F396317

General Info

Members Datasets Scaffolds Average Seq Length
302 176 604 314

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100088262|Ga0068868_1000882622
Length 322
Sequence VEPEQGQGKPHLPPPSLWPIGFAIGIVCILVGLIVSWAAAAVGAAIAIIFGFLWVRDATSDYRRGDRDVVPVPAEGSPESFAEGATAPPADTGEAGMAGPEPGERFPRSVFLEGATLGLGAVIAGVVTVPIVGFSIAPVFQHPHHDEIDLGPITNFKEGQFVVSTFLRDPSIGEISRRTAYIRNNGFIDNVPSFTVLSNRCAHLGCPVQPNGPIFDKQKVEQTTKTGDVSLIPALPAGGFGCPCHGGQYDQEGNRTAGPPVRALDRYEFYIRNGNLALGKTYSVSHVVGAGASARIHKYKETGPGQHVDGPEQWFYPLQPPT

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 13.25
Rhizosphere 85.76
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100088262 3300005338 Bacteria 2495
2 Ga0070690_100029560 3300005330 Bacteria 3400
3 Ga0070680_100204171 3300005336 Bacteria 1667
4 Ga0070682_100052178 3300005337 Bacteria 2558
5 Ga0068868_100149460 3300005338 Bacteria 1923
6 Ga0070660_100071296 3300005339 Bacteria 2713
7 Ga0070689_100084289 3300005340 Bacteria 2498
8 Ga0070687_100116138 3300005343 Bacteria 1523
9 Ga0070692_10004274 3300005345 Bacteria 5936
10 Ga0070692_10169142 3300005345 Bacteria 1259
11 Ga0070668_100210452 3300005347 Unclassified 1599
12 Ga0070669_100056149 3300005353 Bacteria 2887
13 Ga0070675_100212538 3300005354 Bacteria 1682
14 Ga0070671_100222851 3300005355 Bacteria 1600
15 Ga0070674_100123545 3300005356 Bacteria 1919
16 Ga0070673_100112344 3300005364 Bacteria 2261
17 Ga0070659_100060833 3300005366 Bacteria 2984
18 Ga0070659_100149920 3300005366 Bacteria 1902
19 Ga0070703_10065227 3300005406 Unclassified 1201
20 Ga0070714_100052862 3300005435 Bacteria 3465
21 Ga0070713_100074712 3300005436 Bacteria 2872
22 Ga0070713_100297709 3300005436 Bacteria 1484
23 Ga0070710_10090649 3300005437 Unclassified 1802
24 Ga0070710_10116184 3300005437 Unclassified 1613
25 Ga0070711_100066256 3300005439 Bacteria 2529
26 Ga0070711_100103703 3300005439 Bacteria 2073
27 Ga0070711_100128356 3300005439 Unclassified 1885
28 Ga0070705_100009349 3300005440 Bacteria 4870
29 Ga0070705_100083091 3300005440 Bacteria 1972
30 Ga0070694_100172256 3300005444 Unclassified 1595
31 Ga0070708_100045446 3300005445 Bacteria 3868
32 Ga0070708_100052753 3300005445 Bacteria 3606
33 Ga0070708_100181213 3300005445 Unclassified 1969
34 Ga0070663_100142858 3300005455 Bacteria 1829
35 Ga0070662_100264334 3300005457 Unclassified 1387
36 Ga0070685_10022136 3300005466 Bacteria 3461
37 Ga0070706_100008943 3300005467 Bacteria 9323
38 Ga0070706_100033853 3300005467 Bacteria 4716
39 Ga0070706_100037670 3300005467 Bacteria 4466
40 Ga0070706_100081401 3300005467 Bacteria 2998
41 Ga0070706_100099564 3300005467 Bacteria 2701
42 Ga0070706_100263601 3300005467 Unclassified 1608
43 Ga0070707_100000899 3300005468 Bacteria 29535
44 Ga0070707_100018735 3300005468 Bacteria 6517
45 Ga0070707_100155594 3300005468 Bacteria 2227
46 Ga0070698_100102720 3300005471 Bacteria 2829
47 Ga0070698_100206630 3300005471 Bacteria 1899
48 Ga0070699_100032105 3300005518 Bacteria 4534
49 Ga0068853_100087716 3300005539 Bacteria 2731
50 Ga0070686_100034146 3300005544 Bacteria 3132
51 Ga0070695_100070997 3300005545 Bacteria 2279
52 Ga0070696_100010031 3300005546 Bacteria 6336
53 Ga0070696_100085517 3300005546 Bacteria 2239
54 Ga0070696_100141780 3300005546 Bacteria 1757
55 Ga0070693_100110560 3300005547 Bacteria 1690
56 Ga0070665_100008428 3300005548 Bacteria 10427
57 Ga0070704_100081344 3300005549 Bacteria 2386
58 Ga0068855_100084418 3300005563 Bacteria 3677
59 Ga0068855_100354518 3300005563 Unclassified 1616
60 Ga0068854_100437204 3300005578 Unclassified 1090
61 Ga0068856_100005759 3300005614 Bacteria 12210
62 Ga0068864_100161844 3300005618 Bacteria 2035
63 Ga0068866_10005435 3300005718 Bacteria 5257
64 Ga0068861_100338615 3300005719 Unclassified 1316
65 Ga0068860_100344341 3300005843 Bacteria 1466
66 Ga0081539_10004240 3300005985 Bacteria 16119
67 Ga0075432_10009996 3300006058 Bacteria 3223
68 Ga0070716_100067853 3300006173 Bacteria 2084
69 Ga0070716_100098269 3300006173 Bacteria 1788
70 Ga0070712_100015385 3300006175 Bacteria 4927
71 Ga0070712_100015818 3300006175 Bacteria 4864
72 Ga0097621_100297535 3300006237 Bacteria 1424
73 Ga0075428_100048051 3300006844 Bacteria 4685
74 Ga0075428_100129086 3300006844 Bacteria 2750
75 Ga0075431_100037755 3300006847 Bacteria 4973
76 Ga0075433_10002296 3300006852 Bacteria 14564
77 Ga0075433_10071782 3300006852 Bacteria 3043
78 Ga0075433_10072292 3300006852 Bacteria 3032
79 Ga0075434_100049058 3300006871 Bacteria 4190
80 Ga0075436_100034382 3300006914 Bacteria 3495
81 Ga0075436_100039681 3300006914 Bacteria 3248
82 Ga0075435_100001199 3300007076 Bacteria 16571
83 Ga0075435_100042511 3300007076 Bacteria 3635
84 Ga0075435_100184972 3300007076 Bacteria 1762
85 Ga0111539_10421333 3300009094 Bacteria 1555
86 Ga0111539_10646609 3300009094 Bacteria 1231
87 Ga0105245_10007666 3300009098 Bacteria 9455
88 Ga0105245_10148850 3300009098 Bacteria 2212
89 Ga0105247_10022069 3300009101 Bacteria 3832
90 Ga0114129_10031772 3300009147 Bacteria 7463
91 Ga0114129_10035139 3300009147 Bacteria 7081
92 Ga0114129_10118744 3300009147 Bacteria 3643
93 Ga0114129_10158836 3300009147 Bacteria 3090
94 Ga0114129_10265156 3300009147 Bacteria 2300
95 Ga0114129_10525478 3300009147 Bacteria 1542
96 Ga0114129_10563575 3300009147 Bacteria 1480
97 Ga0105243_10035239 3300009148 Bacteria 3879
98 Ga0105242_10134394 3300009176 Bacteria 2139
99 Ga0105248_10215251 3300009177 Unclassified 2164
100 Ga0105237_10144228 3300009545 Bacteria 2376
101 Ga0105238_10441856 3300009551 Bacteria 1297
102 Ga0105249_10000965 3300009553 Bacteria 25443
103 Ga0105249_10064188 3300009553 Bacteria 3375
104 Ga0105249_10559750 3300009553 Bacteria 1195
105 Ga0105239_10069929 3300010375 Bacteria 3855
106 Ga0157374_10004006 3300013296 Bacteria 12379
107 Ga0157374_10235831 3300013296 Unclassified 1798
108 Ga0157378_10007653 3300013297 Bacteria 9430
109 Ga0157378_10232824 3300013297 Bacteria 1756
110 Ga0163162_10020710 3300013306 Bacteria 6464
111 Ga0163162_10299060 3300013306 Bacteria 1741
112 Ga0157372_10405418 3300013307 Bacteria 1589
113 Ga0157375_10002998 3300013308 Bacteria 14665
114 Ga0157380_10048845 3300014326 Bacteria 3335
115 Ga0157377_10004850 3300014745 Bacteria 6253
116 Ga0157376_10010565 3300014969 Bacteria 6760
117 Ga0163161_10193291 3300017792 Unclassified 1565
118 Ga0207642_10002318 3300025899 Bacteria 5936
119 Ga0207685_10087420 3300025905 Bacteria 1304
120 Ga0207684_10011257 3300025910 Bacteria 7836
121 Ga0207684_10194828 3300025910 Bacteria 1748
122 Ga0207684_10247098 3300025910 Bacteria 1539
123 Ga0207693_10000651 3300025915 Bacteria 31097
124 Ga0207693_10006332 3300025915 Bacteria 9813
125 Ga0207693_10161165 3300025915 Bacteria 1765
126 Ga0207663_10013403 3300025916 Bacteria 4456
127 Ga0207663_10040942 3300025916 Bacteria 2820
128 Ga0207657_10045593 3300025919 Bacteria 3846
129 Ga0207646_10001459 3300025922 Bacteria 29261
130 Ga0207646_10029063 3300025922 Bacteria 5025
131 Ga0207646_10050667 3300025922 Bacteria 3715
132 Ga0207646_10350368 3300025922 Bacteria 1334
133 Ga0207681_10067463 3300025923 Bacteria 2481
134 Ga0207687_10056158 3300025927 Bacteria 2761
135 Ga0207687_10085620 3300025927 Bacteria 2287
136 Ga0207700_10000001 3300025928 Bacteria 1122509
137 Ga0207700_10127254 3300025928 Bacteria 2074
138 Ga0207664_10167689 3300025929 Bacteria 1877
139 Ga0207644_10104789 3300025931 Bacteria 2130
140 Ga0207706_10056944 3300025933 Bacteria 3445
141 Ga0207706_10219157 3300025933 Bacteria 1666
142 Ga0207686_10062277 3300025934 Bacteria 2368
143 Ga0207686_10252942 3300025934 Unclassified 1288
144 Ga0207709_10009602 3300025935 Bacteria 5327
145 Ga0207704_10008597 3300025938 Bacteria 4890
146 Ga0207665_10000740 3300025939 Bacteria 21982
147 Ga0207665_10018290 3300025939 Bacteria 4603
148 Ga0207665_10029789 3300025939 Bacteria 3607
149 Ga0207665_10050040 3300025939 Bacteria 2809
150 Ga0207665_10234083 3300025939 Bacteria 1351
151 Ga0207691_10011541 3300025940 Bacteria 8481
152 Ga0207651_10051595 3300025960 Bacteria 2800
153 Ga0207712_10009232 3300025961 Bacteria 6244
154 Ga0207668_10041578 3300025972 Bacteria 3109
155 Ga0207668_10252082 3300025972 Unclassified 1434
156 Ga0207678_10159565 3300026067 Bacteria 1926
157 Ga0207708_10011702 3300026075 Bacteria 6539
158 Ga0207702_10062709 3300026078 Bacteria 3176
159 Ga0207648_10000681 3300026089 Bacteria 38041
160 Ga0207675_100019715 3300026118 Bacteria 6295
161 Ga0207675_100072707 3300026118 Bacteria 3217
162 Ga0207675_100232913 3300026118 Bacteria 1777
163 Ga0207683_10000791 3300026121 Bacteria 28823
164 Ga0207683_10005012 3300026121 Bacteria 11376
165 Ga0207698_10051439 3300026142 Bacteria 3150
166 Ga0209966_1004915 3300027695 Bacteria 2281
167 Ga0207428_10009554 3300027907 Bacteria 8690
168 Ga0207428_10030985 3300027907 Bacteria 4419
169 Ga0268264_10426558 3300028381 Unclassified 1280
170 Ga0373938_0001361 3300034957 Bacteria 3920
171 Ga0373940_0004525 3300035088 Bacteria 2944
172 Ga0373932_0010795 3300035112 Bacteria 2219
173 Ga0373942_0009529 3300035207 Unclassified 2276
174 Ga0373962_0010184 3300035242 Bacteria 2339
175 Ga0373931_0044283 3300035691 Bacteria 2346
176 Ga0395899_0007975 3300037312 Bacteria 8157
177 Ga0395899_0046730 3300037312 Bacteria 3224
178 Ga0395899_0066209 3300037312 Bacteria 2653
179 Ga0395899_0168911 3300037312 Unclassified 1541
180 Ga0395900_0016350 3300037418 Bacteria 7561
181 Ga0395900_0019811 3300037418 Bacteria 6855
182 Ga0395900_0032006 3300037418 Bacteria 5406
183 Ga0395900_0036813 3300037418 Bacteria 5044
184 Ga0395900_0043218 3300037418 Bacteria 4644
185 Ga0395900_0056173 3300037418 Bacteria 4053
186 Ga0395900_0350844 3300037418 Bacteria 1449
187 Ga0395898_0004064 3300037466 Bacteria 16069
188 Ga0395898_0008156 3300037466 Bacteria 11089
189 Ga0395898_0015783 3300037466 Bacteria 7740
190 Ga0395898_0026271 3300037466 Bacteria 5861
191 Ga0395898_0050645 3300037466 Bacteria 4063
192 Ga0395898_0151236 3300037466 Bacteria 2221
193 Ga0395905_0005215 3300037471 Bacteria 13304
194 Ga0395905_0007041 3300037471 Bacteria 11241
195 Ga0395905_0010180 3300037471 Bacteria 9164
196 Ga0395905_0032669 3300037471 Bacteria 4894
197 Ga0395905_0114466 3300037471 Bacteria 2534
198 Ga0395905_0152147 3300037471 Bacteria 2176
199 Ga0395901_0003599 3300038443 Bacteria 15631
200 Ga0395901_0005582 3300038443 Bacteria 12734
201 Ga0395901_0005928 3300038443 Bacteria 12376
202 Ga0395901_0005954 3300038443 Bacteria 12349
203 Ga0395901_0006775 3300038443 Bacteria 11573
204 Ga0395901_0028218 3300038443 Bacteria 5774
205 Ga0395901_0058641 3300038443 Bacteria 4004
206 Ga0395901_0088439 3300038443 Bacteria 3240
207 Ga0395901_0577748 3300038443 Unclassified 1136
208 Ga0451789_0397889 3300041443 Bacteria 1744
209 Ga0451793_1279283 3300041452 Bacteria 3588
210 Ga0451839_0551533 3300041496 Bacteria 1800
211 Ga0451845_0829767 3300041501 Bacteria 1965
212 Ga0466964_0001918 3300044706 Bacteria 7273
213 Ga0466968_0031271 3300044735 Bacteria 2208
214 Ga0466960_0001639 3300044901 Bacteria 8196
215 Ga0466960_0001940 3300044901 Bacteria 7647
216 Ga0466960_0036234 3300044901 Bacteria 2310
217 Ga0466967_0089909 3300045976 Bacteria 2788
218 Ga0495592_0106437 3300046454 Bacteria 1991
219 Ga0495603_0006870 3300046455 Bacteria 6827
220 Ga0495591_078119 3300046458 Unclassified 848
221 Ga0495641_0104774 3300046461 Unclassified 1262
222 Ga0495605_0030568 3300046474 Bacteria 2760
223 Ga0495584_0012590 3300046491 Bacteria 4319
224 Ga0495584_0060303 3300046491 Unclassified 1908
225 Ga0495596_0039631 3300046500 Bacteria 1861
226 Ga0495631_0075006 3300046518 Bacteria 1460
227 Ga0495644_0014880 3300046523 Bacteria 2980
228 Ga0495663_0049782 3300046525 Bacteria 1295
229 Ga0495642_0053399 3300046528 Bacteria 1665
230 Ga0495609_0031986 3300046538 Bacteria 2391
231 Ga0495656_0003611 3300046615 Bacteria 5242
232 Ga0495656_0068394 3300046615 Bacteria 1570
233 Ga0495659_0050159 3300046664 Bacteria 1517
234 Ga0495588_0043111 3300046674 Bacteria 2308
235 Ga0495647_0021878 3300046681 Bacteria 2307
236 Ga0495658_0086991 3300046683 Bacteria 1845
237 Ga0495589_0002669 3300046794 Bacteria 9867
238 Ga0495589_0036771 3300046794 Bacteria 2454
239 Ga0495581_0042440 3300047315 Bacteria 2632
240 Ga0495676_0212346 3300047321 Unclassified 1338
241 Ga0495685_017391 3300047447 Bacteria 2463
242 Ga0496100_0024178 3300048903 Bacteria 3701
243 Ga0496101_0039135 3300048904 Bacteria 3370
244 Ga0496101_0059477 3300048904 Bacteria 2769
245 Ga0496102_0012846 3300048905 Bacteria 7248
246 Ga0496102_0158748 3300048905 Bacteria 2127
247 Ga0496102_0225995 3300048905 Bacteria 1765
248 Ga0496102_0232097 3300048905 Bacteria 1739
249 Ga0496103_0030191 3300048906 Bacteria 3297
250 Ga0496103_0050713 3300048906 Bacteria 2567
251 Ga0496104_0005421 3300048907 Bacteria 11166
252 Ga0496104_0048445 3300048907 Bacteria 4006
253 Ga0496105_0003175 3300048908 Bacteria 12117
254 Ga0496105_0065366 3300048908 Bacteria 3002
255 Ga0496105_0143973 3300048908 Bacteria 1961
256 Ga0496106_0015333 3300048909 Bacteria 5670
257 Ga0496107_0036952 3300048910 Bacteria 3504
258 Ga0496107_0149865 3300048910 Bacteria 1725
259 Ga0496108_0031497 3300048911 Bacteria 4401
260 Ga0496108_0048261 3300048911 Bacteria 3559
261 Ga0496108_0048276 3300048911 Bacteria 3559
262 Ga0496108_0050098 3300048911 Bacteria 3495
263 Ga0496109_0018753 3300048912 Bacteria 6084
264 Ga0496109_0147295 3300048912 Bacteria 2203
265 Ga0496110_0074328 3300048913 Bacteria 3018
266 Ga0496110_0141118 3300048913 Bacteria 2178
267 Ga0496110_0197025 3300048913 Bacteria 1829
268 Ga0496111_0001772 3300048914 Bacteria 12658
269 Ga0496111_0138228 3300048914 Bacteria 1805
270 Ga0496111_0309828 3300048914 Bacteria 1170
271 Ga0496112_0020989 3300048915 Bacteria 6203
272 Ga0496112_0037966 3300048915 Bacteria 4703
273 Ga0496112_0176174 3300048915 Bacteria 2103
274 Ga0496112_0407578 3300048915 Unclassified 1299
275 Ga0496113_0084902 3300048916 Bacteria 2431
276 Ga0496113_0181584 3300048916 Bacteria 1668
277 Ga0496114_0133103 3300048917 Bacteria 2149
278 Ga0496114_0255276 3300048917 Unclassified 1543
279 Ga0496115_0007562 3300048918 Bacteria 8002
280 Ga0501067_0119030 3300049583 Bacteria 1469
281 Ga0501076_0344559 3300049592 Unclassified 1223
282 nmdc:mga0yw44_12121_c1 3300050492 Bacteria 4016
283 nmdc:mga05p37_12526_c1 3300050507 Bacteria 2763
284 nmdc:mga05p37_1586_c1 3300050507 Bacteria 26419
285 nmdc:mga05p37_50509_c1 3300050507 Bacteria 5115
286 nmdc:mga09592_242930_c1 3300050508 Bacteria 1560
287 nmdc:mga06r32_107061_c1 3300050510 Bacteria 2747
288 nmdc:mga06r32_358678_c1 3300050510 Bacteria 1442
289 nmdc:mga08y16_137183_c1 3300050511 Bacteria 2543
290 nmdc:mga0n895_15449_c1 3300050512 Bacteria 6962
291 nmdc:mga0n895_331055_c1 3300050512 Unclassified 1543
292 nmdc:mga0rr50_519_c1 3300050513 Bacteria 20570
293 nmdc:mga08x19_10759_c1 3300050514 Bacteria 5500
294 nmdc:mga08x19_3691_c1 3300050514 Bacteria 9113
295 nmdc:mga08x19_82956_c1 3300050514 Bacteria 2107
296 nmdc:mga0a205_18496_c1 3300050515 Bacteria 6554
297 nmdc:mga0a205_202619_c1 3300050515 Unclassified 1875
298 nmdc:mga0a205_31929_c1 3300050515 Bacteria 5048
299 nmdc:mga0a205_84381_c1 3300050515 Bacteria 3068
300 Ga0495601_0292759 3300053077 Bacteria 1061
301 Ga0495619_0310994 3300053085 Bacteria 1091
302 Ga0501084_0229399 3300054114 Bacteria 1567
303 Ga0068868_100088262
304 Ga0070690_100029560
305 Ga0070680_100204171
306 Ga0070682_100052178
307 Ga0068868_100149460
308 Ga0070660_100071296
309 Ga0070689_100084289
310 Ga0070687_100116138
311 Ga0070692_10004274
312 Ga0070692_10169142
313 Ga0070668_100210452
314 Ga0070669_100056149
315 Ga0070675_100212538
316 Ga0070671_100222851
317 Ga0070674_100123545
318 Ga0070673_100112344
319 Ga0070659_100060833
320 Ga0070659_100149920
321 Ga0070703_10065227
322 Ga0070714_100052862
323 Ga0070713_100074712
324 Ga0070713_100297709
325 Ga0070710_10090649
326 Ga0070710_10116184
327 Ga0070711_100066256
328 Ga0070711_100103703
329 Ga0070711_100128356
330 Ga0070705_100009349
331 Ga0070705_100083091
332 Ga0070694_100172256
333 Ga0070708_100045446
334 Ga0070708_100052753
335 Ga0070708_100181213
336 Ga0070663_100142858
337 Ga0070662_100264334
338 Ga0070685_10022136
339 Ga0070706_100008943
340 Ga0070706_100033853
341 Ga0070706_100037670
342 Ga0070706_100081401
343 Ga0070706_100099564
344 Ga0070706_100263601
345 Ga0070707_100000899
346 Ga0070707_100018735
347 Ga0070707_100155594
348 Ga0070698_100102720
349 Ga0070698_100206630
350 Ga0070699_100032105
351 Ga0068853_100087716
352 Ga0070686_100034146
353 Ga0070695_100070997
354 Ga0070696_100010031
355 Ga0070696_100085517
356 Ga0070696_100141780
357 Ga0070693_100110560
358 Ga0070665_100008428
359 Ga0070704_100081344
360 Ga0068855_100084418
361 Ga0068855_100354518
362 Ga0068854_100437204
363 Ga0068856_100005759
364 Ga0068864_100161844
365 Ga0068866_10005435
366 Ga0068861_100338615
367 Ga0068860_100344341
368 Ga0081539_10004240
369 Ga0075432_10009996
370 Ga0070716_100067853
371 Ga0070716_100098269
372 Ga0070712_100015385
373 Ga0070712_100015818
374 Ga0097621_100297535
375 Ga0075428_100048051
376 Ga0075428_100129086
377 Ga0075431_100037755
378 Ga0075433_10002296
379 Ga0075433_10071782
380 Ga0075433_10072292
381 Ga0075434_100049058
382 Ga0075436_100034382
383 Ga0075436_100039681
384 Ga0075435_100001199
385 Ga0075435_100042511
386 Ga0075435_100184972
387 Ga0111539_10421333
388 Ga0111539_10646609
389 Ga0105245_10007666
390 Ga0105245_10148850
391 Ga0105247_10022069
392 Ga0114129_10031772
393 Ga0114129_10035139
394 Ga0114129_10118744
395 Ga0114129_10158836
396 Ga0114129_10265156
397 Ga0114129_10525478
398 Ga0114129_10563575
399 Ga0105243_10035239
400 Ga0105242_10134394
401 Ga0105248_10215251
402 Ga0105237_10144228
403 Ga0105238_10441856
404 Ga0105249_10000965
405 Ga0105249_10064188
406 Ga0105249_10559750
407 Ga0105239_10069929
408 Ga0157374_10004006
409 Ga0157374_10235831
410 Ga0157378_10007653
411 Ga0157378_10232824
412 Ga0163162_10020710
413 Ga0163162_10299060
414 Ga0157372_10405418
415 Ga0157375_10002998
416 Ga0157380_10048845
417 Ga0157377_10004850
418 Ga0157376_10010565
419 Ga0163161_10193291
420 Ga0207642_10002318
421 Ga0207685_10087420
422 Ga0207684_10011257
423 Ga0207684_10194828
424 Ga0207684_10247098
425 Ga0207693_10000651
426 Ga0207693_10006332
427 Ga0207693_10161165
428 Ga0207663_10013403
429 Ga0207663_10040942
430 Ga0207657_10045593
431 Ga0207646_10001459
432 Ga0207646_10029063
433 Ga0207646_10050667
434 Ga0207646_10350368
435 Ga0207681_10067463
436 Ga0207687_10056158
437 Ga0207687_10085620
438 Ga0207700_10000001
439 Ga0207700_10127254
440 Ga0207664_10167689
441 Ga0207644_10104789
442 Ga0207706_10056944
443 Ga0207706_10219157
444 Ga0207686_10062277
445 Ga0207686_10252942
446 Ga0207709_10009602
447 Ga0207704_10008597
448 Ga0207665_10000740
449 Ga0207665_10018290
450 Ga0207665_10029789
451 Ga0207665_10050040
452 Ga0207665_10234083
453 Ga0207691_10011541
454 Ga0207651_10051595
455 Ga0207712_10009232
456 Ga0207668_10041578
457 Ga0207668_10252082
458 Ga0207678_10159565
459 Ga0207708_10011702
460 Ga0207702_10062709
461 Ga0207648_10000681
462 Ga0207675_100019715
463 Ga0207675_100072707
464 Ga0207675_100232913
465 Ga0207683_10000791
466 Ga0207683_10005012
467 Ga0207698_10051439
468 Ga0209966_1004915
469 Ga0207428_10009554
470 Ga0207428_10030985
471 Ga0268264_10426558
472 Ga0373938_0001361
473 Ga0373940_0004525
474 Ga0373932_0010795
475 Ga0373942_0009529
476 Ga0373962_0010184
477 Ga0373931_0044283
478 Ga0395899_0007975
479 Ga0395899_0046730
480 Ga0395899_0066209
481 Ga0395899_0168911
482 Ga0395900_0016350
483 Ga0395900_0019811
484 Ga0395900_0032006
485 Ga0395900_0036813
486 Ga0395900_0043218
487 Ga0395900_0056173
488 Ga0395900_0350844
489 Ga0395898_0004064
490 Ga0395898_0008156
491 Ga0395898_0015783
492 Ga0395898_0026271
493 Ga0395898_0050645
494 Ga0395898_0151236
495 Ga0395905_0005215
496 Ga0395905_0007041
497 Ga0395905_0010180
498 Ga0395905_0032669
499 Ga0395905_0114466
500 Ga0395905_0152147
501 Ga0395901_0003599
502 Ga0395901_0005582
503 Ga0395901_0005928
504 Ga0395901_0005954
505 Ga0395901_0006775
506 Ga0395901_0028218
507 Ga0395901_0058641
508 Ga0395901_0088439
509 Ga0395901_0577748
510 Ga0451789_0397889
511 Ga0451793_1279283
512 Ga0451839_0551533
513 Ga0451845_0829767
514 Ga0466964_0001918
515 Ga0466968_0031271
516 Ga0466960_0001639
517 Ga0466960_0001940
518 Ga0466960_0036234
519 Ga0466967_0089909
520 Ga0495592_0106437
521 Ga0495603_0006870
522 Ga0495591_078119
523 Ga0495641_0104774
524 Ga0495605_0030568
525 Ga0495584_0012590
526 Ga0495584_0060303
527 Ga0495596_0039631
528 Ga0495631_0075006
529 Ga0495644_0014880
530 Ga0495663_0049782
531 Ga0495642_0053399
532 Ga0495609_0031986
533 Ga0495656_0003611
534 Ga0495656_0068394
535 Ga0495659_0050159
536 Ga0495588_0043111
537 Ga0495647_0021878
538 Ga0495658_0086991
539 Ga0495589_0002669
540 Ga0495589_0036771
541 Ga0495581_0042440
542 Ga0495676_0212346
543 Ga0495685_017391
544 Ga0496100_0024178
545 Ga0496101_0039135
546 Ga0496101_0059477
547 Ga0496102_0012846
548 Ga0496102_0158748
549 Ga0496102_0225995
550 Ga0496102_0232097
551 Ga0496103_0030191
552 Ga0496103_0050713
553 Ga0496104_0005421
554 Ga0496104_0048445
555 Ga0496105_0003175
556 Ga0496105_0065366
557 Ga0496105_0143973
558 Ga0496106_0015333
559 Ga0496107_0036952
560 Ga0496107_0149865
561 Ga0496108_0031497
562 Ga0496108_0048261
563 Ga0496108_0048276
564 Ga0496108_0050098
565 Ga0496109_0018753
566 Ga0496109_0147295
567 Ga0496110_0074328
568 Ga0496110_0141118
569 Ga0496110_0197025
570 Ga0496111_0001772
571 Ga0496111_0138228
572 Ga0496111_0309828
573 Ga0496112_0020989
574 Ga0496112_0037966
575 Ga0496112_0176174
576 Ga0496112_0407578
577 Ga0496113_0084902
578 Ga0496113_0181584
579 Ga0496114_0133103
580 Ga0496114_0255276
581 Ga0496115_0007562
582 Ga0501067_0119030
583 Ga0501076_0344559
584 nmdc:mga0yw44_12121_c1
585 nmdc:mga05p37_12526_c1
586 nmdc:mga05p37_1586_c1
587 nmdc:mga05p37_50509_c1
588 nmdc:mga09592_242930_c1
589 nmdc:mga06r32_107061_c1
590 nmdc:mga06r32_358678_c1
591 nmdc:mga08y16_137183_c1
592 nmdc:mga0n895_15449_c1
593 nmdc:mga0n895_331055_c1
594 nmdc:mga0rr50_519_c1
595 nmdc:mga08x19_10759_c1
596 nmdc:mga08x19_3691_c1
597 nmdc:mga08x19_82956_c1
598 nmdc:mga0a205_18496_c1
599 nmdc:mga0a205_202619_c1
600 nmdc:mga0a205_31929_c1
601 nmdc:mga0a205_84381_c1
602 Ga0495601_0292759
603 Ga0495619_0310994
604 Ga0501084_0229399

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

154

268

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4n-assembly1.cif.gz_B c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8686 9 53
1f4m-assembly3.cif.gz_E p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8544 5 53
1f4n-assembly1.cif.gz_A c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8246 1 53
7kae-assembly1.cif.gz_A rop protein variant with a buried tryptophan 0.7937 1 53
2iji-assembly1.cif.gz_A-2 structure of f14h mutant of cole1 rom protein 0.791 1 54
ID Description Score Start End Superfamily
af_Q54JW5_132_216_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9198 9 53 1.20.1280.290
af_Q4CV83_8_95_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9143 9 53 1.20.1280.290
af_B4FNJ0_133_226_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9084 10 53 1.20.1280.290
af_A0A1D6PAD8_11_93_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9063 9 51 1.20.1280.290
af_Q5N8J1_132_224_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9062 10 53 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A538FS76-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.9644 112 292 GO:0046872
GO:0051537
AF-A0A538DZD1-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.961 112 292 GO:0046872
GO:0051537
AF-A0A2V8TL70-F1-model_v4 Cytochrome B6 0.8665 167 253 GO:0016020
GO:0046872
GO:0051537
AF-A0A538FS76-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.8611 112 292 GO:0046872
GO:0051537
AF-A0A7W0PW47-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.8452 148 290 GO:0046872
GO:0051537

Map