0307412_10016673
411 Ga0307412_10042313
412 Ga0307412_10051664
413 Ga0307412_10059256
414 Ga0307412_10187100
415 Ga0307412_10189144
416 Ga0307412_10421492
417 Ga0307412_10430741
418 Ga0307412_10528610
419 Ga0307412_10588803
420 Ga0307409_100006258
421 Ga0307409_100009116
422 Ga0307409_100168631
423 Ga0307409_100229950
424 Ga0307409_100603125
425 Ga0307409_101006338
426 Ga0307409_101228033
427 Ga0307409_101393980
428 Ga0307409_101789499
429 Ga0307416_100054811
430 Ga0307416_100115012
431 Ga0307416_100200153
432 Ga0307416_100230235
433 Ga0307416_100327169
434 Ga0307416_100358428
435 Ga0307416_100430473
436 Ga0307416_100963263
437 Ga0307416_101054068
438 Ga0307416_101638283
439 Ga0307416_101777186
440 Ga0307416_102010695
441 Ga0307414_10060127
442 Ga0307414_10568216
443 Ga0307414_11072449
444 Ga0307414_11199620
445 Ga0307414_11293601
446 Ga0307411_10041951
447 Ga0307411_11495177
448 Ga0307415_100084286
449 Ga0307415_100112152
450 Ga0307415_100429255
451 Ga0307415_100692328
452 Ga0307415_102046121
453 Ga0395899_0035070
454 Ga0395899_0044179
455 Ga0395900_0014548
456 Ga0395900_0217876
457 Ga0395898_0024944
458 Ga0395898_0126604
459 Ga0395901_0056493
460 Ga0395901_0245275
461 Ga0436365_1831952
462 Ga0439436_0002846
463 Ga0439439_0073445
464 Ga0439466_0042461
465 Ga0439466_0053220
466 Ga0439465_0005540
467 Ga0451787_755741
468 Ga0451789_0809446
469 Ga0451793_0330720
470 Ga0451793_0796630
471 Ga0451797_0697816
472 Ga0451847_0701437
473 Ga0439433_0000479
474 Ga0439442_000001
475 Ga0439442_010935
476 Ga0439432_055716
477 Ga0439449_0000147
478 Ga0439449_0004769
479 Ga0439449_0011479
480 Ga0439452_096379
481 Ga0439457_006357
482 Ga0439457_143704
483 Ga0439462_0046947
484 Ga0439462_0072295
485 Ga0450920_000706
486 Ga0450907_000102
487 Ga0439434_0000022
488 Ga0439434_0010838
489 Ga0450918_000354
490 Ga0450918_040352
491 Ga0495580_0018489
492 Ga0495582_0080354
493 Ga0495639_0005171
494 Ga0495594_0185971
495 Ga0495608_0229552
496 Ga0495631_0209322
497 Ga0495663_0073470
498 Ga0495642_0038622
499 Ga0495665_0098215
500 Ga0495640_0425762
501 Ga0495586_0002737
502 Ga0495586_0030298
503 Ga0495645_0111340
504 Ga0495633_0205341
505 Ga0495656_0000444
506 Ga0495635_0351687
507 Ga0495588_0000656
508 Ga0495588_0044392
509 Ga0495588_0048422
510 Ga0495670_0001138
511 Ga0495581_0002466
512 Ga0495581_0028028
513 Ga0495636_0018098
514 Ga0495680_0423760
515 Ga0495675_0434819
516 Ga0495677_0013135
517 Ga0495593_0004684
518 Ga0496101_0006125
519 Ga0496101_0105336
520 Ga0496101_0554402
521 Ga0496101_1492360
522 Ga0496102_0002123
523 Ga0496102_0041933
524 Ga0496102_0142078
525 Ga0496102_0186586
526 Ga0496102_0330174
527 Ga0496102_0371745
528 Ga0496102_0421138
529 Ga0496102_0562896
530 Ga0496102_0822695
531 Ga0496103_0001053
532 Ga0496103_0022096
533 Ga0496103_0059358
534 Ga0496103_0123018
535 Ga0496103_0607323
536 Ga0496104_0191348
537 Ga0496104_0633401
538 Ga0496105_0060492
539 Ga0496105_0969624
540 Ga0496106_0002122
541 Ga0496106_0606498
542 Ga0496107_0024718
543 Ga0496107_0075798
544 Ga0496107_0677046
545 Ga0496108_0205670
546 Ga0496108_0491738
547 Ga0496108_0669000
548 Ga0496109_0046386
549 Ga0496109_0523099
550 Ga0496110_0005967
551 Ga0496110_0151830
552 Ga0496110_0697477
553 Ga0496110_1345525
554 Ga0496111_0039972
555 Ga0496111_0116619
556 Ga0496112_0334282
557 Ga0496113_1137124
558 Ga0496114_0087152
559 Ga0496114_0279214
560 Ga0496114_1591075
561 Ga0496121_0464664
562 Ga0496121_0493834
563 Ga0496122_0241007
564 Ga0496124_0245608
565 Ga0496125_0338588
566 Ga0501032_0000370
567 Ga0501032_0405429
568 Ga0501037_0004874
569 Ga0501038_0113814
570 Ga0501038_0174804
571 Ga0501039_0021363
572 Ga0501043_0101294
573 Ga0501043_0240694
574 Ga0501067_0490631
575 Ga0501044_0034983
576 Ga0501212_117885
577 nmdc:mga06z11_454238_c1
578 Ga0495595_0363453
579 2537898991
580 2775655121
581 2808827628
582 2808852997
583 2808878492
584 2808891872
585 2808896990
586 2810364179
587 2812320584
588 2844849489
589 2857741373
590 2904499908
591 2905929146
592 2919037706
593 2919542097
594 2933420673
595 2939598601
596 2939648923
597 2945918343
598 2945921365
599 2945959781
600 2946005313
601 2946038390
602 2946062200
603 2974306374
604 8054111083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07811

TadE

TadE-like protein

21

63

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cz6-assembly1.cif.gz_D mycobacterium tuberculosis transcriptional regulator 0.7101 96 136
6cyj-assembly1.cif.gz_A mycobacterium tuberculosis transcriptional regulator 0.71 96 136
6cz6-assembly1.cif.gz_B mycobacterium tuberculosis transcriptional regulator 0.7078 96 136
6cyy-assembly1.cif.gz_A mycobacterium tuberculosis transcriptional regulator 0.7062 96 136
6cz6-assembly1.cif.gz_C mycobacterium tuberculosis transcriptional regulator 0.7057 96 136
ID Description Score Start End Superfamily
af_P53271_109_262_1.20.58.1240 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7885 20 86 1.20.58.1240
af_A0A0P0XXW8_1_333_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7752 96 138 2.130.10.10
af_F1LTN5_25_134_2.60.40.3210 Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain 0.7323 97 139 2.60.40.3210
af_E7FCT0_374_739_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6829 107 137 3.40.850.10
af_I6YF08_25_141_3.30.565.40 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Fervidobacterium nodosum Rt17-B1 like 0.6823 96 137 3.30.565.40
ID Description Score Start End GO Terms
AF-A0A176UMF4-F1-model_v4 deleted 0.9807 21 139
AF-A0A6I6A732-F1-model_v4 Pilus assembly protein 0.979 24 139 GO:0016020
AF-A0A6N7EKJ7-F1-model_v4 Pilus assembly protein 0.9785 19 137 GO:0016020
AF-A0A4Y3KXL4-F1-model_v4 TadE-like domain-containing protein 0.9765 20 138 GO:0016020
AF-A0A2U1EH48-F1-model_v4 deleted 0.9576 23 139

Map