F396420

General Info

Members Datasets Scaffolds Average Seq Length
302 194 604 268

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10040844|Ga0070715_100408442
Length 295
Sequence MSAAPNASRNARPPDATHPVGVSYDRTIYQGAAAHYRHGRPAYSPHLETVLTAELELDGSGRLLDGGCGPGILTVRLAPLFEEAVGLDPDPAMLAEGRRFAQDRGITNVRWIRALAEDLPAAAPGPYRAVTFGQSFHWTDEARVAEAVYDMLVPGGALALIVHTVEGRSAPRSPGPPPIPHAEIEALVETYLGSTRRAGQGVAPVRTHRFEDVLVRTRFGRPRSIFAPGIPDLVRDSESVLSGYFSFSYAAPHLFGDRVEDFADDVRELLKSRSPEGIFWDWPGDTEVILARKAG

Samples

Sample ID Description Type Environment
1 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.66
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 10.93
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 12.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070715_10040844 3300006163 Bacteria 1941
2 Ga0070658_10216519 3300005327 Unclassified 1619
3 Ga0070683_100000915 3300005329 Bacteria 21918
4 Ga0070683_100160428 3300005329 Unclassified 2133
5 Ga0068869_100106520 3300005334 Bacteria 2128
6 Ga0070682_100091784 3300005337 Bacteria 1988
7 Ga0070682_100181646 3300005337 Unclassified 1470
8 Ga0068868_100036584 3300005338 Bacteria 3801
9 Ga0070660_100084257 3300005339 Bacteria 2498
10 Ga0070660_100320212 3300005339 Bacteria 1274
11 Ga0070689_100101699 3300005340 Bacteria 2275
12 Ga0070691_10042548 3300005341 Bacteria 2150
13 Ga0070691_10055703 3300005341 Unclassified 1894
14 Ga0070675_100463638 3300005354 Unclassified 1138
15 Ga0070671_100033418 3300005355 Bacteria 4253
16 Ga0070671_100379674 3300005355 Bacteria 1208
17 Ga0070688_100290147 3300005365 Bacteria 1179
18 Ga0070659_100068731 3300005366 Bacteria 2810
19 Ga0070667_100439114 3300005367 Unclassified 1192
20 Ga0070709_10003901 3300005434 Bacteria 8043
21 Ga0070714_100094194 3300005435 Bacteria 2629
22 Ga0070714_100106029 3300005435 Bacteria 2482
23 Ga0070714_100127548 3300005435 Bacteria 2270
24 Ga0070714_100319456 3300005435 Bacteria 1452
25 Ga0070713_100044081 3300005436 Bacteria 3649
26 Ga0070713_100166278 3300005436 Bacteria 1972
27 Ga0070713_100482715 3300005436 Bacteria 1167
28 Ga0070710_10001711 3300005437 Bacteria 10345
29 Ga0070710_10026762 3300005437 Bacteria 3068
30 Ga0070710_10035146 3300005437 Bacteria 2731
31 Ga0070710_10054377 3300005437 Bacteria 2258
32 Ga0070711_100011241 3300005439 Bacteria 5552
33 Ga0070711_100047851 3300005439 Bacteria 2921
34 Ga0070711_100337848 3300005439 Bacteria 1208
35 Ga0070705_100068761 3300005440 Bacteria 2133
36 Ga0070678_100383553 3300005456 Bacteria 1216
37 Ga0070707_100077361 3300005468 Bacteria 3210
38 Ga0070679_100434089 3300005530 Unclassified 1258
39 Ga0070684_100000203 3300005535 Bacteria 41499
40 Ga0070696_100449388 3300005546 Unclassified 1017
41 Ga0070693_100154583 3300005547 Bacteria 1456
42 Ga0070665_100103035 3300005548 Bacteria 2857
43 Ga0068857_100134719 3300005577 Bacteria 2230
44 Ga0068854_100146427 3300005578 Unclassified 1817
45 Ga0068856_100381103 3300005614 Bacteria 1429
46 Ga0068856_100592828 3300005614 Bacteria 1129
47 Ga0068852_100057722 3300005616 Bacteria 3359
48 Ga0068852_100234795 3300005616 Unclassified 1750
49 Ga0068859_100370445 3300005617 Bacteria 1528
50 Ga0068864_100209517 3300005618 Bacteria 1794
51 Ga0068863_100259463 3300005841 Bacteria 1680
52 Ga0068858_100127576 3300005842 Bacteria 2384
53 Ga0068860_100208293 3300005843 Bacteria 1896
54 Ga0070717_10001309 3300006028 Bacteria 17038
55 Ga0070715_10000128 3300006163 Bacteria 18010
56 Ga0070716_100008555 3300006173 Bacteria 5083
57 Ga0070716_100068733 3300006173 Bacteria 2073
58 Ga0070712_100063980 3300006175 Bacteria 2607
59 Ga0070712_100070940 3300006175 Bacteria 2491
60 Ga0070712_100123163 3300006175 Bacteria 1954
61 Ga0075367_10322070 3300006178 Bacteria 974
62 Ga0075428_100068007 3300006844 Bacteria 3898
63 Ga0075431_100301724 3300006847 Bacteria 1618
64 Ga0075431_100404226 3300006847 Bacteria 1366
65 Ga0075433_10172562 3300006852 Bacteria 1924
66 Ga0075434_100001668 3300006871 Bacteria 18930
67 Ga0075429_100075076 3300006880 Bacteria 2945
68 Ga0097620_100370441 3300006931 Bacteria 1528
69 Ga0075435_100054710 3300007076 Bacteria 3222
70 Ga0105240_10180439 3300009093 Bacteria 2492
71 Ga0105245_10094349 3300009098 Unclassified 2758
72 Ga0105245_10354809 3300009098 Bacteria 1454
73 Ga0105247_10084414 3300009101 Bacteria 2007
74 Ga0105243_10407608 3300009148 Unclassified 1264
75 Ga0105241_10171421 3300009174 Bacteria 1793
76 Ga0105248_10144887 3300009177 Bacteria 2680
77 Ga0105248_10644577 3300009177 Bacteria 1195
78 Ga0105249_10346613 3300009553 Bacteria 1503
79 Ga0157338_1000691 3300012515 Bacteria 2120
80 Ga0157373_10130978 3300013100 Bacteria 1764
81 Ga0157370_10045137 3300013104 Bacteria 4230
82 Ga0157369_10357840 3300013105 Bacteria 1516
83 Ga0157369_10402295 3300013105 Bacteria 1420
84 Ga0157374_10067114 3300013296 Bacteria 3372
85 Ga0157372_10247545 3300013307 Bacteria 2069
86 Ga0163163_10118059 3300014325 Bacteria 2685
87 Ga0206356_10695060 3300020070 Bacteria 2462
88 Ga0207692_10022976 3300025898 Unclassified 2878
89 Ga0207692_10168806 3300025898 Bacteria 1266
90 Ga0207692_10324917 3300025898 Bacteria 942
91 Ga0207710_10072173 3300025900 Bacteria 1585
92 Ga0207699_10007377 3300025906 Bacteria 5379
93 Ga0207699_10068802 3300025906 Bacteria 2156
94 Ga0207699_10108981 3300025906 Bacteria 1771
95 Ga0207699_10350440 3300025906 Bacteria 1042
96 Ga0207705_10024930 3300025909 Bacteria 4269
97 Ga0207695_10233525 3300025913 Bacteria 1743
98 Ga0207693_10002202 3300025915 Bacteria 16996
99 Ga0207693_10008747 3300025915 Bacteria 8278
100 Ga0207693_10100138 3300025915 Bacteria 2272
101 Ga0207693_10113982 3300025915 Bacteria 2121
102 Ga0207693_10286129 3300025915 Unclassified 1291
103 Ga0207663_10001573 3300025916 Bacteria 10714
104 Ga0207663_10033662 3300025916 Bacteria 3055
105 Ga0207663_10183246 3300025916 Bacteria 1497
106 Ga0207663_10213756 3300025916 Bacteria 1399
107 Ga0207660_10169250 3300025917 Bacteria 1690
108 Ga0207657_10001308 3300025919 Bacteria 26451
109 Ga0207657_10143572 3300025919 Bacteria 1949
110 Ga0207687_10023210 3300025927 Unclassified 4133
111 Ga0207687_10352953 3300025927 Bacteria 1199
112 Ga0207700_10007098 3300025928 Bacteria 6821
113 Ga0207700_10093272 3300025928 Bacteria 2382
114 Ga0207664_10060886 3300025929 Bacteria 3010
115 Ga0207664_10119980 3300025929 Bacteria 2199
116 Ga0207664_10229095 3300025929 Bacteria 1614
117 Ga0207664_10405896 3300025929 Bacteria 1212
118 Ga0207644_10165231 3300025931 Bacteria 1724
119 Ga0207665_10001140 3300025939 Bacteria 17874
120 Ga0207665_10119208 3300025939 Bacteria 1862
121 Ga0207665_10142915 3300025939 Bacteria 1708
122 Ga0207665_10247209 3300025939 Bacteria 1316
123 Ga0207661_10013118 3300025944 Bacteria 6047
124 Ga0207679_10193974 3300025945 Unclassified 1691
125 Ga0207667_10545181 3300025949 Unclassified 1173
126 Ga0207651_10129406 3300025960 Bacteria 1930
127 Ga0207712_10366604 3300025961 Unclassified 1202
128 Ga0207677_10444475 3300026023 Bacteria 1110
129 Ga0207639_10527044 3300026041 Unclassified 1082
130 Ga0207678_10448318 3300026067 Bacteria 1121
131 Ga0207708_10130016 3300026075 Bacteria 1969
132 Ga0207702_10090207 3300026078 Bacteria 2682
133 Ga0207641_10090564 3300026088 Bacteria 2675
134 Ga0207674_10050115 3300026116 Bacteria 4267
135 Ga0207675_100098313 3300026118 Bacteria 2756
136 Ga0207683_10610721 3300026121 Unclassified 1010
137 Ga0265338_10302388 3300028800 Bacteria 1162
138 Ga0307408_100034994 3300031548 Bacteria 3522
139 Ga0307405_10046214 3300031731 Bacteria 2673
140 Ga0307413_10046295 3300031824 Bacteria 2585
141 Ga0307410_10016079 3300031852 Bacteria 4452
142 Ga0307406_10053105 3300031901 Bacteria 2580
143 Ga0307407_10026378 3300031903 Bacteria 3075
144 Ga0307412_10235355 3300031911 Bacteria 1413
145 Ga0307409_100009211 3300031995 Bacteria 6052
146 Ga0307409_100036539 3300031995 Bacteria 3612
147 Ga0307409_100271390 3300031995 Bacteria 1562
148 Ga0307409_100354528 3300031995 Bacteria 1386
149 Ga0307416_100062865 3300032002 Bacteria 3037
150 Ga0307416_100269759 3300032002 Bacteria 1670
151 Ga0307415_100004541 3300032126 Bacteria 7227
152 Ga0373926_0036843 3300035083 Bacteria 1739
153 Ga0373932_0015512 3300035112 Unclassified 1933
154 Ga0373956_0058654 3300035119 Unclassified 1740
155 Ga0373943_0009496 3300035170 Bacteria 4360
156 Ga0373943_0123942 3300035170 Bacteria 1376
157 Ga0373946_0044105 3300035171 Bacteria 1840
158 Ga0373931_0007346 3300035691 Bacteria 5186
159 Ga0373935_0002064 3300035692 Bacteria 11384
160 Ga0373935_0044885 3300035692 Bacteria 2787
161 Ga0373927_0100104 3300035695 Bacteria 1885
162 Ga0373933_0429663 3300035724 Bacteria 863
163 Ga0373947_0025744 3300035725 Bacteria 3431
164 Ga0373947_0099243 3300035725 Unclassified 1828
165 Ga0373947_0109298 3300035725 Bacteria 1745
166 Ga0373947_0193964 3300035725 Unclassified 1326
167 Ga0373937_0731445 3300036401 Unclassified 936
168 Ga0372808_016388 3300036459 Unclassified 1062
169 Ga0373925_0006714 3300037068 Bacteria 8441
170 Ga0373925_0029761 3300037068 Bacteria 4006
171 Ga0373925_0207649 3300037068 Bacteria 1559
172 Ga0395898_0083667 3300037466 Bacteria 3076
173 Ga0395901_0118889 3300038443 Bacteria 2777
174 Ga0451853_2245645 3300041512 Bacteria 1119
175 Ga0439448_0072990 3300042005 Bacteria 1144
176 Ga0466966_0153011 3300044684 Bacteria 1406
177 Ga0466961_0023729 3300044693 Bacteria 3947
178 Ga0466961_0030543 3300044693 Bacteria 3463
179 Ga0466963_0000443 3300044694 Bacteria 19185
180 Ga0466963_0005210 3300044694 Bacteria 7592
181 Ga0466963_0066842 3300044694 Bacteria 2411
182 Ga0466963_0433176 3300044694 Unclassified 927
183 Ga0466971_0125475 3300044719 Bacteria 1189
184 Ga0466970_0046162 3300044765 Bacteria 2320
185 Ga0466957_0005150 3300044842 Bacteria 7308
186 Ga0466957_0026684 3300044842 Bacteria 3428
187 Ga0466957_0129699 3300044842 Bacteria 1614
188 Ga0466960_0015015 3300044901 Bacteria 3331
189 Ga0466960_0122184 3300044901 Bacteria 1365
190 Ga0466959_0092242 3300045049 Bacteria 2174
191 Ga0466958_0011452 3300045836 Bacteria 4995
192 Ga0466958_0013730 3300045836 Bacteria 4615
193 Ga0466958_0013908 3300045836 Bacteria 4590
194 Ga0466958_0080641 3300045836 Bacteria 2002
195 Ga0466967_0000269 3300045976 Bacteria 22896
196 Ga0466967_0006023 3300045976 Bacteria 8520
197 Ga0466967_0007915 3300045976 Bacteria 7729
198 Ga0466967_0021523 3300045976 Bacteria 5241
199 Ga0466967_0257855 3300045976 Bacteria 1667
200 Ga0466967_0275511 3300045976 Bacteria 1613
201 Ga0466967_0403622 3300045976 Bacteria 1330
202 Ga0495592_0230999 3300046454 Bacteria 1232
203 Ga0495629_0035496 3300046459 Bacteria 3523
204 Ga0495641_0012334 3300046461 Bacteria 4790
205 Ga0495641_0012552 3300046461 Bacteria 4727
206 Ga0495651_0010418 3300046462 Bacteria 7142
207 Ga0495653_0056473 3300046463 Bacteria 2992
208 Ga0495580_0149967 3300046472 Bacteria 1615
209 Ga0495582_0041709 3300046473 Bacteria 2529
210 Ga0495639_0004118 3300046475 Bacteria 6231
211 Ga0495662_0007779 3300046476 Bacteria 5276
212 Ga0495584_0123957 3300046491 Bacteria 1309
213 Ga0495585_0049855 3300046492 Bacteria 2324
214 Ga0495608_0248930 3300046511 Bacteria 1108
215 Ga0495618_0035524 3300046514 Unclassified 3127
216 Ga0495630_0051055 3300046517 Bacteria 3094
217 Ga0495630_0114299 3300046517 Bacteria 2045
218 Ga0495630_0266578 3300046517 Bacteria 1308
219 Ga0495630_0337633 3300046517 Bacteria 1152
220 Ga0495644_0018352 3300046523 Bacteria 2672
221 Ga0495666_0059266 3300046526 Bacteria 1831
222 Ga0495642_0040677 3300046528 Unclassified 1889
223 Ga0495652_0050612 3300046529 Bacteria 3551
224 Ga0495652_0347558 3300046529 Unclassified 1063
225 Ga0495665_0004683 3300046531 Bacteria 7377
226 Ga0495640_0112725 3300046533 Bacteria 1775
227 Ga0495586_0022508 3300046535 Bacteria 3363
228 Ga0495587_0013977 3300046536 Bacteria 5040
229 Ga0495587_0017440 3300046536 Bacteria 4459
230 Ga0495645_0154707 3300046543 Bacteria 1589
231 Ga0495645_0207433 3300046543 Bacteria 1325
232 Ga0495634_0059665 3300046642 Bacteria 2540
233 Ga0495635_0083955 3300046663 Unclassified 2179
234 Ga0495661_0074170 3300046665 Unclassified 1981
235 Ga0495599_0124600 3300046678 Bacteria 1601
236 Ga0495658_0008284 3300046683 Bacteria 5150
237 Ga0495613_0006127 3300046689 Bacteria 9000
238 Ga0495624_0006530 3300046690 Bacteria 8265
239 Ga0495624_0016667 3300046690 Bacteria 4945
240 Ga0495624_0022186 3300046690 Bacteria 4201
241 Ga0495604_0129041 3300047317 Bacteria 1819
242 Ga0495674_0187330 3300047319 Bacteria 1721
243 Ga0495674_0259608 3300047319 Bacteria 1428
244 Ga0495676_0038614 3300047321 Bacteria 3964
245 Ga0495676_0157043 3300047321 Unclassified 1613
246 Ga0495679_049495 3300047446 Bacteria 1268
247 Ga0495684_0044531 3300047471 Bacteria 3397
248 Ga0495593_0005676 3300047673 Bacteria 7362
249 Ga0495593_0076145 3300047673 Bacteria 1739
250 Ga0495602_0136136 3300048088 Unclassified 1951
251 Ga0495602_0351541 3300048088 Bacteria 1063
252 Ga0496100_0009649 3300048903 Bacteria 5428
253 Ga0496100_0012259 3300048903 Bacteria 4909
254 Ga0496100_0056482 3300048903 Bacteria 2568
255 Ga0496100_0086742 3300048903 Unclassified 2127
256 Ga0496100_0318749 3300048903 Bacteria 1167
257 Ga0496101_0002073 3300048904 Bacteria 12209
258 Ga0496101_0037946 3300048904 Bacteria 3419
259 Ga0496102_0166871 3300048905 Bacteria 2072
260 Ga0496102_0519269 3300048905 Bacteria 1113
261 Ga0496103_0124035 3300048906 Bacteria 1646
262 Ga0496104_0030431 3300048907 Bacteria 5016
263 Ga0496105_0047153 3300048908 Bacteria 3555
264 Ga0496105_0069384 3300048908 Bacteria 2912
265 Ga0496105_0071994 3300048908 Bacteria 2857
266 Ga0496106_0025436 3300048909 Bacteria 4406
267 Ga0496107_0150278 3300048910 Bacteria 1722
268 Ga0496107_0200744 3300048910 Bacteria 1482
269 Ga0496108_0042368 3300048911 Bacteria 3800
270 Ga0496108_0046923 3300048911 Bacteria 3610
271 Ga0496109_0017794 3300048912 Bacteria 6232
272 Ga0496109_0570139 3300048912 Bacteria 1067
273 Ga0496110_0023148 3300048913 Bacteria 5283
274 Ga0496111_0027675 3300048914 Bacteria 4013
275 Ga0496111_0474365 3300048914 Bacteria 922
276 Ga0496112_0010342 3300048915 Bacteria 8462
277 Ga0496112_0131489 3300048915 Bacteria 2474
278 Ga0496112_0273696 3300048915 Unclassified 1636
279 Ga0496112_0733915 3300048915 Unclassified 914
280 Ga0496113_0068122 3300048916 Bacteria 2700
281 Ga0496113_0299546 3300048916 Unclassified 1287
282 Ga0496114_0333673 3300048917 Bacteria 1341
283 Ga0496114_0378437 3300048917 Bacteria 1253
284 Ga0496115_0283213 3300048918 Bacteria 1360
285 Ga0501067_0000105 3300049583 Bacteria 47941
286 Ga0501068_0000557 3300049584 Bacteria 18931
287 nmdc:mga09592_253683_c1 3300050508 Bacteria 1525
288 nmdc:mga06r32_200660_c1 3300050510 Bacteria 1982
289 nmdc:mga06r32_507063_c1 3300050510 Bacteria 1183
290 nmdc:mga0n895_9642_c1 3300050512 Bacteria 8462
291 nmdc:mga0rr50_115704_c1 3300050513 Bacteria 2128
292 nmdc:mga0rr50_888435_c1 3300050513 Unclassified 760
293 nmdc:mga0a205_158631_c1 3300050515 Bacteria 2160
294 Ga0495601_0038654 3300053077 Bacteria 2984
295 Ga0495601_0046225 3300053077 Bacteria 2740
296 Ga0495612_0003026 3300053078 Bacteria 6974
297 Ga0495612_0034684 3300053078 Bacteria 2043
298 Ga0495595_0004198 3300053084 Bacteria 5796
299 Ga0495619_0005580 3300053085 Bacteria 7983
300 Ga0500616_0000584 3300053153 Bacteria 44375
301 2515857652 2515154155 Bacteria 7985436
302 2515857943 2515154155 Bacteria 7985436
303 Ga0070715_10040844
304 Ga0070658_10216519
305 Ga0070683_100000915
306 Ga0070683_100160428
307 Ga0068869_100106520
308 Ga0070682_100091784
309 Ga0070682_100181646
310 Ga0068868_100036584
311 Ga0070660_100084257
312 Ga0070660_100320212
313 Ga0070689_100101699
314 Ga0070691_10042548
315 Ga0070691_10055703
316 Ga0070675_100463638
317 Ga0070671_100033418
318 Ga0070671_100379674
319 Ga0070688_100290147
320 Ga0070659_100068731
321 Ga0070667_100439114
322 Ga0070709_10003901
323 Ga0070714_100094194
324 Ga0070714_100106029
325 Ga0070714_100127548
326 Ga0070714_100319456
327 Ga0070713_100044081
328 Ga0070713_100166278
329 Ga0070713_100482715
330 Ga0070710_10001711
331 Ga0070710_10026762
332 Ga0070710_10035146
333 Ga0070710_10054377
334 Ga0070711_100011241
335 Ga0070711_100047851
336 Ga0070711_100337848
337 Ga0070705_100068761
338 Ga0070678_100383553
339 Ga0070707_100077361
340 Ga0070679_100434089
341 Ga0070684_100000203
342 Ga0070696_100449388
343 Ga0070693_100154583
344 Ga0070665_100103035
345 Ga0068857_100134719
346 Ga0068854_100146427
347 Ga0068856_100381103
348 Ga0068856_100592828
349 Ga0068852_100057722
350 Ga0068852_100234795
351 Ga0068859_100370445
352 Ga0068864_100209517
353 Ga0068863_100259463
354 Ga0068858_100127576
355 Ga0068860_100208293
356 Ga0070717_10001309
357 Ga0070715_10000128
358 Ga0070716_100008555
359 Ga0070716_100068733
360 Ga0070712_100063980
361 Ga0070712_100070940
362 Ga0070712_100123163
363 Ga0075367_10322070
364 Ga0075428_100068007
365 Ga0075431_100301724
366 Ga0075431_100404226
367 Ga0075433_10172562
368 Ga0075434_100001668
369 Ga0075429_100075076
370 Ga0097620_100370441
371 Ga0075435_100054710
372 Ga0105240_10180439
373 Ga0105245_10094349
374 Ga0105245_10354809
375 Ga0105247_10084414
376 Ga0105243_10407608
377 Ga0105241_10171421
378 Ga0105248_10144887
379 Ga0105248_10644577
380 Ga0105249_10346613
381 Ga0157338_1000691
382 Ga0157373_10130978
383 Ga0157370_10045137
384 Ga0157369_10357840
385 Ga0157369_10402295
386 Ga0157374_10067114
387 Ga0157372_10247545
388 Ga0163163_10118059
389 Ga0206356_10695060
390 Ga0207692_10022976
391 Ga0207692_10168806
392 Ga0207692_10324917
393 Ga0207710_10072173
394 Ga0207699_10007377
395 Ga0207699_10068802
396 Ga0207699_10108981
397 Ga0207699_10350440
398 Ga0207705_10024930
399 Ga0207695_10233525
400 Ga0207693_10002202
401 Ga0207693_10008747
402 Ga0207693_10100138
403 Ga0207693_10113982
404 Ga0207693_10286129
405 Ga0207663_10001573
406 Ga0207663_10033662
407 Ga0207663_10183246
408 Ga0207663_10213756
409 Ga0207660_10169250
410 Ga0207657_10001308
411 Ga0207657_10143572
412 Ga0207687_10023210
413 Ga0207687_10352953
414 Ga0207700_10007098
415 Ga0207700_10093272
416 Ga0207664_10060886
417 Ga0207664_10119980
418 Ga0207664_10229095
419 Ga0207664_10405896
420 Ga0207644_10165231
421 Ga0207665_10001140
422 Ga0207665_10119208
423 Ga0207665_10142915
424 Ga0207665_10247209
425 Ga0207661_10013118
426 Ga0207679_10193974
427 Ga0207667_10545181
428 Ga0207651_10129406
429 Ga0207712_10366604
430 Ga0207677_10444475
431 Ga0207639_10527044
432 Ga0207678_10448318
433 Ga0207708_10130016
434 Ga0207702_10090207
435 Ga0207641_10090564
436 Ga0207674_10050115
437 Ga0207675_100098313
438 Ga0207683_10610721
439 Ga0265338_10302388
440 Ga0307408_100034994
441 Ga0307405_10046214
442 Ga0307413_10046295
443 Ga0307410_10016079
444 Ga0307406_10053105
445 Ga0307407_10026378
446 Ga0307412_10235355
447 Ga0307409_100009211
448 Ga0307409_100036539
449 Ga0307409_100271390
450 Ga0307409_100354528
451 Ga0307416_100062865
452 Ga0307416_100269759
453 Ga0307415_100004541
454 Ga0373926_0036843
455 Ga0373932_0015512
456 Ga0373956_0058654
457 Ga0373943_0009496
458 Ga0373943_0123942
459 Ga0373946_0044105
460 Ga0373931_0007346
461 Ga0373935_0002064
462 Ga0373935_0044885
463 Ga0373927_0100104
464 Ga0373933_0429663
465 Ga0373947_0025744
466 Ga0373947_0099243
467 Ga0373947_0109298
468 Ga0373947_0193964
469 Ga0373937_0731445
470 Ga0372808_016388
471 Ga0373925_0006714
472 Ga0373925_0029761
473 Ga0373925_0207649
474 Ga0395898_0083667
475 Ga0395901_0118889
476 Ga0451853_2245645
477 Ga0439448_0072990
478 Ga0466966_0153011
479 Ga0466961_0023729
480 Ga0466961_0030543
481 Ga0466963_0000443
482 Ga0466963_0005210
483 Ga0466963_0066842
484 Ga0466963_0433176
485 Ga0466971_0125475
486 Ga0466970_0046162
487 Ga0466957_0005150
488 Ga0466957_0026684
489 Ga0466957_0129699
490 Ga0466960_0015015
491 Ga0466960_0122184
492 Ga0466959_0092242
493 Ga0466958_0011452
494 Ga0466958_0013730
495 Ga0466958_0013908
496 Ga0466958_0080641
497 Ga0466967_0000269
498 Ga0466967_0006023
499 Ga0466967_0007915
500 Ga0466967_0021523
501 Ga0466967_0257855
502 Ga0466967_0275511
503 Ga0466967_0403622
504 Ga0495592_0230999
505 Ga0495629_0035496
506 Ga0495641_0012334
507 Ga0495641_0012552
508 Ga0495651_0010418
509 Ga0495653_0056473
510 Ga0495580_0149967
511 Ga0495582_0041709
512 Ga0495639_0004118
513 Ga0495662_0007779
514 Ga0495584_0123957
515 Ga0495585_0049855
516 Ga0495608_0248930
517 Ga0495618_0035524
518 Ga0495630_0051055
519 Ga0495630_0114299
520 Ga0495630_0266578
521 Ga0495630_0337633
522 Ga0495644_0018352
523 Ga0495666_0059266
524 Ga0495642_0040677
525 Ga0495652_0050612
526 Ga0495652_0347558
527 Ga0495665_0004683
528 Ga0495640_0112725
529 Ga0495586_0022508
530 Ga0495587_0013977
531 Ga0495587_0017440
532 Ga0495645_0154707
533 Ga0495645_0207433
534 Ga0495634_0059665
535 Ga0495635_0083955
536 Ga0495661_0074170
537 Ga0495599_0124600
538 Ga0495658_0008284
539 Ga0495613_0006127
540 Ga0495624_0006530
541 Ga0495624_0016667
542 Ga0495624_0022186
543 Ga0495604_0129041
544 Ga0495674_0187330
545 Ga0495674_0259608
546 Ga0495676_0038614
547 Ga0495676_0157043
548 Ga0495679_049495
549 Ga0495684_0044531
550 Ga0495593_0005676
551 Ga0495593_0076145
552 Ga0495602_0136136
553 Ga0495602_0351541
554 Ga0496100_0009649
555 Ga0496100_0012259
556 Ga0496100_0056482
557 Ga0496100_0086742
558 Ga0496100_0318749
559 Ga0496101_0002073
560 Ga0496101_0037946
561 Ga0496102_0166871
562 Ga0496102_0519269
563 Ga0496103_0124035
564 Ga0496104_0030431
565 Ga0496105_0047153
566 Ga0496105_0069384
567 Ga0496105_0071994
568 Ga0496106_0025436
569 Ga0496107_0150278
570 Ga0496107_0200744
571 Ga0496108_0042368
572 Ga0496108_0046923
573 Ga0496109_0017794
574 Ga0496109_0570139
575 Ga0496110_0023148
576 Ga0496111_0027675
577 Ga0496111_0474365
578 Ga0496112_0010342
579 Ga0496112_0131489
580 Ga0496112_0273696
581 Ga0496112_0733915
582 Ga0496113_0068122
583 Ga0496113_0299546
584 Ga0496114_0333673
585 Ga0496114_0378437
586 Ga0496115_0283213
587 Ga0501067_0000105
588 Ga0501068_0000557
589 nmdc:mga09592_253683_c1
590 nmdc:mga06r32_200660_c1
591 nmdc:mga06r32_507063_c1
592 nmdc:mga0n895_9642_c1
593 nmdc:mga0rr50_115704_c1
594 nmdc:mga0rr50_888435_c1
595 nmdc:mga0a205_158631_c1
596 Ga0495601_0038654
597 Ga0495601_0046225
598 Ga0495612_0003026
599 Ga0495612_0034684
600 Ga0495595_0004198
601 Ga0495619_0005580
602 Ga0500616_0000584
603 2515857652
604 2515857943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

64

160

0.95

PF08242

Methyltransf_12

Methyltransferase domain

64

158

0.93

PF13649

Methyltransf_25

Methyltransferase domain

63

156

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

48

167

0.87

PF13489

Methyltransf_23

Methyltransferase domain

34

198

0.82

PF13847

Methyltransf_31

Methyltransferase domain

57

171

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kdr-assembly1.cif.gz_A crystal structure of ubig/sah complex 0.8294 14 148
3vse-assembly1.cif.gz_A crystal structure of methyltransferase 0.8166 29 142
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.8083 5 142
1uwv-assembly1.cif.gz_A crystal structure of ruma, the iron-sulfur cluster containing e. coli 23s ribosomal rna 5-methyluridine methyltransferase 0.808 27 142
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.8049 29 142
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9119 42 101 3.40.50.150
af_C0H5A2_481_622_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8719 27 94 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8391 41 97 3.40.50.150
3vseC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8339 27 142 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8328 27 99 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6B2DJZ9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9507 1 123 GO:0008168
GO:0032259
AF-A0A6H1KXK6-F1-model_v4 Class I SAM-dependent methyltransferase (EC 2.1.1.222, EC 2.1.1.64) 0.9224 2 145 GO:0008168
GO:0009058
GO:0032259
AF-A0A2W6DJR7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9211 2 145 GO:0008168
GO:0032259
AF-A0A3D3REH4-F1-model_v4 Class I SAM-dependent methyltransferase 0.9108 5 149 GO:0008168
GO:0032259
AF-A0A495JX45-F1-model_v4 Methyltransferase family protein 0.8885 1 258 GO:0008168
GO:0032259

Map