F396286

General Info

Members Datasets Scaffolds Average Seq Length
302 186 604 376

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10000986|Ga0070676_100009866
Length 353
Sequence MRNGVIAFRRDGTLALMNDEAYRIFGLTPAPGDIGRPFADVLRERPEIIRLMFSSFELSYLPNRAELRLKDLDRVIGYTISHVRDESGDAPIGAVLFFKDLTRVEQIEEQERLRDRLASLGEMAAGIAHELKNPLAGIEVMAGLLRRQVPESKDAQSLLADILSEAKLANAIVVEMLEFVRPVRLQVERTDLADVLQQSVTMAESKARRGQVTVATEIEQGLPPIDGDHHQLSQVFTNLVANAFEAMDGKGHITITAATSTIDADPAFAGVHPPTPVVVVEVADDGPGIAPELTDRIFNPFFTTKVTGTGLGLAIVRKIIDAHDGRIDVHSNAQTGTKFRVTVPVTSASSWFK

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.3
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10000986 3300005328 Bacteria 14151
2 JGI24751J29686_10001090 3300002459 Bacteria 5884
3 Ga0070676_10036882 3300005328 Bacteria 2817
4 Ga0070676_10063238 3300005328 Bacteria 2204
5 Ga0070683_100213396 3300005329 Bacteria 1834
6 Ga0070690_100009755 3300005330 Bacteria 5569
7 Ga0070670_100023056 3300005331 Bacteria 5356
8 Ga0070670_100232207 3300005331 Unclassified 1605
9 Ga0070666_10001460 3300005335 Bacteria 14346
10 Ga0070660_100077427 3300005339 Bacteria 2606
11 Ga0070689_100132178 3300005340 Bacteria 2002
12 Ga0070691_10006564 3300005341 Bacteria 5322
13 Ga0070668_100090435 3300005347 Bacteria 2412
14 Ga0070669_100158990 3300005353 Bacteria 1754
15 Ga0070675_100080757 3300005354 Bacteria 2711
16 Ga0070671_100059703 3300005355 Bacteria 3174
17 Ga0070674_100242158 3300005356 Unclassified 1413
18 Ga0070673_100056848 3300005364 Bacteria 3088
19 Ga0070673_100334408 3300005364 Bacteria 1341
20 Ga0070659_100091827 3300005366 Bacteria 2434
21 Ga0070667_100004804 3300005367 Bacteria 11320
22 Ga0070667_100184280 3300005367 Bacteria 1847
23 Ga0070714_100114637 3300005435 Bacteria 2391
24 Ga0070701_10011576 3300005438 Bacteria 3950
25 Ga0070711_100111135 3300005439 Bacteria 2012
26 Ga0070694_100007108 3300005444 Bacteria 6817
27 Ga0070708_100172316 3300005445 Bacteria 2021
28 Ga0070678_100004053 3300005456 Bacteria 8247
29 Ga0070678_100029612 3300005456 Bacteria 3751
30 Ga0070681_10037177 3300005458 Bacteria 4887
31 Ga0070681_10138362 3300005458 Bacteria 2364
32 Ga0070681_10172624 3300005458 Bacteria 2084
33 Ga0068867_100184058 3300005459 Bacteria 1663
34 Ga0070685_10105276 3300005466 Bacteria 1729
35 Ga0070707_100093642 3300005468 Bacteria 2909
36 Ga0070698_100263085 3300005471 Bacteria 1657
37 Ga0070699_100005716 3300005518 Bacteria 10890
38 Ga0070699_100091351 3300005518 Bacteria 2662
39 Ga0070699_100114466 3300005518 Bacteria 2370
40 Ga0070699_100190611 3300005518 Bacteria 1821
41 Ga0070699_100190631 3300005518 Bacteria 1821
42 Ga0070679_100050906 3300005530 Bacteria 4126
43 Ga0070679_100098223 3300005530 Bacteria 2916
44 Ga0070697_100083120 3300005536 Bacteria 2640
45 Ga0070697_100085939 3300005536 Bacteria 2595
46 Ga0070697_100109591 3300005536 Bacteria 2299
47 Ga0070686_100001443 3300005544 Bacteria 13429
48 Ga0070686_100045827 3300005544 Bacteria 2756
49 Ga0070695_100201463 3300005545 Bacteria 1423
50 Ga0070696_100055390 3300005546 Bacteria 2765
51 Ga0070665_100191757 3300005548 Bacteria 2044
52 Ga0070704_100047398 3300005549 Bacteria 3004
53 Ga0068855_100062542 3300005563 Bacteria 4345
54 Ga0070664_100192373 3300005564 Bacteria 1818
55 Ga0068857_100130781 3300005577 Bacteria 2264
56 Ga0068854_100053335 3300005578 Bacteria 2904
57 Ga0068856_100034335 3300005614 Bacteria 4968
58 Ga0068859_100160810 3300005617 Bacteria 2325
59 Ga0068859_100239118 3300005617 Bacteria 1905
60 Ga0068864_100003141 3300005618 Bacteria 13649
61 Ga0068866_10025675 3300005718 Bacteria 2772
62 Ga0068861_100020433 3300005719 Bacteria 4744
63 Ga0068863_100046453 3300005841 Bacteria 4121
64 Ga0068863_100142959 3300005841 Bacteria 2287
65 Ga0068860_100059670 3300005843 Bacteria 3626
66 Ga0068860_100066799 3300005843 Bacteria 3417
67 Ga0068860_100118549 3300005843 Bacteria 2533
68 Ga0081455_10008733 3300005937 Bacteria 10492
69 Ga0081455_10051001 3300005937 Bacteria 3552
70 Ga0081539_10054142 3300005985 Bacteria 2242
71 Ga0070716_100097961 3300006173 Bacteria 1791
72 Ga0097621_100013447 3300006237 Bacteria 6101
73 Ga0097621_100050268 3300006237 Bacteria 3390
74 Ga0097621_100052332 3300006237 Bacteria 3326
75 Ga0097621_100164097 3300006237 Bacteria 1911
76 Ga0068871_100091099 3300006358 Bacteria 2541
77 Ga0075434_100036241 3300006871 Bacteria 4880
78 Ga0075434_100042105 3300006871 Bacteria 4527
79 Ga0075434_100066146 3300006871 Bacteria 3600
80 Ga0075429_100036513 3300006880 Bacteria 4274
81 Ga0075429_100332537 3300006880 Bacteria 1330
82 Ga0075436_100014955 3300006914 Bacteria 5319
83 Ga0075436_100017746 3300006914 Bacteria 4872
84 Ga0075436_100035607 3300006914 Bacteria 3433
85 Ga0075436_100062393 3300006914 Bacteria 2575
86 Ga0075436_100154968 3300006914 Bacteria 1613
87 Ga0097620_100160810 3300006931 Bacteria 2325
88 Ga0097620_100239116 3300006931 Bacteria 1905
89 Ga0075435_100012125 3300007076 Bacteria 6373
90 Ga0075435_100022429 3300007076 Bacteria 4872
91 Ga0075435_100054130 3300007076 Bacteria 3238
92 Ga0075435_100168518 3300007076 Bacteria 1847
93 Ga0105240_10038904 3300009093 Bacteria 6097
94 Ga0105240_10126082 3300009093 Bacteria 3076
95 Ga0105240_10140243 3300009093 Bacteria 2891
96 Ga0105240_10199549 3300009093 Bacteria 2345
97 Ga0111539_10001119 3300009094 Bacteria 35455
98 Ga0111539_10022288 3300009094 Bacteria 7785
99 Ga0111539_10102355 3300009094 Bacteria 3361
100 Ga0105247_10058080 3300009101 Bacteria 2393
101 Ga0114129_10000997 3300009147 Bacteria 36967
102 Ga0114129_10001174 3300009147 Bacteria 34722
103 Ga0114129_10002196 3300009147 Bacteria 26870
104 Ga0114129_10020638 3300009147 Bacteria 9367
105 Ga0114129_10028205 3300009147 Bacteria 7954
106 Ga0114129_10100890 3300009147 Bacteria 3994
107 Ga0114129_10147813 3300009147 Bacteria 3218
108 Ga0114129_10152236 3300009147 Bacteria 3165
109 Ga0114129_10163650 3300009147 Bacteria 3038
110 Ga0114129_10200542 3300009147 Bacteria 2703
111 Ga0105243_10261268 3300009148 Bacteria 1550
112 Ga0105242_10049668 3300009176 Bacteria 3414
113 Ga0105242_10176892 3300009176 Bacteria 1880
114 Ga0105248_10063544 3300009177 Bacteria 4144
115 Ga0105248_10089368 3300009177 Bacteria 3467
116 Ga0105248_10104758 3300009177 Bacteria 3189
117 Ga0105248_10137252 3300009177 Bacteria 2759
118 Ga0105248_10193587 3300009177 Bacteria 2291
119 Ga0105248_10526852 3300009177 Bacteria 1333
120 Ga0105238_10247912 3300009551 Bacteria 1759
121 Ga0105238_10437393 3300009551 Bacteria 1304
122 Ga0105249_10168267 3300009553 Bacteria 2124
123 Ga0105249_10223449 3300009553 Bacteria 1854
124 Ga0105246_10133109 3300011119 Bacteria 1860
125 Ga0105246_10204805 3300011119 Bacteria 1536
126 Ga0157374_10205842 3300013296 Bacteria 1928
127 Ga0163162_10088655 3300013306 Bacteria 3173
128 Ga0163162_10320460 3300013306 Bacteria 1683
129 Ga0157375_10126428 3300013308 Bacteria 2671
130 Ga0157375_10157679 3300013308 Bacteria 2410
131 Ga0157375_10370992 3300013308 Bacteria 1597
132 Ga0163163_10008939 3300014325 Bacteria 8923
133 Ga0163163_10144001 3300014325 Bacteria 2426
134 Ga0157380_10323297 3300014326 Bacteria 1431
135 Ga0157377_10040317 3300014745 Bacteria 2585
136 Ga0157379_10049036 3300014968 Bacteria 3770
137 Ga0157379_10169706 3300014968 Bacteria 1969
138 Ga0157376_10075114 3300014969 Bacteria 2883
139 Ga0157376_10078409 3300014969 Bacteria 2829
140 Ga0207682_10027555 3300025893 Bacteria 2263
141 Ga0207642_10067500 3300025899 Bacteria 1688
142 Ga0207680_10001435 3300025903 Bacteria 11296
143 Ga0207699_10009440 3300025906 Bacteria 4858
144 Ga0207645_10066980 3300025907 Bacteria 2295
145 Ga0207707_10018304 3300025912 Bacteria 6106
146 Ga0207707_10019710 3300025912 Bacteria 5887
147 Ga0207707_10142632 3300025912 Bacteria 2094
148 Ga0207695_10081851 3300025913 Bacteria 3266
149 Ga0207695_10096856 3300025913 Bacteria 2952
150 Ga0207663_10210593 3300025916 Bacteria 1408
151 Ga0207662_10087439 3300025918 Bacteria 1912
152 Ga0207657_10026903 3300025919 Bacteria 5275
153 Ga0207657_10089866 3300025919 Bacteria 2564
154 Ga0207652_10024227 3300025921 Bacteria 5034
155 Ga0207646_10071767 3300025922 Bacteria 3092
156 Ga0207681_10088786 3300025923 Bacteria 2202
157 Ga0207650_10173262 3300025925 Bacteria 1716
158 Ga0207659_10000072 3300025926 Bacteria 64525
159 Ga0207659_10080691 3300025926 Bacteria 2404
160 Ga0207687_10037910 3300025927 Bacteria 3292
161 Ga0207700_10003372 3300025928 Bacteria 9273
162 Ga0207706_10165776 3300025933 Bacteria 1942
163 Ga0207686_10021800 3300025934 Bacteria 3682
164 Ga0207704_10006608 3300025938 Bacteria 5426
165 Ga0207665_10065293 3300025939 Bacteria 2475
166 Ga0207691_10070884 3300025940 Bacteria 3147
167 Ga0207711_10045170 3300025941 Bacteria 3764
168 Ga0207711_10049132 3300025941 Bacteria 3611
169 Ga0207711_10081839 3300025941 Bacteria 2822
170 Ga0207689_10084733 3300025942 Bacteria 2605
171 Ga0207689_10210350 3300025942 Bacteria 1607
172 Ga0207667_10118977 3300025949 Bacteria 2722
173 Ga0207651_10021719 3300025960 Bacteria 3908
174 Ga0207640_10013629 3300025981 Bacteria 4665
175 Ga0207640_10042120 3300025981 Bacteria 2909
176 Ga0207658_10126475 3300025986 Bacteria 2046
177 Ga0207658_10178035 3300025986 Bacteria 1758
178 Ga0207677_10126676 3300026023 Bacteria 1931
179 Ga0207703_10037916 3300026035 Bacteria 3843
180 Ga0207703_10305979 3300026035 Bacteria 1451
181 Ga0207639_10055270 3300026041 Bacteria 3038
182 Ga0207702_10089686 3300026078 Bacteria 2689
183 Ga0207641_10023804 3300026088 Bacteria 5046
184 Ga0207641_10098357 3300026088 Bacteria 2573
185 Ga0207648_10005751 3300026089 Bacteria 12425
186 Ga0207676_10003454 3300026095 Bacteria 11182
187 Ga0207676_10239432 3300026095 Unclassified 1627
188 Ga0207675_100135884 3300026118 Bacteria 2333
189 Ga0207683_10007672 3300026121 Bacteria 9236
190 Ga0207683_10069605 3300026121 Bacteria 3108
191 Ga0209974_10022136 3300027876 Bacteria 2104
192 Ga0207428_10010807 3300027907 Bacteria 8138
193 Ga0268266_10014019 3300028379 Bacteria 6901
194 Ga0268266_10228222 3300028379 Bacteria 1714
195 Ga0268264_10052338 3300028381 Bacteria 3404
196 Ga0268264_10053894 3300028381 Bacteria 3357
197 Ga0307416_100167118 3300032002 Bacteria 2042
198 Ga0373930_0000409 3300034816 Bacteria 5697
199 Ga0373948_0000409 3300034817 Bacteria 5287
200 Ga0373958_0009176 3300034819 Bacteria 1622
201 Ga0373959_0002290 3300034820 Bacteria 3042
202 Ga0373938_0001602 3300034957 Bacteria 3641
203 Ga0373928_0000693 3300035084 Bacteria 6609
204 Ga0373929_0000500 3300035085 Bacteria 7481
205 Ga0373934_0055013 3300035086 Bacteria 1581
206 Ga0373940_0000710 3300035088 Bacteria 5400
207 Ga0373949_0001026 3300035090 Bacteria 8602
208 Ga0373951_0000835 3300035091 Bacteria 8381
209 Ga0373952_0000580 3300035092 Bacteria 6454
210 Ga0373939_0000222 3300035114 Bacteria 15549
211 Ga0373941_0002079 3300035115 Bacteria 4347
212 Ga0373945_0022582 3300035116 Bacteria 2168
213 Ga0373953_0078737 3300035117 Bacteria 1368
214 Ga0373960_0000140 3300035121 Bacteria 12051
215 Ga0373943_0015996 3300035170 Bacteria 3415
216 Ga0373946_0005179 3300035171 Bacteria 4700
217 Ga0373955_0109349 3300035172 Bacteria 1597
218 Ga0373955_0189377 3300035172 Bacteria 1223
219 Ga0373942_0001703 3300035207 Bacteria 5578
220 Ga0373961_0000977 3300035241 Bacteria 9454
221 Ga0373962_0039807 3300035242 Bacteria 1321
222 Ga0373931_0000392 3300035691 Bacteria 17983
223 Ga0373935_0012630 3300035692 Bacteria 5081
224 Ga0373947_0072465 3300035725 Bacteria 2115
225 Ga0373937_0041778 3300036401 Bacteria 4183
226 Ga0373937_0213228 3300036401 Bacteria 1817
227 Ga0373937_0455293 3300036401 Bacteria 1215
228 Ga0373925_0055885 3300037068 Bacteria 2956
229 Ga0439433_0003945 3300041999 Bacteria 3192
230 Ga0439450_023005 3300042008 Bacteria 1349
231 Ga0451576_0004093 3300045051 Bacteria 19254
232 Ga0451576_0083419 3300045051 Bacteria 3325
233 Ga0495582_0094548 3300046473 Bacteria 1669
234 Ga0495640_0218805 3300046533 Bacteria 1202
235 Ga0495586_0111645 3300046535 Bacteria 1522
236 Ga0495587_0110792 3300046536 Bacteria 1577
237 Ga0495645_0007405 3300046543 Bacteria 7635
238 Ga0495634_0024322 3300046642 Bacteria 4250
239 Ga0495647_0039026 3300046681 Bacteria 1797
240 Ga0495669_0002827 3300046684 Bacteria 7123
241 Ga0495613_0249251 3300046689 Bacteria 1240
242 Ga0495604_0083607 3300047317 Bacteria 2385
243 Ga0495604_0186279 3300047317 Bacteria 1449
244 Ga0495684_0043687 3300047471 Bacteria 3432
245 Ga0496100_0069520 3300048903 Bacteria 2345
246 Ga0496100_0218762 3300048903 Bacteria 1397
247 Ga0496101_0001911 3300048904 Bacteria 12588
248 Ga0496102_0056429 3300048905 Bacteria 3583
249 Ga0496102_0190371 3300048905 Bacteria 1933
250 Ga0496103_0111536 3300048906 Bacteria 1738
251 Ga0496104_0020531 3300048907 Bacteria 6056
252 Ga0496104_0131196 3300048907 Bacteria 2407
253 Ga0496107_0025813 3300048910 Bacteria 4163
254 Ga0496109_0106740 3300048912 Bacteria 2601
255 Ga0496112_0035661 3300048915 Bacteria 4848
256 Ga0496114_0000613 3300048917 Bacteria 26374
257 Ga0496114_0408516 3300048917 Bacteria 1202
258 Ga0501034_0005914 3300049571 Bacteria 13275
259 Ga0501042_0314742 3300049578 Bacteria 1131
260 Ga0501043_0171204 3300049579 Bacteria 1694
261 Ga0501047_0001540 3300049581 Bacteria 22545
262 Ga0501047_0220320 3300049581 Bacteria 1754
263 Ga0501076_0184828 3300049592 Bacteria 1700
264 Ga0501083_0152065 3300049744 Bacteria 1515
265 Ga0501044_0036519 3300049823 Bacteria 5141
266 nmdc:mga05p37_1000_c1 3300050507 Bacteria 32217
267 nmdc:mga05p37_120531_c1 3300050507 Bacteria 3223
268 nmdc:mga05p37_184035_c1 3300050507 Bacteria 2540
269 nmdc:mga05p37_22470_c1 3300050507 Bacteria 7648
270 nmdc:mga05p37_24195_c1 3300050507 Bacteria 7379
271 nmdc:mga05p37_25634_c1 3300050507 Bacteria 7172
272 nmdc:mga05p37_428360_c1 3300050507 Bacteria 1538
273 nmdc:mga05p37_8828_c1 3300050507 Bacteria 11908
274 nmdc:mga05p37_91344_c1 3300050507 Bacteria 3752
275 nmdc:mga09592_23788_c1 3300050508 Bacteria 5061
276 nmdc:mga08y16_168841_c1 3300050511 Bacteria 2273
277 nmdc:mga08y16_191800_c1 3300050511 Bacteria 2119
278 nmdc:mga08y16_51177_c1 3300050511 Bacteria 4321
279 nmdc:mga08y16_56865_c1 3300050511 Bacteria 4088
280 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
281 nmdc:mga0n895_182320_c1 3300050512 Bacteria 2131
282 nmdc:mga0n895_5137_c1 3300050512 Bacteria 10882
283 nmdc:mga0n895_8220_c1 3300050512 Bacteria 9021
284 nmdc:mga0rr50_123817_c1 3300050513 Bacteria 2062
285 nmdc:mga0rr50_1622_c1 3300050513 Bacteria 12380
286 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
287 nmdc:mga0rr50_202680_c1 3300050513 Bacteria 1631
288 nmdc:mga0rr50_8433_c1 3300050513 Bacteria 6416
289 nmdc:mga08x19_10189_c1 3300050514 Bacteria 5641
290 nmdc:mga08x19_39167_c1 3300050514 Bacteria 3013
291 nmdc:mga08x19_43795_c1 3300050514 Bacteria 2856
292 nmdc:mga08x19_48082_c1 3300050514 Bacteria 2732
293 nmdc:mga08x19_58632_c1 3300050514 Bacteria 2491
294 nmdc:mga0a205_38695_c1 3300050515 Bacteria 4589
295 nmdc:mga0a205_56101_c1 3300050515 Bacteria 3804
296 Ga0495601_0014122 3300053077 Bacteria 4812
297 Ga0495601_0068813 3300053077 Bacteria 2257
298 Ga0495619_0043004 3300053085 Bacteria 2960
299 Ga0495619_0070760 3300053085 Bacteria 2333
300 Ga0495619_0197533 3300053085 Bacteria 1393
301 Ga0590075_023028 3300059424 Bacteria 1561
302 Ga0501082_0090549 3300060353 Bacteria 2641
303 Ga0070676_10000986
304 JGI24751J29686_10001090
305 Ga0070676_10036882
306 Ga0070676_10063238
307 Ga0070683_100213396
308 Ga0070690_100009755
309 Ga0070670_100023056
310 Ga0070670_100232207
311 Ga0070666_10001460
312 Ga0070660_100077427
313 Ga0070689_100132178
314 Ga0070691_10006564
315 Ga0070668_100090435
316 Ga0070669_100158990
317 Ga0070675_100080757
318 Ga0070671_100059703
319 Ga0070674_100242158
320 Ga0070673_100056848
321 Ga0070673_100334408
322 Ga0070659_100091827
323 Ga0070667_100004804
324 Ga0070667_100184280
325 Ga0070714_100114637
326 Ga0070701_10011576
327 Ga0070711_100111135
328 Ga0070694_100007108
329 Ga0070708_100172316
330 Ga0070678_100004053
331 Ga0070678_100029612
332 Ga0070681_10037177
333 Ga0070681_10138362
334 Ga0070681_10172624
335 Ga0068867_100184058
336 Ga0070685_10105276
337 Ga0070707_100093642
338 Ga0070698_100263085
339 Ga0070699_100005716
340 Ga0070699_100091351
341 Ga0070699_100114466
342 Ga0070699_100190611
343 Ga0070699_100190631
344 Ga0070679_100050906
345 Ga0070679_100098223
346 Ga0070697_100083120
347 Ga0070697_100085939
348 Ga0070697_100109591
349 Ga0070686_100001443
350 Ga0070686_100045827
351 Ga0070695_100201463
352 Ga0070696_100055390
353 Ga0070665_100191757
354 Ga0070704_100047398
355 Ga0068855_100062542
356 Ga0070664_100192373
357 Ga0068857_100130781
358 Ga0068854_100053335
359 Ga0068856_100034335
360 Ga0068859_100160810
361 Ga0068859_100239118
362 Ga0068864_100003141
363 Ga0068866_10025675
364 Ga0068861_100020433
365 Ga0068863_100046453
366 Ga0068863_100142959
367 Ga0068860_100059670
368 Ga0068860_100066799
369 Ga0068860_100118549
370 Ga0081455_10008733
371 Ga0081455_10051001
372 Ga0081539_10054142
373 Ga0070716_100097961
374 Ga0097621_100013447
375 Ga0097621_100050268
376 Ga0097621_100052332
377 Ga0097621_100164097
378 Ga0068871_100091099
379 Ga0075434_100036241
380 Ga0075434_100042105
381 Ga0075434_100066146
382 Ga0075429_100036513
383 Ga0075429_100332537
384 Ga0075436_100014955
385 Ga0075436_100017746
386 Ga0075436_100035607
387 Ga0075436_100062393
388 Ga0075436_100154968
389 Ga0097620_100160810
390 Ga0097620_100239116
391 Ga0075435_100012125
392 Ga0075435_100022429
393 Ga0075435_100054130
394 Ga0075435_100168518
395 Ga0105240_10038904
396 Ga0105240_10126082
397 Ga0105240_10140243
398 Ga0105240_10199549
399 Ga0111539_10001119
400 Ga0111539_10022288
401 Ga0111539_10102355
402 Ga0105247_10058080
403 Ga0114129_10000997
404 Ga0114129_10001174
405 Ga0114129_10002196
406 Ga0114129_10020638
407 Ga0114129_10028205
408 Ga0114129_10100890
409 Ga0114129_10147813
410 Ga0114129_10152236
411 Ga0114129_10163650
412 Ga0114129_10200542
413 Ga0105243_10261268
414 Ga0105242_10049668
415 Ga0105242_10176892
416 Ga0105248_10063544
417 Ga0105248_10089368
418 Ga0105248_10104758
419 Ga0105248_10137252
420 Ga0105248_10193587
421 Ga0105248_10526852
422 Ga0105238_10247912
423 Ga0105238_10437393
424 Ga0105249_10168267
425 Ga0105249_10223449
426 Ga0105246_10133109
427 Ga0105246_10204805
428 Ga0157374_10205842
429 Ga0163162_10088655
430 Ga0163162_10320460
431 Ga0157375_10126428
432 Ga0157375_10157679
433 Ga0157375_10370992
434 Ga0163163_10008939
435 Ga0163163_10144001
436 Ga0157380_10323297
437 Ga0157377_10040317
438 Ga0157379_10049036
439 Ga0157379_10169706
440 Ga0157376_10075114
441 Ga0157376_10078409
442 Ga0207682_10027555
443 Ga0207642_10067500
444 Ga0207680_10001435
445 Ga0207699_10009440
446 Ga0207645_10066980
447 Ga0207707_10018304
448 Ga0207707_10019710
449 Ga0207707_10142632
450 Ga0207695_10081851
451 Ga0207695_10096856
452 Ga0207663_10210593
453 Ga0207662_10087439
454 Ga0207657_10026903
455 Ga0207657_10089866
456 Ga0207652_10024227
457 Ga0207646_10071767
458 Ga0207681_10088786
459 Ga0207650_10173262
460 Ga0207659_10000072
461 Ga0207659_10080691
462 Ga0207687_10037910
463 Ga0207700_10003372
464 Ga0207706_10165776
465 Ga0207686_10021800
466 Ga0207704_10006608
467 Ga0207665_10065293
468 Ga0207691_10070884
469 Ga0207711_10045170
470 Ga0207711_10049132
471 Ga0207711_10081839
472 Ga0207689_10084733
473 Ga0207689_10210350
474 Ga0207667_10118977
475 Ga0207651_10021719
476 Ga0207640_10013629
477 Ga0207640_10042120
478 Ga0207658_10126475
479 Ga0207658_10178035
480 Ga0207677_10126676
481 Ga0207703_10037916
482 Ga0207703_10305979
483 Ga0207639_10055270
484 Ga0207702_10089686
485 Ga0207641_10023804
486 Ga0207641_10098357
487 Ga0207648_10005751
488 Ga0207676_10003454
489 Ga0207676_10239432
490 Ga0207675_100135884
491 Ga0207683_10007672
492 Ga0207683_10069605
493 Ga0209974_10022136
494 Ga0207428_10010807
495 Ga0268266_10014019
496 Ga0268266_10228222
497 Ga0268264_10052338
498 Ga0268264_10053894
499 Ga0307416_100167118
500 Ga0373930_0000409
501 Ga0373948_0000409
502 Ga0373958_0009176
503 Ga0373959_0002290
504 Ga0373938_0001602
505 Ga0373928_0000693
506 Ga0373929_0000500
507 Ga0373934_0055013
508 Ga0373940_0000710
509 Ga0373949_0001026
510 Ga0373951_0000835
511 Ga0373952_0000580
512 Ga0373939_0000222
513 Ga0373941_0002079
514 Ga0373945_0022582
515 Ga0373953_0078737
516 Ga0373960_0000140
517 Ga0373943_0015996
518 Ga0373946_0005179
519 Ga0373955_0109349
520 Ga0373955_0189377
521 Ga0373942_0001703
522 Ga0373961_0000977
523 Ga0373962_0039807
524 Ga0373931_0000392
525 Ga0373935_0012630
526 Ga0373947_0072465
527 Ga0373937_0041778
528 Ga0373937_0213228
529 Ga0373937_0455293
530 Ga0373925_0055885
531 Ga0439433_0003945
532 Ga0439450_023005
533 Ga0451576_0004093
534 Ga0451576_0083419
535 Ga0495582_0094548
536 Ga0495640_0218805
537 Ga0495586_0111645
538 Ga0495587_0110792
539 Ga0495645_0007405
540 Ga0495634_0024322
541 Ga0495647_0039026
542 Ga0495669_0002827
543 Ga0495613_0249251
544 Ga0495604_0083607
545 Ga0495604_0186279
546 Ga0495684_0043687
547 Ga0496100_0069520
548 Ga0496100_0218762
549 Ga0496101_0001911
550 Ga0496102_0056429
551 Ga0496102_0190371
552 Ga0496103_0111536
553 Ga0496104_0020531
554 Ga0496104_0131196
555 Ga0496107_0025813
556 Ga0496109_0106740
557 Ga0496112_0035661
558 Ga0496114_0000613
559 Ga0496114_0408516
560 Ga0501034_0005914
561 Ga0501042_0314742
562 Ga0501043_0171204
563 Ga0501047_0001540
564 Ga0501047_0220320
565 Ga0501076_0184828
566 Ga0501083_0152065
567 Ga0501044_0036519
568 nmdc:mga05p37_1000_c1
569 nmdc:mga05p37_120531_c1
570 nmdc:mga05p37_184035_c1
571 nmdc:mga05p37_22470_c1
572 nmdc:mga05p37_24195_c1
573 nmdc:mga05p37_25634_c1
574 nmdc:mga05p37_428360_c1
575 nmdc:mga05p37_8828_c1
576 nmdc:mga05p37_91344_c1
577 nmdc:mga09592_23788_c1
578 nmdc:mga08y16_168841_c1
579 nmdc:mga08y16_191800_c1
580 nmdc:mga08y16_51177_c1
581 nmdc:mga08y16_56865_c1
582 nmdc:mga0n895_11_c1
583 nmdc:mga0n895_182320_c1
584 nmdc:mga0n895_5137_c1
585 nmdc:mga0n895_8220_c1
586 nmdc:mga0rr50_123817_c1
587 nmdc:mga0rr50_1622_c1
588 nmdc:mga0rr50_19_c1
589 nmdc:mga0rr50_202680_c1
590 nmdc:mga0rr50_8433_c1
591 nmdc:mga08x19_10189_c1
592 nmdc:mga08x19_39167_c1
593 nmdc:mga08x19_43795_c1
594 nmdc:mga08x19_48082_c1
595 nmdc:mga08x19_58632_c1
596 nmdc:mga0a205_38695_c1
597 nmdc:mga0a205_56101_c1
598 Ga0495601_0014122
599 Ga0495601_0068813
600 Ga0495619_0043004
601 Ga0495619_0070760
602 Ga0495619_0197533
603 Ga0590075_023028
604 Ga0501082_0090549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

119

183

0.96

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

227

347

0.88

Map