F396313

General Info

Members Datasets Scaffolds Average Seq Length
302 180 604 260

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100435785|Ga0070680_1004357852
Length 280
Sequence MFHRIRRRLTDRLSTLAALAIVIAVLIARGAHAADMPTIAAASSVQYALTDIAAEFRRETGRDVRLAFGASGNLRRQIADGAPFELFLSADEGYADALVREKRTLDAGVVYAVGRLVLFVPNGSPIKLDATLADLGAALRDGRLRKLAIANPALAPYGRAAQQALERADLWQRAEVHLVQGENISQAAQFAASGAAQAGIIAYSLTREPGIAERGRFVLLPACDHAPLAQKMVLLKGASATARAFEAFVQSAKARAIFARYGFEPPGARSAANHGATPAG

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 1.32
Rhizosphere 96.36
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100435785 3300005336 Bacteria 1119
2 Ga0065712_10015893 3300005290 Bacteria 2024
3 Ga0065715_10107516 3300005293 Bacteria 2768
4 Ga0065715_10109152 3300005293 Bacteria 2679
5 Ga0065707_10001922 3300005295 Bacteria 7366
6 Ga0070658_10011986 3300005327 Bacteria 6960
7 Ga0070683_100032309 3300005329 Bacteria 4766
8 Ga0070690_100234865 3300005330 Unclassified 1291
9 Ga0070670_100755828 3300005331 Bacteria 876
10 Ga0070677_10172782 3300005333 Bacteria 1023
11 Ga0070666_10159993 3300005335 Bacteria 1574
12 Ga0070689_100015027 3300005340 Bacteria 5636
13 Ga0070689_100100336 3300005340 Bacteria 2290
14 Ga0070687_100031187 3300005343 Viruses 2614
15 Ga0070661_100131779 3300005344 Bacteria 1878
16 Ga0070692_10063352 3300005345 Bacteria 1953
17 Ga0070668_100215843 3300005347 Bacteria 1580
18 Ga0070668_100325753 3300005347 Bacteria 1294
19 Ga0070668_100512731 3300005347 Bacteria 1039
20 Ga0070669_100207694 3300005353 Bacteria 1543
21 Ga0070675_100004488 3300005354 Bacteria 10655
22 Ga0070675_100084422 3300005354 Bacteria 2652
23 Ga0070675_100127999 3300005354 Bacteria 2162
24 Ga0070675_100294452 3300005354 Bacteria 1429
25 Ga0070675_100349532 3300005354 Unclassified 1311
26 Ga0070671_100104683 3300005355 Bacteria 2375
27 Ga0070671_100300357 3300005355 Bacteria 1367
28 Ga0070674_100000942 3300005356 Bacteria 15167
29 Ga0070674_100027770 3300005356 Bacteria 3711
30 Ga0070674_100034371 3300005356 Bacteria 3385
31 Ga0070674_100182807 3300005356 Unclassified 1607
32 Ga0070673_100153595 3300005364 Bacteria 1951
33 Ga0070688_100016765 3300005365 Bacteria 4194
34 Ga0070659_100028857 3300005366 Bacteria 4286
35 Ga0070714_100053334 3300005435 Bacteria 3451
36 Ga0070710_10269249 3300005437 Bacteria 1101
37 Ga0070700_100297244 3300005441 Unclassified 1177
38 Ga0070708_100070569 3300005445 Bacteria 3143
39 Ga0070678_100142268 3300005456 Bacteria 1921
40 Ga0070678_100303810 3300005456 Bacteria 1357
41 Ga0070678_100560053 3300005456 Unclassified 1016
42 Ga0070662_100109557 3300005457 Bacteria 2102
43 Ga0070662_100112152 3300005457 Bacteria 2079
44 Ga0070662_100287268 3300005457 Bacteria 1332
45 Ga0070662_100478351 3300005457 Bacteria 1037
46 Ga0070681_10076017 3300005458 Bacteria 3318
47 Ga0070681_10100692 3300005458 Bacteria 2835
48 Ga0068867_100145134 3300005459 Bacteria 1859
49 Ga0068867_100520882 3300005459 Bacteria 1025
50 Ga0070685_10082110 3300005466 Unclassified 1933
51 Ga0070706_100278875 3300005467 Bacteria 1560
52 Ga0070699_100015345 3300005518 Bacteria 6583
53 Ga0070684_100004358 3300005535 Bacteria 10758
54 Ga0070697_100806406 3300005536 Unclassified 831
55 Ga0070672_100076547 3300005543 Bacteria 2673
56 Ga0070672_100154399 3300005543 Viruses 1901
57 Ga0070696_100303319 3300005546 Bacteria 1224
58 Ga0070664_100019406 3300005564 Bacteria 5594
59 Ga0070664_100236535 3300005564 Viruses 1638
60 Ga0070664_100804943 3300005564 Bacteria 879
61 Ga0068857_100132389 3300005577 Bacteria 2249
62 Ga0068857_100427882 3300005577 Bacteria 1235
63 Ga0068854_100017507 3300005578 Bacteria 4795
64 Ga0068856_100037386 3300005614 Bacteria 4764
65 Ga0070702_100198625 3300005615 Bacteria 1326
66 Ga0068852_100200493 3300005616 Bacteria 1888
67 Ga0068859_100009370 3300005617 Bacteria 9887
68 Ga0068864_100072093 3300005618 Bacteria 3009
69 Ga0068864_100419992 3300005618 Bacteria 1274
70 Ga0068861_100429601 3300005719 Bacteria 1179
71 Ga0068851_10026121 3300005834 Bacteria 2867
72 Ga0068860_100002316 3300005843 Bacteria 20016
73 Ga0068862_100024651 3300005844 Bacteria 5049
74 Ga0068862_100134406 3300005844 Bacteria 2191
75 Ga0068862_100514902 3300005844 Unclassified 1138
76 Ga0068862_100553351 3300005844 Bacteria 1099
77 Ga0068862_100630612 3300005844 Unclassified 1032
78 Ga0081539_10141584 3300005985 Bacteria 1168
79 Ga0075368_10046644 3300006042 Bacteria 1714
80 Ga0075432_10082257 3300006058 Bacteria 1169
81 Ga0075367_10062753 3300006178 Bacteria 2220
82 Ga0075367_10124726 3300006178 Bacteria 1588
83 Ga0075366_10274130 3300006195 Bacteria 1030
84 Ga0097621_100213397 3300006237 Bacteria 1680
85 Ga0097621_100401860 3300006237 Bacteria 1227
86 Ga0075428_100028691 3300006844 Bacteria 6157
87 Ga0075428_100041559 3300006844 Bacteria 5056
88 Ga0075428_100048659 3300006844 Bacteria 4653
89 Ga0075430_100015882 3300006846 Bacteria 6413
90 Ga0075430_100026750 3300006846 Bacteria 4906
91 Ga0075430_100079807 3300006846 Bacteria 2742
92 Ga0075431_100017713 3300006847 Bacteria 7243
93 Ga0075431_100023156 3300006847 Bacteria 6351
94 Ga0075431_100060108 3300006847 Bacteria 3922
95 Ga0075431_100545092 3300006847 Bacteria 1148
96 Ga0075434_100332934 3300006871 Unclassified 1539
97 Ga0075434_100433306 3300006871 Unclassified 1336
98 Ga0075434_100535118 3300006871 Unclassified 1192
99 Ga0075434_100636089 3300006871 Bacteria 1085
100 Ga0075429_100076257 3300006880 Bacteria 2920
101 Ga0075429_100094615 3300006880 Bacteria 2605
102 Ga0075429_100153112 3300006880 Bacteria 2019
103 Ga0075429_100195889 3300006880 Bacteria 1770
104 Ga0068865_100331158 3300006881 Viruses 1228
105 Ga0097620_100009370 3300006931 Bacteria 9887
106 Ga0075435_100007106 3300007076 Bacteria 7951
107 Ga0075435_100162445 3300007076 Bacteria 1882
108 Ga0075435_100194335 3300007076 Bacteria 1718
109 Ga0105240_10102931 3300009093 Bacteria 3470
110 Ga0105240_10779831 3300009093 Unclassified 1037
111 Ga0111539_10011138 3300009094 Bacteria 11313
112 Ga0111539_10040993 3300009094 Bacteria 5570
113 Ga0111539_10053055 3300009094 Bacteria 4826
114 Ga0111539_10088994 3300009094 Bacteria 3627
115 Ga0114129_10004873 3300009147 Bacteria 18936
116 Ga0114129_10042459 3300009147 Bacteria 6404
117 Ga0114129_10594129 3300009147 Unclassified 1435
118 Ga0114129_10684450 3300009147 Bacteria 1320
119 Ga0105243_10420453 3300009148 Bacteria 1246
120 Ga0105241_10015260 3300009174 Bacteria 5626
121 Ga0105248_10074660 3300009177 Bacteria 3811
122 Ga0105237_10075522 3300009545 Bacteria 3361
123 Ga0105238_10081007 3300009551 Bacteria 3235
124 Ga0105238_10266301 3300009551 Bacteria 1694
125 Ga0105249_10019528 3300009553 Bacteria 6047
126 Ga0105249_10403812 3300009553 Bacteria 1397
127 Ga0105249_10411131 3300009553 Unclassified 1385
128 Ga0105239_10354498 3300010375 Bacteria 1656
129 Ga0157373_10020817 3300013100 Bacteria 4761
130 Ga0157370_10019410 3300013104 Bacteria 6819
131 Ga0157378_10202991 3300013297 Bacteria 1876
132 Ga0157372_10369853 3300013307 Bacteria 1670
133 Ga0157375_10277552 3300013308 Unclassified 1838
134 Ga0157380_10014308 3300014326 Bacteria 5804
135 Ga0157380_10095949 3300014326 Unclassified 2458
136 Ga0157380_10321909 3300014326 Bacteria 1434
137 Ga0157380_10358401 3300014326 Bacteria 1367
138 Ga0157377_10235094 3300014745 Bacteria 1180
139 Ga0163161_10242601 3300017792 Unclassified 1402
140 Ga0207697_10070900 3300025315 Bacteria 1460
141 Ga0207656_10015211 3300025321 Bacteria 2975
142 Ga0207682_10006857 3300025893 Bacteria 4571
143 Ga0207682_10050175 3300025893 Bacteria 1725
144 Ga0207682_10054962 3300025893 Bacteria 1655
145 Ga0207680_10150552 3300025903 Bacteria 1551
146 Ga0207705_10110544 3300025909 Bacteria 2030
147 Ga0207684_10073214 3300025910 Bacteria 2909
148 Ga0207684_10233719 3300025910 Bacteria 1586
149 Ga0207654_10019716 3300025911 Bacteria 3565
150 Ga0207707_10109556 3300025912 Bacteria 2414
151 Ga0207707_10304288 3300025912 Bacteria 1378
152 Ga0207695_10366399 3300025913 Bacteria 1327
153 Ga0207660_10012403 3300025917 Bacteria 5576
154 Ga0207662_10023533 3300025918 Bacteria 3540
155 Ga0207657_10014099 3300025919 Bacteria 7821
156 Ga0207652_10059079 3300025921 Bacteria 3305
157 Ga0207646_10105690 3300025922 Bacteria 2525
158 Ga0207694_10009529 3300025924 Bacteria 7324
159 Ga0207659_10000336 3300025926 Bacteria 28295
160 Ga0207659_10435795 3300025926 Bacteria 1101
161 Ga0207664_10075203 3300025929 Bacteria 2730
162 Ga0207644_10032048 3300025931 Bacteria 3665
163 Ga0207690_10070135 3300025932 Bacteria 2413
164 Ga0207706_10020518 3300025933 Bacteria 5940
165 Ga0207706_10069023 3300025933 Bacteria 3108
166 Ga0207670_10008608 3300025936 Bacteria 5769
167 Ga0207669_10004057 3300025937 Bacteria 6410
168 Ga0207669_10008098 3300025937 Bacteria 4915
169 Ga0207669_10098572 3300025937 Bacteria 1925
170 Ga0207704_10063393 3300025938 Unclassified 2304
171 Ga0207704_10110201 3300025938 Bacteria 1859
172 Ga0207691_10029825 3300025940 Bacteria 5101
173 Ga0207691_10181434 3300025940 Bacteria 1839
174 Ga0207679_10367732 3300025945 Viruses 1258
175 Ga0207679_10462036 3300025945 Bacteria 1127
176 Ga0207667_10006654 3300025949 Bacteria 13970
177 Ga0207667_10104678 3300025949 Bacteria 2919
178 Ga0207668_10157364 3300025972 Bacteria 1766
179 Ga0207668_10378450 3300025972 Bacteria 1191
180 Ga0207639_10479373 3300026041 Bacteria 1133
181 Ga0207708_10017611 3300026075 Bacteria 5379
182 Ga0207708_10078865 3300026075 Bacteria 2529
183 Ga0207648_10102926 3300026089 Bacteria 2503
184 Ga0207648_10525932 3300026089 Bacteria 1084
185 Ga0207676_10117898 3300026095 Bacteria 2233
186 Ga0207676_10202018 3300026095 Bacteria 1757
187 Ga0207676_10456062 3300026095 Unclassified 1206
188 Ga0207674_10050496 3300026116 Bacteria 4248
189 Ga0207674_10157802 3300026116 Bacteria 2224
190 Ga0207675_100131632 3300026118 Bacteria 2372
191 Ga0207683_10058595 3300026121 Bacteria 3382
192 Ga0207683_10164196 3300026121 Bacteria 2009
193 Ga0207683_10293358 3300026121 Bacteria 1487
194 Ga0207698_10006583 3300026142 Bacteria 7263
195 Ga0207428_10013750 3300027907 Bacteria 7056
196 Ga0207428_10144727 3300027907 Bacteria 1812
197 Ga0207428_10293881 3300027907 Bacteria 1203
198 Ga0268265_10175034 3300028380 Bacteria 1838
199 Ga0268265_10220534 3300028380 Bacteria 1659
200 Ga0268265_10724569 3300028380 Unclassified 963
201 Ga0268264_10018815 3300028381 Bacteria 5648
202 Ga0307408_100005008 3300031548 Bacteria 8888
203 Ga0307416_100121083 3300032002 Bacteria 2332
204 Ga0307416_100315493 3300032002 Bacteria 1562
205 Ga0307416_100878081 3300032002 Bacteria 996
206 Ga0307416_101073784 3300032002 Bacteria 909
207 Ga0307415_100240993 3300032126 Unclassified 1463
208 Ga0373940_0071987 3300035088 Bacteria 1008
209 Ga0373949_0021316 3300035090 Bacteria 1489
210 Ga0373932_0106436 3300035112 Bacteria 919
211 Ga0373953_0206654 3300035117 Bacteria 850
212 Ga0373947_0012000 3300035725 Bacteria 4962
213 Ga0395905_0260230 3300037471 Bacteria 1620
214 Ga0395905_0580655 3300037471 Bacteria 1022
215 Ga0400486_20280 3300038742 Bacteria 2381
216 Ga0439435_0036474 3300042436 Bacteria 1359
217 Ga0466963_0515320 3300044694 Bacteria 844
218 Ga0466967_0353138 3300045976 Bacteria 1423
219 Ga0495638_0020727 3300046460 Bacteria 4340
220 Ga0495582_0161351 3300046473 Bacteria 1275
221 Ga0495583_0000318 3300046506 Bacteria 76178
222 Ga0495630_0334173 3300046517 Unclassified 1159
223 Ga0495643_0003695 3300046522 Bacteria 11089
224 Ga0495598_0034420 3300046537 Bacteria 1444
225 Ga0495598_0084215 3300046537 Unclassified 1026
226 Ga0495621_0004730 3300046539 Bacteria 3859
227 Ga0495633_0113824 3300046558 Bacteria 1254
228 Ga0495669_0011465 3300046684 Bacteria 3764
229 Ga0495675_0105217 3300047444 Bacteria 1764
230 Ga0496101_0331726 3300048904 Unclassified 1194
231 Ga0496102_0285762 3300048905 Unclassified 1555
232 Ga0496106_0347243 3300048909 Bacteria 1192
233 Ga0496109_0202850 3300048912 Bacteria 1865
234 Ga0501032_0347080 3300049569 Unclassified 956
235 Ga0501036_0047395 3300049572 Bacteria 3640
236 Ga0501037_0128394 3300049573 Unclassified 1819
237 Ga0501038_0083597 3300049574 Bacteria 2687
238 Ga0501038_0236267 3300049574 Bacteria 1453
239 Ga0501039_0320958 3300049575 Unclassified 1217
240 Ga0501040_0014957 3300049576 Bacteria 5125
241 Ga0501040_0018732 3300049576 Bacteria 4598
242 Ga0501041_0040368 3300049577 Bacteria 2832
243 Ga0501041_0382059 3300049577 Bacteria 891
244 Ga0501042_0031637 3300049578 Bacteria 3743
245 Ga0501042_0037071 3300049578 Bacteria 3460
246 Ga0501043_0059940 3300049579 Bacteria 2987
247 Ga0501046_0018724 3300049580 Bacteria 5756
248 Ga0501046_0028055 3300049580 Bacteria 4588
249 Ga0501048_0059271 3300049582 Bacteria 2713
250 Ga0501048_0114133 3300049582 Bacteria 1908
251 Ga0501068_0088917 3300049584 Bacteria 1903
252 Ga0501068_0214438 3300049584 Bacteria 1223
253 Ga0501071_0027129 3300049587 Bacteria 4027
254 Ga0501072_0015837 3300049588 Bacteria 5780
255 Ga0501074_0042967 3300049590 Bacteria 3271
256 Ga0501075_0006339 3300049591 Bacteria 8133
257 Ga0501075_0026401 3300049591 Bacteria 4275
258 Ga0501076_0007517 3300049592 Bacteria 7930
259 Ga0501077_0101096 3300049593 Bacteria 1827
260 Ga0501079_0015264 3300049741 Bacteria 5858
261 Ga0501079_0037628 3300049741 Bacteria 3730
262 Ga0501081_0026227 3300049743 Bacteria 3927
263 Ga0501081_0083373 3300049743 Unclassified 2241
264 Ga0501081_0177321 3300049743 Bacteria 1540
265 Ga0501083_0270572 3300049744 Bacteria 1105
266 Ga0501045_0013092 3300049824 Bacteria 5851
267 Ga0501045_0031077 3300049824 Bacteria 3867
268 nmdc:mga0k408_236726_c1 3300050493 Bacteria 1090
269 nmdc:mga05p37_10222_c1 3300050507 Bacteria 11145
270 nmdc:mga05p37_131626_c2 3300050507 Unclassified 2633
271 nmdc:mga05p37_34061_c1 3300050507 Bacteria 6239
272 nmdc:mga05p37_7282_c1 3300050507 Bacteria 13056
273 nmdc:mga05p37_82260_c1 3300050507 Bacteria 3261
274 nmdc:mga09592_13968_c1 3300050508 Bacteria 6558
275 nmdc:mga09592_186524_c1 3300050508 Bacteria 1795
276 nmdc:mga09592_278965_c1 3300050508 Bacteria 1449
277 nmdc:mga09592_31582_c2 3300050508 Bacteria 3838
278 nmdc:mga09592_39610_c1 3300050508 Bacteria 3959
279 nmdc:mga0qj67_155258_c1 3300050509 Unclassified 1857
280 nmdc:mga0qj67_313269_c1 3300050509 Bacteria 1271
281 nmdc:mga0qj67_72341_c1 3300050509 Bacteria 2753
282 nmdc:mga0qj67_86799_c1 3300050509 Bacteria 2511
283 nmdc:mga06r32_434989_c1 3300050510 Bacteria 1293
284 nmdc:mga06r32_6003_c1 3300050510 Bacteria 10929
285 nmdc:mga06r32_77533_c1 3300050510 Unclassified 3229
286 nmdc:mga06r32_86905_c1 3300050510 Bacteria 3050
287 nmdc:mga08y16_124511_c1 3300050511 Bacteria 2682
288 nmdc:mga08y16_21334_c1 3300050511 Bacteria 6839
289 nmdc:mga08y16_269143_c1 3300050511 Bacteria 1759
290 nmdc:mga08y16_62166_c1 3300050511 Bacteria 3899
291 nmdc:mga08y16_97101_c1 3300050511 Bacteria 3068
292 nmdc:mga0rr50_63881_c1 3300050513 Bacteria 2782
293 nmdc:mga0a205_146038_c1 3300050515 Bacteria 2265
294 nmdc:mga0a205_236671_c1 3300050515 Bacteria 1708
295 nmdc:mga0a205_73024_c1 3300050515 Bacteria 3315
296 Ga0500568_0014202 3300053139 Bacteria 3604
297 Ga0501084_0251048 3300054114 Bacteria 1493
298 Ga0501082_0014885 3300060353 Bacteria 6700
299 Ga0501082_0083775 3300060353 Bacteria 2751
300 Ga0501082_0629189 3300060353 Bacteria 939
301 Ga0530510_0038716 3300061734 Bacteria 3443
302 Ga0530510_0055319 3300061734 Unclassified 2866
303 Ga0070680_100435785
304 Ga0065712_10015893
305 Ga0065715_10107516
306 Ga0065715_10109152
307 Ga0065707_10001922
308 Ga0070658_10011986
309 Ga0070683_100032309
310 Ga0070690_100234865
311 Ga0070670_100755828
312 Ga0070677_10172782
313 Ga0070666_10159993
314 Ga0070689_100015027
315 Ga0070689_100100336
316 Ga0070687_100031187
317 Ga0070661_100131779
318 Ga0070692_10063352
319 Ga0070668_100215843
320 Ga0070668_100325753
321 Ga0070668_100512731
322 Ga0070669_100207694
323 Ga0070675_100004488
324 Ga0070675_100084422
325 Ga0070675_100127999
326 Ga0070675_100294452
327 Ga0070675_100349532
328 Ga0070671_100104683
329 Ga0070671_100300357
330 Ga0070674_100000942
331 Ga0070674_100027770
332 Ga0070674_100034371
333 Ga0070674_100182807
334 Ga0070673_100153595
335 Ga0070688_100016765
336 Ga0070659_100028857
337 Ga0070714_100053334
338 Ga0070710_10269249
339 Ga0070700_100297244
340 Ga0070708_100070569
341 Ga0070678_100142268
342 Ga0070678_100303810
343 Ga0070678_100560053
344 Ga0070662_100109557
345 Ga0070662_100112152
346 Ga0070662_100287268
347 Ga0070662_100478351
348 Ga0070681_10076017
349 Ga0070681_10100692
350 Ga0068867_100145134
351 Ga0068867_100520882
352 Ga0070685_10082110
353 Ga0070706_100278875
354 Ga0070699_100015345
355 Ga0070684_100004358
356 Ga0070697_100806406
357 Ga0070672_100076547
358 Ga0070672_100154399
359 Ga0070696_100303319
360 Ga0070664_100019406
361 Ga0070664_100236535
362 Ga0070664_100804943
363 Ga0068857_100132389
364 Ga0068857_100427882
365 Ga0068854_100017507
366 Ga0068856_100037386
367 Ga0070702_100198625
368 Ga0068852_100200493
369 Ga0068859_100009370
370 Ga0068864_100072093
371 Ga0068864_100419992
372 Ga0068861_100429601
373 Ga0068851_10026121
374 Ga0068860_100002316
375 Ga0068862_100024651
376 Ga0068862_100134406
377 Ga0068862_100514902
378 Ga0068862_100553351
379 Ga0068862_100630612
380 Ga0081539_10141584
381 Ga0075368_10046644
382 Ga0075432_10082257
383 Ga0075367_10062753
384 Ga0075367_10124726
385 Ga0075366_10274130
386 Ga0097621_100213397
387 Ga0097621_100401860
388 Ga0075428_100028691
389 Ga0075428_100041559
390 Ga0075428_100048659
391 Ga0075430_100015882
392 Ga0075430_100026750
393 Ga0075430_100079807
394 Ga0075431_100017713
395 Ga0075431_100023156
396 Ga0075431_100060108
397 Ga0075431_100545092
398 Ga0075434_100332934
399 Ga0075434_100433306
400 Ga0075434_100535118
401 Ga0075434_100636089
402 Ga0075429_100076257
403 Ga0075429_100094615
404 Ga0075429_100153112
405 Ga0075429_100195889
406 Ga0068865_100331158
407 Ga0097620_100009370
408 Ga0075435_100007106
409 Ga0075435_100162445
410 Ga0075435_100194335
411 Ga0105240_10102931
412 Ga0105240_10779831
413 Ga0111539_10011138
414 Ga0111539_10040993
415 Ga0111539_10053055
416 Ga0111539_10088994
417 Ga0114129_10004873
418 Ga0114129_10042459
419 Ga0114129_10594129
420 Ga0114129_10684450
421 Ga0105243_10420453
422 Ga0105241_10015260
423 Ga0105248_10074660
424 Ga0105237_10075522
425 Ga0105238_10081007
426 Ga0105238_10266301
427 Ga0105249_10019528
428 Ga0105249_10403812
429 Ga0105249_10411131
430 Ga0105239_10354498
431 Ga0157373_10020817
432 Ga0157370_10019410
433 Ga0157378_10202991
434 Ga0157372_10369853
435 Ga0157375_10277552
436 Ga0157380_10014308
437 Ga0157380_10095949
438 Ga0157380_10321909
439 Ga0157380_10358401
440 Ga0157377_10235094
441 Ga0163161_10242601
442 Ga0207697_10070900
443 Ga0207656_10015211
444 Ga0207682_10006857
445 Ga0207682_10050175
446 Ga0207682_10054962
447 Ga0207680_10150552
448 Ga0207705_10110544
449 Ga0207684_10073214
450 Ga0207684_10233719
451 Ga0207654_10019716
452 Ga0207707_10109556
453 Ga0207707_10304288
454 Ga0207695_10366399
455 Ga0207660_10012403
456 Ga0207662_10023533
457 Ga0207657_10014099
458 Ga0207652_10059079
459 Ga0207646_10105690
460 Ga0207694_10009529
461 Ga0207659_10000336
462 Ga0207659_10435795
463 Ga0207664_10075203
464 Ga0207644_10032048
465 Ga0207690_10070135
466 Ga0207706_10020518
467 Ga0207706_10069023
468 Ga0207670_10008608
469 Ga0207669_10004057
470 Ga0207669_10008098
471 Ga0207669_10098572
472 Ga0207704_10063393
473 Ga0207704_10110201
474 Ga0207691_10029825
475 Ga0207691_10181434
476 Ga0207679_10367732
477 Ga0207679_10462036
478 Ga0207667_10006654
479 Ga0207667_10104678
480 Ga0207668_10157364
481 Ga0207668_10378450
482 Ga0207639_10479373
483 Ga0207708_10017611
484 Ga0207708_10078865
485 Ga0207648_10102926
486 Ga0207648_10525932
487 Ga0207676_10117898
488 Ga0207676_10202018
489 Ga0207676_10456062
490 Ga0207674_10050496
491 Ga0207674_10157802
492 Ga0207675_100131632
493 Ga0207683_10058595
494 Ga0207683_10164196
495 Ga0207683_10293358
496 Ga0207698_10006583
497 Ga0207428_10013750
498 Ga0207428_10144727
499 Ga0207428_10293881
500 Ga0268265_10175034
501 Ga0268265_10220534
502 Ga0268265_10724569
503 Ga0268264_10018815
504 Ga0307408_100005008
505 Ga0307416_100121083
506 Ga0307416_100315493
507 Ga0307416_100878081
508 Ga0307416_101073784
509 Ga0307415_100240993
510 Ga0373940_0071987
511 Ga0373949_0021316
512 Ga0373932_0106436
513 Ga0373953_0206654
514 Ga0373947_0012000
515 Ga0395905_0260230
516 Ga0395905_0580655
517 Ga0400486_20280
518 Ga0439435_0036474
519 Ga0466963_0515320
520 Ga0466967_0353138
521 Ga0495638_0020727
522 Ga0495582_0161351
523 Ga0495583_0000318
524 Ga0495630_0334173
525 Ga0495643_0003695
526 Ga0495598_0034420
527 Ga0495598_0084215
528 Ga0495621_0004730
529 Ga0495633_0113824
530 Ga0495669_0011465
531 Ga0495675_0105217
532 Ga0496101_0331726
533 Ga0496102_0285762
534 Ga0496106_0347243
535 Ga0496109_0202850
536 Ga0501032_0347080
537 Ga0501036_0047395
538 Ga0501037_0128394
539 Ga0501038_0083597
540 Ga0501038_0236267
541 Ga0501039_0320958
542 Ga0501040_0014957
543 Ga0501040_0018732
544 Ga0501041_0040368
545 Ga0501041_0382059
546 Ga0501042_0031637
547 Ga0501042_0037071
548 Ga0501043_0059940
549 Ga0501046_0018724
550 Ga0501046_0028055
551 Ga0501048_0059271
552 Ga0501048_0114133
553 Ga0501068_0088917
554 Ga0501068_0214438
555 Ga0501071_0027129
556 Ga0501072_0015837
557 Ga0501074_0042967
558 Ga0501075_0006339
559 Ga0501075_0026401
560 Ga0501076_0007517
561 Ga0501077_0101096
562 Ga0501079_0015264
563 Ga0501079_0037628
564 Ga0501081_0026227
565 Ga0501081_0083373
566 Ga0501081_0177321
567 Ga0501083_0270572
568 Ga0501045_0013092
569 Ga0501045_0031077
570 nmdc:mga0k408_236726_c1
571 nmdc:mga05p37_10222_c1
572 nmdc:mga05p37_131626_c2
573 nmdc:mga05p37_34061_c1
574 nmdc:mga05p37_7282_c1
575 nmdc:mga05p37_82260_c1
576 nmdc:mga09592_13968_c1
577 nmdc:mga09592_186524_c1
578 nmdc:mga09592_278965_c1
579 nmdc:mga09592_31582_c2
580 nmdc:mga09592_39610_c1
581 nmdc:mga0qj67_155258_c1
582 nmdc:mga0qj67_313269_c1
583 nmdc:mga0qj67_72341_c1
584 nmdc:mga0qj67_86799_c1
585 nmdc:mga06r32_434989_c1
586 nmdc:mga06r32_6003_c1
587 nmdc:mga06r32_77533_c1
588 nmdc:mga06r32_86905_c1
589 nmdc:mga08y16_124511_c1
590 nmdc:mga08y16_21334_c1
591 nmdc:mga08y16_269143_c1
592 nmdc:mga08y16_62166_c1
593 nmdc:mga08y16_97101_c1
594 nmdc:mga0rr50_63881_c1
595 nmdc:mga0a205_146038_c1
596 nmdc:mga0a205_236671_c1
597 nmdc:mga0a205_73024_c1
598 Ga0500568_0014202
599 Ga0501084_0251048
600 Ga0501082_0014885
601 Ga0501082_0083775
602 Ga0501082_0629189
603 Ga0530510_0038716
604 Ga0530510_0055319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

37

264

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8608 22 249
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8568 21 249
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8506 22 249
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8465 21 249
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.8362 21 250
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9656 24 87 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9595 24 87 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9468 23 86 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9179 22 250 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9125 22 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7T4QXI0-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9111 25 248 GO:0015689
GO:0030973
GO:0046872
AF-A0A7Y2YAX4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.903 31 248 GO:0015689
GO:0030973
GO:0046872
AF-A0A7Y2YAX4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.8835 31 248 GO:0015689
GO:0030973
GO:0046872
AF-A0A6H0IVM9-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.8833 14 249 GO:0015689
GO:0030973
GO:0046872
AF-A0A661EE90-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.8807 19 250 GO:0015689
GO:0016020
GO:0030973
GO:0046872

Map