F396565

General Info

Members Datasets Scaffolds Average Seq Length
302 171 291 281

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10003158|Ga0307511_1000315810
Length 305
Sequence MSKINQHSNDLPNSPFRGRGGKVILAGAGPGDPELLTIKALRYLQKADVVITDRLVSEEILTNYTREDALIISVGKQCSKGASTPQSEINDLLVEHAGRGRLVVRLKGGDASIFSNILDELRTLATHQIPYEIIPGITAALGAAAYAAIPLTARGYSTAVRFLTHYKKDDLNESYWKDLAQTADTLVFYMSSEPLDHLVENLLQYGIGPDKWLAVIEQATTPLQNVYNCPIHEYLSAKRGSHYVSPTLIIIGKVAALHEPFQWLPDSHSKENYFAPVAAQTASPVVTRAAEPTLKKYAYADSAET

Samples

Sample ID Description Type Environment
1 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
2 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
3 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
4 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
5 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
6 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
7 2738541278 Niastella sp. CF465 Isolate Unclassified
8 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
9 2818991444 Filimonas endophytica 3197 Isolate Unclassified
10 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
11 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 1.32
Rhizosphere 87.42
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10130558 3300003316 Bacteria 3808
2 rootH2_10023677 3300003320 Bacteria 21338
3 rootH2_10024559 3300003320 Bacteria 24277
4 rootL2_10001777 3300003322 Bacteria 2960
5 rootL2_10026427 3300003322 Bacteria 1516
6 rootH1_10135911 3300003323 Bacteria 2378
7 Ga0070683_100064753 3300005329 Bacteria 3403
8 Ga0070690_100070278 3300005330 Bacteria 2273
9 Ga0070670_100127041 3300005331 Unclassified 2201
10 Ga0070670_100432711 3300005331 Unclassified 1164
11 Ga0068869_100015905 3300005334 Bacteria 5061
12 Ga0070666_10000028 3300005335 Bacteria 144796
13 Ga0070666_10208428 3300005335 Bacteria 1376
14 Ga0070682_100227892 3300005337 Bacteria 1330
15 Ga0068868_100138774 3300005338 Bacteria 1994
16 Ga0070691_10025621 3300005341 Bacteria 2746
17 Ga0070691_10178365 3300005341 Unclassified 1104
18 Ga0070687_100213971 3300005343 Bacteria 1176
19 Ga0070668_100030592 3300005347 Bacteria 4093
20 Ga0070668_100423463 3300005347 Bacteria 1140
21 Ga0070675_100033881 3300005354 Bacteria 4142
22 Ga0070671_100003437 3300005355 Bacteria 12358
23 Ga0070671_100068616 3300005355 Bacteria 2957
24 Ga0070667_100003232 3300005367 Bacteria 13938
25 Ga0070663_100317281 3300005455 Bacteria 1252
26 Ga0070678_100562024 3300005456 Bacteria 1014
27 Ga0070681_10006598 3300005458 Bacteria 11301
28 Ga0070684_100009827 3300005535 Bacteria 7556
29 Ga0068853_100000730 3300005539 Bacteria 22729
30 Ga0070672_100251432 3300005543 Bacteria 1489
31 Ga0068855_100005983 3300005563 Bacteria 14842
32 Ga0068855_100009148 3300005563 Bacteria 11963
33 Ga0068855_100054386 3300005563 Bacteria 4705
34 Ga0068855_100209679 3300005563 Unclassified 2190
35 Ga0068857_100002029 3300005577 Bacteria 16411
36 Ga0068854_100172097 3300005578 Bacteria 1686
37 Ga0068856_100007851 3300005614 Bacteria 10420
38 Ga0068856_100391115 3300005614 Unclassified 1410
39 Ga0068852_100004018 3300005616 Bacteria 10342
40 Ga0068852_100376083 3300005616 Bacteria 1392
41 Ga0068859_100000012 3300005617 Bacteria 300376
42 Ga0068859_100000859 3300005617 Bacteria 30939
43 Ga0068859_100369673 3300005617 Bacteria 1529
44 Ga0068864_100120558 3300005618 Unclassified 2345
45 Ga0068864_100174541 3300005618 Bacteria 1961
46 Ga0068864_100206131 3300005618 Unclassified 1808
47 Ga0068866_10011380 3300005718 Bacteria 3848
48 Ga0068861_100340361 3300005719 Unclassified 1313
49 Ga0068851_10014960 3300005834 Bacteria 3691
50 Ga0068863_100013238 3300005841 Bacteria 7957
51 Ga0068863_100049303 3300005841 Bacteria 3993
52 Ga0068858_100004166 3300005842 Bacteria 14229
53 Ga0068860_100001749 3300005843 Bacteria 23145
54 Ga0068860_100016656 3300005843 Bacteria 7169
55 Ga0068860_100017849 3300005843 Bacteria 6911
56 Ga0068860_100176268 3300005843 Unclassified 2066
57 Ga0068860_100260695 3300005843 Unclassified 1690
58 Ga0075366_10115300 3300006195 Bacteria 1618
59 Ga0097621_100001267 3300006237 Bacteria 17448
60 Ga0097621_100187613 3300006237 Unclassified 1789
61 Ga0068871_100000704 3300006358 Bacteria 22713
62 Ga0068871_100024075 3300006358 Bacteria 4717
63 Ga0068871_100180386 3300006358 Unclassified 1814
64 Ga0068871_100205690 3300006358 Bacteria 1701
65 Ga0068871_100384245 3300006358 Bacteria 1248
66 Ga0075431_100054608 3300006847 Bacteria 4119
67 Ga0075429_100300076 3300006880 Bacteria 1406
68 Ga0068865_100102640 3300006881 Unclassified 2096
69 Ga0068865_100291413 3300006881 Bacteria 1303
70 Ga0097620_100000012 3300006931 Bacteria 300376
71 Ga0097620_100000859 3300006931 Bacteria 30939
72 Ga0097620_100369702 3300006931 Bacteria 1529
73 Ga0105240_10000023 3300009093 Bacteria 385028
74 Ga0105240_10000893 3300009093 Bacteria 53349
75 Ga0105240_10002999 3300009093 Bacteria 26556
76 Ga0105240_10015470 3300009093 Bacteria 10373
77 Ga0105240_10029275 3300009093 Bacteria 7179
78 Ga0105240_10040332 3300009093 Bacteria 5973
79 Ga0105240_10055938 3300009093 Bacteria 4938
80 Ga0105240_10846748 3300009093 Unclassified 987
81 Ga0114129_10007165 3300009147 Bacteria 15870
82 Ga0114129_10065166 3300009147 Bacteria 5085
83 Ga0105243_10048286 3300009148 Bacteria 3355
84 Ga0105241_10003136 3300009174 Bacteria 12295
85 Ga0105241_10203343 3300009174 Bacteria 1656
86 Ga0105242_10098518 3300009176 Unclassified 2473
87 Ga0105242_10241648 3300009176 Bacteria 1624
88 Ga0105242_10545818 3300009176 Bacteria 1110
89 Ga0105248_10007183 3300009177 Bacteria 12220
90 Ga0105237_10004328 3300009545 Bacteria 16462
91 Ga0105237_10011363 3300009545 Bacteria 9420
92 Ga0105237_10052768 3300009545 Bacteria 4080
93 Ga0105237_10110160 3300009545 Bacteria 2745
94 Ga0105237_10167639 3300009545 Bacteria 2196
95 Ga0105237_10345905 3300009545 Bacteria 1491
96 Ga0105238_10023396 3300009551 Bacteria 6298
97 Ga0105238_10081307 3300009551 Bacteria 3229
98 Ga0105238_10138185 3300009551 Unclassified 2414
99 Ga0105249_10003694 3300009553 Bacteria 13195
100 Ga0105249_10013608 3300009553 Bacteria 7185
101 Ga0105249_10142667 3300009553 Bacteria 2298
102 Ga0105249_10424390 3300009553 Bacteria 1364
103 Ga0105249_10610603 3300009553 Bacteria 1146
104 Ga0105249_10827935 3300009553 Unclassified 990
105 Ga0105249_10848095 3300009553 Bacteria 979
106 Ga0105239_10000128 3300010375 Bacteria 107095
107 Ga0105239_10001010 3300010375 Bacteria 39353
108 Ga0105239_10001102 3300010375 Bacteria 37330
109 Ga0105239_10001887 3300010375 Bacteria 27397
110 Ga0105239_10044383 3300010375 Bacteria 4874
111 Ga0105246_10088633 3300011119 Bacteria 2224
112 Ga0157371_10004659 3300013102 Bacteria 11874
113 Ga0157370_10001091 3300013104 Bacteria 34028
114 Ga0157370_10001225 3300013104 Bacteria 32118
115 Ga0157369_10041623 3300013105 Bacteria 5014
116 Ga0157369_10069725 3300013105 Bacteria 3777
117 Ga0157369_10450972 3300013105 Bacteria 1332
118 Ga0157374_10000002 3300013296 Bacteria 1054226
119 Ga0157374_10228943 3300013296 Bacteria 1825
120 Ga0157378_10013483 3300013297 Bacteria 7148
121 Ga0157378_10191557 3300013297 Unclassified 1929
122 Ga0163162_10000086 3300013306 Bacteria 85949
123 Ga0163162_10000282 3300013306 Bacteria 46472
124 Ga0163162_10002016 3300013306 Bacteria 19121
125 Ga0163162_10003354 3300013306 Bacteria 15318
126 Ga0163162_10006341 3300013306 Bacteria 11455
127 Ga0157372_10000573 3300013307 Bacteria 40317
128 Ga0157372_10018359 3300013307 Bacteria 7518
129 Ga0157372_10055809 3300013307 Bacteria 4412
130 Ga0157372_10721624 3300013307 Bacteria 1159
131 Ga0157372_10905181 3300013307 Bacteria 1023
132 Ga0157375_10000115 3300013308 Bacteria 77964
133 Ga0157375_10250748 3300013308 Bacteria 1931
134 Ga0157375_10331894 3300013308 Bacteria 1686
135 Ga0163163_10001214 3300014325 Bacteria 21788
136 Ga0163163_10024040 3300014325 Bacteria 5796
137 Ga0163163_10121735 3300014325 Bacteria 2643
138 Ga0163163_10891488 3300014325 Unclassified 953
139 Ga0157380_10392421 3300014326 Bacteria 1314
140 Ga0157379_10043589 3300014968 Bacteria 4006
141 Ga0157379_10045506 3300014968 Bacteria 3916
142 Ga0157376_10000467 3300014969 Bacteria 26068
143 Ga0157376_10002716 3300014969 Bacteria 12057
144 Ga0157376_10071506 3300014969 Bacteria 2948
145 Ga0157376_10115792 3300014969 Bacteria 2367
146 Ga0157376_10166846 3300014969 Unclassified 2001
147 Ga0182006_1000001 3300015261 Bacteria 1091090
148 Ga0163161_10005511 3300017792 Bacteria 8771
149 Ga0163161_10171516 3300017792 Bacteria 1659
150 Ga0207642_10222188 3300025899 Bacteria 1056
151 Ga0207680_10000515 3300025903 Bacteria 18445
152 Ga0207680_10194431 3300025903 Bacteria 1379
153 Ga0207647_10074731 3300025904 Bacteria 2041
154 Ga0207654_10003719 3300025911 Bacteria 7701
155 Ga0207654_10065937 3300025911 Bacteria 2134
156 Ga0207695_10000016 3300025913 Bacteria 771991
157 Ga0207695_10000128 3300025913 Bacteria 226098
158 Ga0207695_10006251 3300025913 Bacteria 15507
159 Ga0207695_10019363 3300025913 Bacteria 7838
160 Ga0207695_10088824 3300025913 Bacteria 3110
161 Ga0207695_10347496 3300025913 Unclassified 1371
162 Ga0207695_10557401 3300025913 Unclassified 1027
163 Ga0207671_10031252 3300025914 Bacteria 3967
164 Ga0207671_10092977 3300025914 Bacteria 2274
165 Ga0207671_10105364 3300025914 Bacteria 2139
166 Ga0207671_10229419 3300025914 Bacteria 1456
167 Ga0207694_10010885 3300025924 Bacteria 6869
168 Ga0207694_10197681 3300025924 Unclassified 1635
169 Ga0207659_10020520 3300025926 Bacteria 4369
170 Ga0207644_10008771 3300025931 Bacteria 6621
171 Ga0207644_10095651 3300025931 Unclassified 2222
172 Ga0207686_10152385 3300025934 Bacteria 1611
173 Ga0207704_10046567 3300025938 Bacteria 2586
174 Ga0207691_10069093 3300025940 Bacteria 3191
175 Ga0207711_10176257 3300025941 Unclassified 1942
176 Ga0207689_10006838 3300025942 Bacteria 10030
177 Ga0207689_10010894 3300025942 Bacteria 7819
178 Ga0207689_10129767 3300025942 Unclassified 2074
179 Ga0207661_10059366 3300025944 Bacteria 3082
180 Ga0207667_10000151 3300025949 Bacteria 104054
181 Ga0207667_10000502 3300025949 Bacteria 51671
182 Ga0207667_10018553 3300025949 Bacteria 7798
183 Ga0207667_10019745 3300025949 Bacteria 7512
184 Ga0207667_10088606 3300025949 Bacteria 3200
185 Ga0207667_10119097 3300025949 Unclassified 2721
186 Ga0207651_10046634 3300025960 Bacteria 2916
187 Ga0207712_10059041 3300025961 Bacteria 2713
188 Ga0207712_10217680 3300025961 Bacteria 1525
189 Ga0207668_10200026 3300025972 Bacteria 1590
190 Ga0207640_10123841 3300025981 Unclassified 1857
191 Ga0207658_10062952 3300025986 Bacteria 2778
192 Ga0207677_10261257 3300026023 Bacteria 1411
193 Ga0207703_10031134 3300026035 Bacteria 4216
194 Ga0207639_10003082 3300026041 Bacteria 11200
195 Ga0207639_10048957 3300026041 Bacteria 3202
196 Ga0207639_10356949 3300026041 Unclassified 1307
197 Ga0207702_10143204 3300026078 Bacteria 2166
198 Ga0207641_10011451 3300026088 Bacteria 7281
199 Ga0207641_10026831 3300026088 Bacteria 4756
200 Ga0207641_10192489 3300026088 Unclassified 1875
201 Ga0207641_10618421 3300026088 Unclassified 1062
202 Ga0207648_10255800 3300026089 Bacteria 1562
203 Ga0207648_10449018 3300026089 Bacteria 1174
204 Ga0207676_10050906 3300026095 Bacteria 3232
205 Ga0207676_10121205 3300026095 Unclassified 2206
206 Ga0207676_10207142 3300026095 Bacteria 1737
207 Ga0207676_10215281 3300026095 Unclassified 1707
208 Ga0207674_10005376 3300026116 Bacteria 15236
209 Ga0207675_100012580 3300026118 Bacteria 7905
210 Ga0207675_100276367 3300026118 Bacteria 1631
211 Ga0207683_10357327 3300026121 Bacteria 1341
212 Ga0207698_10024835 3300026142 Bacteria 4212
213 Ga0268264_10001722 3300028381 Bacteria 20135
214 Ga0268264_10002806 3300028381 Bacteria 15215
215 Ga0268264_10010077 3300028381 Bacteria 7823
216 Ga0307517_10004401 3300028786 Bacteria 21639
217 Ga0307515_10000010 3300028794 Bacteria 651586
218 Ga0307515_10077934 3300028794 Bacteria 4368
219 Ga0307515_10157919 3300028794 Bacteria 2330
220 Ga0307515_10241017 3300028794 Bacteria 1579
221 Ga0307511_10003158 3300030521 Bacteria 16966
222 Ga0265327_10001284 3300031251 Bacteria 33021
223 Ga0307509_10006906 3300031507 Bacteria 15076
224 Ga0307509_10057873 3300031507 Bacteria 4107
225 Ga0307516_10003127 3300031730 Bacteria 21526
226 Ga0307516_10282061 3300031730 Bacteria 1343
227 Ga0307510_10015073 3300033180 Bacteria 9137
228 Ga0373927_0060224 3300035695 Bacteria 2456
229 Ga0395900_0014224 3300037418 Bacteria 8122
230 Ga0395900_0180472 3300037418 Unclassified 2146
231 Ga0395905_0004754 3300037471 Bacteria 14035
232 Ga0395901_0018592 3300038443 Bacteria 7097
233 Ga0439436_0000413 3300041404 Bacteria 10744
234 Ga0439433_0015438 3300041999 Bacteria 1686
235 Ga0439449_0001602 3300042007 Bacteria 8873
236 Ga0439449_0003547 3300042007 Bacteria 6061
237 Ga0439457_008702 3300042014 Bacteria 2383
238 Ga0439457_015215 3300042014 Unclassified 1719
239 Ga0439462_0020800 3300042015 Bacteria 1712
240 Ga0466972_0000104 3300044658 Bacteria 73886
241 Ga0466965_0186079 3300044683 Bacteria 1097
242 Ga0466966_0000193 3300044684 Bacteria 40730
243 Ga0466971_0086250 3300044719 Bacteria 1435
244 Ga0466971_0201901 3300044719 Bacteria 939
245 Ga0466968_0153529 3300044735 Unclassified 1059
246 Ga0466970_0000529 3300044765 Bacteria 18707
247 Ga0466970_0149233 3300044765 Bacteria 1291
248 Ga0466957_0001943 3300044842 Bacteria 10977
249 Ga0466960_0027613 3300044901 Bacteria 2591
250 Ga0466960_0103810 3300044901 Bacteria 1468
251 Ga0466959_0007615 3300045049 Bacteria 7609
252 Ga0466959_0061233 3300045049 Bacteria 2737
253 Ga0495606_0033364 3300046507 Bacteria 3551
254 Ga0495610_0000005 3300046512 Bacteria 924111
255 Ga0495668_0003676 3300046616 Bacteria 11333
256 Ga0495634_0168811 3300046642 Bacteria 1376
257 Ga0495611_0000440 3300046648 Bacteria 25587
258 Ga0495635_0049094 3300046663 Bacteria 2909
259 Ga0495686_0000016 3300047472 Bacteria 443701
260 Ga0496100_0017292 3300048903 Bacteria 4254
261 Ga0496101_0104027 3300048904 Unclassified 2129
262 Ga0496102_0104017 3300048905 Bacteria 2641
263 Ga0496110_0449486 3300048913 Bacteria 1174
264 Ga0496126_0379521 3300048929 Bacteria 1151
265 Ga0501290_003143 3300049513 Bacteria 2092
266 Ga0501032_0002459 3300049569 Bacteria 14470
267 Ga0501033_0059266 3300049570 Bacteria 2827
268 Ga0501034_0025888 3300049571 Bacteria 5974
269 Ga0501034_0026096 3300049571 Bacteria 5950
270 Ga0501037_0008913 3300049573 Bacteria 7347
271 Ga0501043_0054336 3300049579 Bacteria 3145
272 Ga0501047_0209898 3300049581 Bacteria 1806
273 Ga0501047_0458087 3300049581 Bacteria 1104
274 Ga0501225_0001814 3300049705 Bacteria 6688
275 Ga0501035_0039676 3300049822 Bacteria 4260
276 Ga0501044_0022366 3300049823 Bacteria 6739
277 nmdc:mga0k408_14340_c1 3300050493 Bacteria 4364
278 nmdc:mga05p37_11170_c1 3300050507 Bacteria 10673
279 nmdc:mga05p37_179814_c1 3300050507 Bacteria 2574
280 nmdc:mga09592_91913_c1 3300050508 Bacteria 2594
281 nmdc:mga06r32_173571_c1 3300050510 Bacteria 2140
282 nmdc:mga08y16_698835_c1 3300050511 Unclassified 1014
283 Ga0500578_0000100 3300053086 Bacteria 99827
284 Ga0500578_0027120 3300053086 Bacteria 3676
285 Ga0500646_0051914 3300053090 Bacteria 1185
286 Ga0500583_0000009 3300053092 Bacteria 160749
287 Ga0500583_0004029 3300053092 Bacteria 4725
288 Ga0500642_0040797 3300053130 Bacteria 2004
289 Ga0500652_040146 3300053131 Bacteria 1880
290 Ga0500604_0004825 3300053151 Bacteria 3574
291 Ga0500637_0024212 3300053178 Bacteria 3326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044719 Ga0466971_0201901 Ga0466971_0201901_137_919 237
2 3300028794 Ga0307515_10000010 Ga0307515_10000010306 240
3 3300026088 Ga0207641_10618421 Ga0207641_106184211 242
4 3300028794 Ga0307515_10241017 Ga0307515_102410172 252
5 3300005330 Ga0070690_100070278 Ga0070690_1000702782 255
6 3300005354 Ga0070675_100033881 Ga0070675_1000338813 255
7 3300014326 Ga0157380_10392421 Ga0157380_103924212 255
8 3300025926 Ga0207659_10020520 Ga0207659_100205203 255
9 3300044683 Ga0466965_0186079 Ga0466965_0186079_211_1047 255
10 3300044901 Ga0466960_0027613 Ga0466960_0027613_1578_2414 255
11 3300044901 Ga0466960_0103810 Ga0466960_0103810_619_1446 255
12 3300003320 rootH2_10023677 rootH2_1002367717 256
13 3300005563 Ga0068855_100054386 Ga0068855_1000543863 256
14 3300006358 Ga0068871_100180386 Ga0068871_1001803862 256
15 3300009545 Ga0105237_10167639 Ga0105237_101676392 256
16 3300009551 Ga0105238_10138185 Ga0105238_101381852 256
17 3300010375 Ga0105239_10000128 Ga0105239_1000012885 256
18 3300013296 Ga0157374_10000002 Ga0157374_10000002311 256
19 3300013307 Ga0157372_10018359 Ga0157372_100183595 256
20 3300014969 Ga0157376_10002716 Ga0157376_100027163 256
21 3300025914 Ga0207671_10105364 Ga0207671_101053642 256
22 3300025924 Ga0207694_10197681 Ga0207694_101976811 256
23 3300025949 Ga0207667_10088606 Ga0207667_100886062 256
24 3300003320 rootH2_10024559 rootH2_1002455910 257
25 3300005617 Ga0068859_100000859 Ga0068859_10000085924 257
26 3300006931 Ga0097620_100000859 Ga0097620_10000085924 257
27 3300013307 Ga0157372_10721624 Ga0157372_107216241 257
28 3300042007 Ga0439449_0001602 Ga0439449_0001602_5531_6367 257
29 3300042014 Ga0439457_015215 Ga0439457_015215_72_908 257
30 3300044765 Ga0466970_0149233 Ga0466970_0149233_208_1014 257
31 3300045049 Ga0466959_0061233 Ga0466959_0061233_1225_2043 257
32 iso_pu_bacteria 2585428060 2587746654 257
33 iso_pu_bacteria 2585428185 2588223750 257
34 iso_pu_bacteria 2588253712 2588447143 257
35 iso_pu_bacteria 2588254257 2590609796 257
36 iso_pu_bacteria 2728369107 2729201202 257
37 iso_pu_bacteria 2738541273 2738701322 257
38 iso_pu_bacteria 2738541278 2738725996 257
39 iso_pu_bacteria 2738543014 2739255620 257
40 iso_pu_bacteria 2842083920 2842084656 257
41 iso_pu_bacteria 2905999023 2905999362 257
42 3300005329 Ga0070683_100064753 Ga0070683_1000647532 258
43 3300005335 Ga0070666_10208428 Ga0070666_102084282 258
44 3300005341 Ga0070691_10025621 Ga0070691_100256212 258
45 3300005341 Ga0070691_10178365 Ga0070691_101783651 258
46 3300005535 Ga0070684_100009827 Ga0070684_1000098276 258
47 3300005563 Ga0068855_100009148 Ga0068855_1000091487 258
48 3300006358 Ga0068871_100205690 Ga0068871_1002056902 258
49 3300006847 Ga0075431_100054608 Ga0075431_1000546082 258
50 3300006880 Ga0075429_100300076 Ga0075429_1003000761 258
51 3300009093 Ga0105240_10002999 Ga0105240_100029996 258
52 3300009093 Ga0105240_10846748 Ga0105240_108467481 258
53 3300009147 Ga0114129_10065166 Ga0114129_100651663 258
54 3300013105 Ga0157369_10069725 Ga0157369_100697253 258
55 3300013296 Ga0157374_10228943 Ga0157374_102289432 258
56 3300013306 Ga0163162_10002016 Ga0163162_100020162 258
57 3300013307 Ga0157372_10905181 Ga0157372_109051812 258
58 3300025903 Ga0207680_10194431 Ga0207680_101944312 258
59 3300025913 Ga0207695_10000128 Ga0207695_10000128146 258
60 3300025913 Ga0207695_10557401 Ga0207695_105574012 258
61 3300025944 Ga0207661_10059366 Ga0207661_100593662 258
62 3300025949 Ga0207667_10000502 Ga0207667_1000050236 258
63 3300026041 Ga0207639_10048957 Ga0207639_100489573 258
64 3300028381 Ga0268264_10002806 Ga0268264_1000280615 258
65 3300031251 Ga0265327_10001284 Ga0265327_1000128426 258
66 3300049569 Ga0501032_0002459 Ga0501032_0002459_12236_13042 258
67 3300049570 Ga0501033_0059266 Ga0501033_0059266_861_1667 258
68 3300049571 Ga0501034_0025888 Ga0501034_0025888_3160_3966 258
69 3300049571 Ga0501034_0026096 Ga0501034_0026096_1449_2291 258
70 3300049573 Ga0501037_0008913 Ga0501037_0008913_3454_4260 258
71 3300049579 Ga0501043_0054336 Ga0501043_0054336_555_1367 258
72 3300049822 Ga0501035_0039676 Ga0501035_0039676_2028_2834 258
73 3300049823 Ga0501044_0022366 Ga0501044_0022366_2039_2845 258
74 3300050507 nmdc:mga05p37_179814_c1 nmdc:mga05p37_179814_c1_1726_2562 258
75 3300050508 nmdc:mga09592_91913_c1 nmdc:mga09592_91913_c1_414_1250 258
76 3300050510 nmdc:mga06r32_173571_c1 nmdc:mga06r32_173571_c1_987_1823 258
77 3300005331 Ga0070670_100432711 Ga0070670_1004327112 259
78 3300005355 Ga0070671_100068616 Ga0070671_1000686162 259
79 3300005719 Ga0068861_100340361 Ga0068861_1003403611 259
80 3300005843 Ga0068860_100260695 Ga0068860_1002606952 259
81 3300006237 Ga0097621_100187613 Ga0097621_1001876131 259
82 3300009176 Ga0105242_10098518 Ga0105242_100985183 259
83 3300009553 Ga0105249_10424390 Ga0105249_104243901 259
84 3300013297 Ga0157378_10191557 Ga0157378_101915573 259
85 3300014969 Ga0157376_10071506 Ga0157376_100715063 259
86 3300014969 Ga0157376_10166846 Ga0157376_101668462 259
87 3300025934 Ga0207686_10152385 Ga0207686_101523852 259
88 3300025942 Ga0207689_10006838 Ga0207689_100068385 259
89 3300025942 Ga0207689_10129767 Ga0207689_101297672 259
90 3300025961 Ga0207712_10217680 Ga0207712_102176802 259
91 3300026089 Ga0207648_10255800 Ga0207648_102558002 259
92 3300026118 Ga0207675_100012580 Ga0207675_1000125805 259
93 3300037418 Ga0395900_0180472 Ga0395900_0180472_700_1542 259
94 3300003316 rootH1_10130558 rootH1_101305582 260
95 3300003322 rootL2_10001777 rootL2_100017773 260
96 3300003322 rootL2_10026427 rootL2_100264272 260
97 3300003323 rootH1_10135911 rootH1_101359112 260
98 3300005331 Ga0070670_100127041 Ga0070670_1001270412 260
99 3300005334 Ga0068869_100015905 Ga0068869_1000159052 260
100 3300005335 Ga0070666_10000028 Ga0070666_1000002879 260
101 3300005337 Ga0070682_100227892 Ga0070682_1002278922 260
102 3300005338 Ga0068868_100138774 Ga0068868_1001387742 260
103 3300005343 Ga0070687_100213971 Ga0070687_1002139711 260
104 3300005347 Ga0070668_100030592 Ga0070668_1000305922 260
105 3300005347 Ga0070668_100423463 Ga0070668_1004234631 260
106 3300005355 Ga0070671_100003437 Ga0070671_1000034379 260
107 3300005367 Ga0070667_100003232 Ga0070667_10000323210 260
108 3300005455 Ga0070663_100317281 Ga0070663_1003172811 260
109 3300005456 Ga0070678_100562024 Ga0070678_1005620241 260
110 3300005458 Ga0070681_10006598 Ga0070681_100065986 260
111 3300005539 Ga0068853_100000730 Ga0068853_1000007305 260
112 3300005543 Ga0070672_100251432 Ga0070672_1002514322 260
113 3300005563 Ga0068855_100005983 Ga0068855_1000059839 260
114 3300005563 Ga0068855_100209679 Ga0068855_1002096792 260
115 3300005577 Ga0068857_100002029 Ga0068857_1000020295 260
116 3300005578 Ga0068854_100172097 Ga0068854_1001720972 260
117 3300005614 Ga0068856_100007851 Ga0068856_1000078519 260
118 3300005614 Ga0068856_100391115 Ga0068856_1003911152 260
119 3300005616 Ga0068852_100004018 Ga0068852_1000040185 260
120 3300005616 Ga0068852_100376083 Ga0068852_1003760832 260
121 3300005617 Ga0068859_100000012 Ga0068859_100000012259 260
122 3300005617 Ga0068859_100369673 Ga0068859_1003696732 260
123 3300005618 Ga0068864_100120558 Ga0068864_1001205582 260
124 3300005618 Ga0068864_100174541 Ga0068864_1001745412 260
125 3300005618 Ga0068864_100206131 Ga0068864_1002061312 260
126 3300005718 Ga0068866_10011380 Ga0068866_100113802 260
127 3300005834 Ga0068851_10014960 Ga0068851_100149602 260
128 3300005841 Ga0068863_100013238 Ga0068863_1000132383 260
129 3300005841 Ga0068863_100049303 Ga0068863_1000493033 260
130 3300005842 Ga0068858_100004166 Ga0068858_1000041666 260
131 3300005843 Ga0068860_100001749 Ga0068860_10000174916 260
132 3300005843 Ga0068860_100016656 Ga0068860_1000166563 260
133 3300005843 Ga0068860_100017849 Ga0068860_1000178493 260
134 3300005843 Ga0068860_100176268 Ga0068860_1001762682 260
135 3300006195 Ga0075366_10115300 Ga0075366_101153002 260
136 3300006237 Ga0097621_100001267 Ga0097621_10000126712 260
137 3300006358 Ga0068871_100000704 Ga0068871_10000070411 260
138 3300006358 Ga0068871_100024075 Ga0068871_1000240752 260
139 3300006358 Ga0068871_100384245 Ga0068871_1003842452 260
140 3300006881 Ga0068865_100102640 Ga0068865_1001026402 260
141 3300006881 Ga0068865_100291413 Ga0068865_1002914132 260
142 3300006931 Ga0097620_100000012 Ga0097620_100000012259 260
143 3300006931 Ga0097620_100369702 Ga0097620_1003697022 260
144 3300009093 Ga0105240_10000023 Ga0105240_10000023171 260
145 3300009093 Ga0105240_10000893 Ga0105240_100008936 260
146 3300009093 Ga0105240_10015470 Ga0105240_100154703 260
147 3300009093 Ga0105240_10029275 Ga0105240_100292754 260
148 3300009093 Ga0105240_10040332 Ga0105240_100403322 260
149 3300009093 Ga0105240_10055938 Ga0105240_100559382 260
150 3300009147 Ga0114129_10007165 Ga0114129_100071655 260
151 3300009148 Ga0105243_10048286 Ga0105243_100482863 260
152 3300009174 Ga0105241_10003136 Ga0105241_100031365 260
153 3300009174 Ga0105241_10203343 Ga0105241_102033431 260
154 3300009176 Ga0105242_10241648 Ga0105242_102416482 260
155 3300009176 Ga0105242_10545818 Ga0105242_105458182 260
156 3300009177 Ga0105248_10007183 Ga0105248_100071832 260
157 3300009545 Ga0105237_10004328 Ga0105237_1000432810 260
158 3300009545 Ga0105237_10011363 Ga0105237_100113632 260
159 3300009545 Ga0105237_10052768 Ga0105237_100527683 260
160 3300009545 Ga0105237_10110160 Ga0105237_101101602 260
161 3300009545 Ga0105237_10345905 Ga0105237_103459052 260
162 3300009551 Ga0105238_10023396 Ga0105238_100233963 260
163 3300009551 Ga0105238_10081307 Ga0105238_100813072 260
164 3300009553 Ga0105249_10003694 Ga0105249_100036944 260
165 3300009553 Ga0105249_10013608 Ga0105249_100136083 260
166 3300009553 Ga0105249_10142667 Ga0105249_101426672 260
167 3300009553 Ga0105249_10610603 Ga0105249_106106031 260
168 3300009553 Ga0105249_10827935 Ga0105249_108279352 260
169 3300009553 Ga0105249_10848095 Ga0105249_108480951 260
170 3300010375 Ga0105239_10001010 Ga0105239_1000101031 260
171 3300010375 Ga0105239_10001102 Ga0105239_1000110215 260
172 3300010375 Ga0105239_10001887 Ga0105239_1000188718 260
173 3300010375 Ga0105239_10044383 Ga0105239_100443832 260
174 3300011119 Ga0105246_10088633 Ga0105246_100886332 260
175 3300013102 Ga0157371_10004659 Ga0157371_100046592 260
176 3300013104 Ga0157370_10001091 Ga0157370_1000109127 260
177 3300013104 Ga0157370_10001225 Ga0157370_1000122518 260
178 3300013105 Ga0157369_10041623 Ga0157369_100416232 260
179 3300013105 Ga0157369_10450972 Ga0157369_104509722 260
180 3300013297 Ga0157378_10013483 Ga0157378_100134832 260
181 3300013306 Ga0163162_10000086 Ga0163162_1000008610 260
182 3300013306 Ga0163162_10000282 Ga0163162_1000028231 260
183 3300013306 Ga0163162_10003354 Ga0163162_100033542 260
184 3300013306 Ga0163162_10006341 Ga0163162_100063417 260
185 3300013307 Ga0157372_10000573 Ga0157372_100005733 260
186 3300013307 Ga0157372_10055809 Ga0157372_100558093 260
187 3300013308 Ga0157375_10000115 Ga0157375_1000011568 260
188 3300013308 Ga0157375_10250748 Ga0157375_102507482 260
189 3300013308 Ga0157375_10331894 Ga0157375_103318942 260
190 3300014325 Ga0163163_10001214 Ga0163163_1000121416 260
191 3300014325 Ga0163163_10024040 Ga0163163_100240402 260
192 3300014325 Ga0163163_10121735 Ga0163163_101217352 260
193 3300014325 Ga0163163_10891488 Ga0163163_108914881 260
194 3300014968 Ga0157379_10043589 Ga0157379_100435893 260
195 3300014968 Ga0157379_10045506 Ga0157379_100455062 260
196 3300014969 Ga0157376_10000467 Ga0157376_100004672 260
197 3300014969 Ga0157376_10115792 Ga0157376_101157923 260
198 3300015261 Ga0182006_1000001 Ga0182006_1000001453 260
199 3300017792 Ga0163161_10005511 Ga0163161_100055115 260
200 3300017792 Ga0163161_10171516 Ga0163161_101715162 260
201 3300025899 Ga0207642_10222188 Ga0207642_102221881 260
202 3300025903 Ga0207680_10000515 Ga0207680_100005158 260
203 3300025904 Ga0207647_10074731 Ga0207647_100747312 260
204 3300025911 Ga0207654_10003719 Ga0207654_100037193 260
205 3300025911 Ga0207654_10065937 Ga0207654_100659372 260
206 3300025913 Ga0207695_10000016 Ga0207695_10000016146 260
207 3300025913 Ga0207695_10006251 Ga0207695_100062517 260
208 3300025913 Ga0207695_10019363 Ga0207695_100193633 260
209 3300025913 Ga0207695_10088824 Ga0207695_100888243 260
210 3300025913 Ga0207695_10347496 Ga0207695_103474961 260
211 3300025914 Ga0207671_10031252 Ga0207671_100312522 260
212 3300025914 Ga0207671_10092977 Ga0207671_100929772 260
213 3300025914 Ga0207671_10229419 Ga0207671_102294192 260
214 3300025924 Ga0207694_10010885 Ga0207694_100108852 260
215 3300025931 Ga0207644_10008771 Ga0207644_100087716 260
216 3300025931 Ga0207644_10095651 Ga0207644_100956512 260
217 3300025938 Ga0207704_10046567 Ga0207704_100465672 260
218 3300025940 Ga0207691_10069093 Ga0207691_100690932 260
219 3300025941 Ga0207711_10176257 Ga0207711_101762572 260
220 3300025942 Ga0207689_10010894 Ga0207689_100108943 260
221 3300025949 Ga0207667_10000151 Ga0207667_1000015178 260
222 3300025949 Ga0207667_10018553 Ga0207667_100185532 260
223 3300025949 Ga0207667_10019745 Ga0207667_100197453 260
224 3300025949 Ga0207667_10119097 Ga0207667_101190971 260
225 3300025960 Ga0207651_10046634 Ga0207651_100466343 260
226 3300025961 Ga0207712_10059041 Ga0207712_100590413 260
227 3300025972 Ga0207668_10200026 Ga0207668_102000262 260
228 3300025981 Ga0207640_10123841 Ga0207640_101238412 260
229 3300025986 Ga0207658_10062952 Ga0207658_100629523 260
230 3300026023 Ga0207677_10261257 Ga0207677_102612572 260
231 3300026035 Ga0207703_10031134 Ga0207703_100311342 260
232 3300026041 Ga0207639_10003082 Ga0207639_100030827 260
233 3300026041 Ga0207639_10356949 Ga0207639_103569492 260
234 3300026078 Ga0207702_10143204 Ga0207702_101432042 260
235 3300026088 Ga0207641_10011451 Ga0207641_100114514 260
236 3300026088 Ga0207641_10026831 Ga0207641_100268313 260
237 3300026088 Ga0207641_10192489 Ga0207641_101924892 260
238 3300026089 Ga0207648_10449018 Ga0207648_104490181 260
239 3300026095 Ga0207676_10050906 Ga0207676_100509062 260
240 3300026095 Ga0207676_10121205 Ga0207676_101212052 260
241 3300026095 Ga0207676_10207142 Ga0207676_102071422 260
242 3300026095 Ga0207676_10215281 Ga0207676_102152811 260
243 3300026116 Ga0207674_10005376 Ga0207674_100053769 260
244 3300026118 Ga0207675_100276367 Ga0207675_1002763671 260
245 3300026121 Ga0207683_10357327 Ga0207683_103573272 260
246 3300026142 Ga0207698_10024835 Ga0207698_100248354 260
247 3300028381 Ga0268264_10001722 Ga0268264_100017229 260
248 3300028381 Ga0268264_10010077 Ga0268264_100100775 260
249 3300028786 Ga0307517_10004401 Ga0307517_1000440114 260
250 3300028794 Ga0307515_10077934 Ga0307515_100779343 260
251 3300028794 Ga0307515_10157919 Ga0307515_101579193 260
252 3300030521 Ga0307511_10003158 Ga0307511_1000315810 260
253 3300031507 Ga0307509_10006906 Ga0307509_1000690613 260
254 3300031507 Ga0307509_10057873 Ga0307509_100578734 260
255 3300031730 Ga0307516_10003127 Ga0307516_100031276 260
256 3300031730 Ga0307516_10282061 Ga0307516_102820611 260
257 3300033180 Ga0307510_10015073 Ga0307510_100150736 260
258 3300035695 Ga0373927_0060224 Ga0373927_0060224_1459_2277 260
259 3300037418 Ga0395900_0014224 Ga0395900_0014224_4541_5383 260
260 3300037471 Ga0395905_0004754 Ga0395905_0004754_1332_2177 260
261 3300038443 Ga0395901_0018592 Ga0395901_0018592_4825_5667 260
262 3300041404 Ga0439436_0000413 Ga0439436_0000413_7286_8149 260
263 3300041999 Ga0439433_0015438 Ga0439433_0015438_159_1022 260
264 3300042007 Ga0439449_0003547 Ga0439449_0003547_494_1357 260
265 3300042014 Ga0439457_008702 Ga0439457_008702_1504_2367 260
266 3300042015 Ga0439462_0020800 Ga0439462_0020800_23_886 260
267 3300044658 Ga0466972_0000104 Ga0466972_0000104_57197_58060 260
268 3300044684 Ga0466966_0000193 Ga0466966_0000193_21935_22798 260
269 3300044719 Ga0466971_0086250 Ga0466971_0086250_488_1315 260
270 3300044735 Ga0466968_0153529 Ga0466968_0153529_39_893 260
271 3300044765 Ga0466970_0000529 Ga0466970_0000529_15189_16043 260
272 3300044842 Ga0466957_0001943 Ga0466957_0001943_1519_2382 260
273 3300045049 Ga0466959_0007615 Ga0466959_0007615_5217_6080 260
274 3300046507 Ga0495606_0033364 Ga0495606_0033364_2698_3525 260
275 3300046512 Ga0495610_0000005 Ga0495610_0000005_616630_617475 260
276 3300046616 Ga0495668_0003676 Ga0495668_0003676_666_1520 260
277 3300046642 Ga0495634_0168811 Ga0495634_0168811_152_970 260
278 3300046648 Ga0495611_0000440 Ga0495611_0000440_16356_17195 260
279 3300046663 Ga0495635_0049094 Ga0495635_0049094_468_1337 260
280 3300047472 Ga0495686_0000016 Ga0495686_0000016_210563_211402 260
281 3300048903 Ga0496100_0017292 Ga0496100_0017292_2576_3436 260
282 3300048904 Ga0496101_0104027 Ga0496101_0104027_542_1402 260
283 3300048905 Ga0496102_0104017 Ga0496102_0104017_1631_2491 260
284 3300048913 Ga0496110_0449486 Ga0496110_0449486_255_1115 260
285 3300048929 Ga0496126_0379521 Ga0496126_0379521_202_1047 260
286 3300049513 Ga0501290_003143 Ga0501290_003143_142_996 260
287 3300049581 Ga0501047_0209898 Ga0501047_0209898_865_1728 260
288 3300049581 Ga0501047_0458087 Ga0501047_0458087_196_1056 260
289 3300049705 Ga0501225_0001814 Ga0501225_0001814_3805_4668 260
290 3300050493 nmdc:mga0k408_14340_c1 nmdc:mga0k408_14340_c1_2846_3709 260
291 3300050507 nmdc:mga05p37_11170_c1 nmdc:mga05p37_11170_c1_2575_3438 260
292 3300050511 nmdc:mga08y16_698835_c1 nmdc:mga08y16_698835_c1_23_880 260
293 3300053086 Ga0500578_0000100 Ga0500578_0000100_81195_82058 260
294 3300053086 Ga0500578_0027120 Ga0500578_0027120_779_1642 260
295 3300053090 Ga0500646_0051914 Ga0500646_0051914_225_1088 260
296 3300053092 Ga0500583_0000009 Ga0500583_0000009_101108_101971 260
297 3300053092 Ga0500583_0004029 Ga0500583_0004029_2404_3267 260
298 3300053130 Ga0500642_0040797 Ga0500642_0040797_39_902 260
299 3300053131 Ga0500652_040146 Ga0500652_040146_210_1073 260
300 3300053151 Ga0500604_0004825 Ga0500604_0004825_787_1641 260
301 3300053178 Ga0500637_0024212 Ga0500637_0024212_1642_2508 260
302 iso_pu_bacteria 2818991444 2819587885 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

22

234

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pr2-assembly1.cif.gz_A r261a/s128a s. typhimurium siroheme synthase 0.9322 1 246
6pr2-assembly1.cif.gz_B r261a/s128a s. typhimurium siroheme synthase 0.9293 2 245
6pr3-assembly1.cif.gz_A d262a/s128a s. typhimurium siroheme synthase 0.9286 1 247
6pr4-assembly1.cif.gz_A d262n/s128a s. typhimurium siroheme synthase 0.9273 1 247
6pr0-assembly1.cif.gz_B p133h-s128a s. typhimurium siroheme synthase 0.9258 2 247
ID Description Score Start End Superfamily
1pjsB05 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8983 122 247 3.30.950.10
af_Q2FVM0_1_122_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8877 2 120 3.40.1010.10
1pjsB05 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8848 122 247 3.30.950.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8844 1 120 3.40.1010.10
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8812 2 120 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A7C7JMX4-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9385 4 240 GO:0004851
GO:0019354
GO:0032259
AF-A0A1I5Z3T5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9357 2 254 GO:0004851
GO:0019354
GO:0032259
AF-A0A4Q5UDU2-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9333 4 254 GO:0004851
GO:0019354
GO:0032259
AF-A0A5B8V4I5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9325 1 259 GO:0004851
GO:0019354
GO:0032259
AF-A0A5B8V4I5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9256 1 259 GO:0004851
GO:0019354
GO:0032259

Feature Viewer

pLDDT pTM Quality
85.86 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map