F396135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 154 | 300 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300048914|Ga0496111_0017833|Ga0496111_0017833_3885_4880 |
| Length | 319 |
| Sequence | LEPIQNQGNLNCRERCYYQNQKDRISHRINLPDLKKEINPDKSGFLIMGDYIKVEFEHLNIEQKEIIIALLAEMNYDGFEENDDVLKAFIPSNIYDENKLKALSKDRKLFFSVSKLENKNWINHSIXHTPWVAIRAAFHESISDIKYELIITPKMSFGTGHHATTSMMIKMMSELDFSGKTVLDFGTGTGILAILAEKLGASKIVAIDNDDQSIKNAGENLGSNDCSKIRLLQGSTANVDIKFDIILANIIKGVILDNLAAFTKEMVTDGVILLSGLLADDEREVMEKATGYNLILNKKIEDKNWICLQMTYKSSSFRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 116 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 117 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 120 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 121 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 122 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 141 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 143 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 144 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 147 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 148 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 149 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 150 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 151 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 152 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 153 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 154 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.65 |
| Nodule | 0 |
| Rhizoplane | 0.33 |
| Rhizosphere | 89.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10125848 | 3300003316 | Bacteria | 3347 |
| 2 | rootH2_10168450 | 3300003320 | Bacteria | 1176 |
| 3 | rootH2_10197471 | 3300003320 | Bacteria | 2933 |
| 4 | rootL2_10097124 | 3300003322 | Unclassified | 2320 |
| 5 | rootL2_10140161 | 3300003322 | Bacteria | 1817 |
| 6 | rootL2_10277332 | 3300003322 | Bacteria | 1204 |
| 7 | rootH1_10277108 | 3300003323 | Bacteria | 1871 |
| 8 | JGI25160J50197_1003110 | 3300003354 | Bacteria | 7555 |
| 9 | Ga0070683_100000329 | 3300005329 | Bacteria | 32745 |
| 10 | Ga0070683_100081163 | 3300005329 | Bacteria | 3036 |
| 11 | Ga0070670_100053200 | 3300005331 | Bacteria | 3477 |
| 12 | Ga0070670_100150728 | 3300005331 | Bacteria | 2012 |
| 13 | Ga0068869_100024126 | 3300005334 | Bacteria | 4211 |
| 14 | Ga0068869_100031526 | 3300005334 | Bacteria | 3729 |
| 15 | Ga0068869_100055895 | 3300005334 | Bacteria | 2877 |
| 16 | Ga0070666_10000043 | 3300005335 | Bacteria | 111402 |
| 17 | Ga0070666_10031370 | 3300005335 | Bacteria | 3508 |
| 18 | Ga0068868_100022584 | 3300005338 | Bacteria | 4750 |
| 19 | Ga0070691_10007717 | 3300005341 | Bacteria | 4928 |
| 20 | Ga0070661_100004831 | 3300005344 | Bacteria | 9277 |
| 21 | Ga0070668_100275096 | 3300005347 | Unclassified | 1405 |
| 22 | Ga0070669_100278882 | 3300005353 | Bacteria | 1339 |
| 23 | Ga0070675_100313413 | 3300005354 | Bacteria | 1385 |
| 24 | Ga0070688_100345312 | 3300005365 | Unclassified | 1088 |
| 25 | Ga0070667_100028595 | 3300005367 | Bacteria | 4642 |
| 26 | Ga0070678_100034523 | 3300005456 | Bacteria | 3524 |
| 27 | Ga0070662_100039341 | 3300005457 | Bacteria | 3362 |
| 28 | Ga0070662_100041094 | 3300005457 | Bacteria | 3297 |
| 29 | Ga0070662_100047930 | 3300005457 | Unclassified | 3076 |
| 30 | Ga0068867_100068162 | 3300005459 | Bacteria | 2655 |
| 31 | Ga0070685_10071691 | 3300005466 | Bacteria | 2054 |
| 32 | Ga0070684_100000768 | 3300005535 | Bacteria | 22215 |
| 33 | Ga0070684_100001060 | 3300005535 | Bacteria | 19661 |
| 34 | Ga0070684_100453788 | 3300005535 | Bacteria | 1185 |
| 35 | Ga0068853_100000520 | 3300005539 | Bacteria | 26128 |
| 36 | Ga0068853_100059557 | 3300005539 | Bacteria | 3299 |
| 37 | Ga0068853_100074904 | 3300005539 | Bacteria | 2954 |
| 38 | Ga0068853_100090645 | 3300005539 | Bacteria | 2687 |
| 39 | Ga0068853_100238521 | 3300005539 | Bacteria | 1666 |
| 40 | Ga0070686_100142662 | 3300005544 | Unclassified | 1669 |
| 41 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 42 | Ga0070665_100263449 | 3300005548 | Bacteria | 1725 |
| 43 | Ga0068855_100174465 | 3300005563 | Unclassified | 2433 |
| 44 | Ga0070664_100007325 | 3300005564 | Bacteria | 8896 |
| 45 | Ga0070664_100279457 | 3300005564 | Bacteria | 1505 |
| 46 | Ga0070664_100386011 | 3300005564 | Bacteria | 1279 |
| 47 | Ga0068857_100008614 | 3300005577 | Bacteria | 8827 |
| 48 | Ga0068857_100032917 | 3300005577 | Bacteria | 4583 |
| 49 | Ga0068857_100132177 | 3300005577 | Bacteria | 2251 |
| 50 | Ga0068857_100357987 | 3300005577 | Bacteria | 1352 |
| 51 | Ga0068854_100003899 | 3300005578 | Bacteria | 9349 |
| 52 | Ga0068854_100043746 | 3300005578 | Bacteria | 3176 |
| 53 | Ga0068854_100390590 | 3300005578 | Bacteria | 1149 |
| 54 | Ga0068856_100113099 | 3300005614 | Bacteria | 2713 |
| 55 | Ga0068856_100360980 | 3300005614 | Bacteria | 1471 |
| 56 | Ga0068852_100003948 | 3300005616 | Bacteria | 10424 |
| 57 | Ga0068852_100358506 | 3300005616 | Bacteria | 1426 |
| 58 | Ga0068852_100426275 | 3300005616 | Bacteria | 1309 |
| 59 | Ga0068859_100000012 | 3300005617 | Bacteria | 300376 |
| 60 | Ga0068859_100016918 | 3300005617 | Bacteria | 7320 |
| 61 | Ga0068859_100180962 | 3300005617 | Bacteria | 2191 |
| 62 | Ga0068864_100010946 | 3300005618 | Bacteria | 7499 |
| 63 | Ga0068864_100030323 | 3300005618 | Bacteria | 4583 |
| 64 | Ga0068864_100064925 | 3300005618 | Bacteria | 3167 |
| 65 | Ga0068864_100083935 | 3300005618 | Bacteria | 2798 |
| 66 | Ga0068866_10190177 | 3300005718 | Bacteria | 1219 |
| 67 | Ga0068863_100025383 | 3300005841 | Bacteria | 5650 |
| 68 | Ga0068858_100001362 | 3300005842 | Bacteria | 25148 |
| 69 | Ga0068858_100047034 | 3300005842 | Bacteria | 4001 |
| 70 | Ga0068860_100000026 | 3300005843 | Bacteria | 270483 |
| 71 | Ga0068860_100002209 | 3300005843 | Bacteria | 20481 |
| 72 | Ga0068860_100010129 | 3300005843 | Bacteria | 9342 |
| 73 | Ga0068860_100072785 | 3300005843 | Bacteria | 3267 |
| 74 | Ga0081539_10029290 | 3300005985 | Bacteria | 3442 |
| 75 | Ga0081539_10053064 | 3300005985 | Bacteria | 2272 |
| 76 | Ga0070715_10006819 | 3300006163 | Bacteria | 3899 |
| 77 | Ga0075366_10069948 | 3300006195 | Bacteria | 2089 |
| 78 | Ga0075366_10076952 | 3300006195 | Bacteria | 1991 |
| 79 | Ga0097621_100085134 | 3300006237 | Bacteria | 2636 |
| 80 | Ga0097621_100194998 | 3300006237 | Bacteria | 1756 |
| 81 | Ga0097621_100225857 | 3300006237 | Bacteria | 1633 |
| 82 | Ga0097621_100404986 | 3300006237 | Bacteria | 1222 |
| 83 | Ga0068871_100112386 | 3300006358 | Bacteria | 2292 |
| 84 | Ga0097620_100000012 | 3300006931 | Bacteria | 300376 |
| 85 | Ga0097620_100016919 | 3300006931 | Bacteria | 7320 |
| 86 | Ga0097620_100180977 | 3300006931 | Bacteria | 2191 |
| 87 | Ga0105240_10000258 | 3300009093 | Bacteria | 105011 |
| 88 | Ga0105240_10004553 | 3300009093 | Bacteria | 21043 |
| 89 | Ga0105240_10004621 | 3300009093 | Bacteria | 20878 |
| 90 | Ga0105240_10039801 | 3300009093 | Bacteria | 6017 |
| 91 | Ga0105240_10054842 | 3300009093 | Bacteria | 4993 |
| 92 | Ga0105240_10060026 | 3300009093 | Bacteria | 4742 |
| 93 | Ga0105245_10410015 | 3300009098 | Bacteria | 1356 |
| 94 | Ga0105247_10001409 | 3300009101 | Bacteria | 17436 |
| 95 | Ga0105247_10234417 | 3300009101 | Bacteria | 1248 |
| 96 | Ga0105241_10000533 | 3300009174 | Bacteria | 28600 |
| 97 | Ga0105241_10000721 | 3300009174 | Bacteria | 25017 |
| 98 | Ga0105241_10204702 | 3300009174 | Bacteria | 1650 |
| 99 | Ga0105241_10546049 | 3300009174 | Bacteria | 1040 |
| 100 | Ga0105237_10000654 | 3300009545 | Bacteria | 48395 |
| 101 | Ga0105237_10005490 | 3300009545 | Bacteria | 14294 |
| 102 | Ga0105237_10005694 | 3300009545 | Bacteria | 14017 |
| 103 | Ga0105237_10022472 | 3300009545 | Bacteria | 6471 |
| 104 | Ga0105237_10064862 | 3300009545 | Bacteria | 3648 |
| 105 | Ga0105237_10126957 | 3300009545 | Unclassified | 2545 |
| 106 | Ga0105238_10006981 | 3300009551 | Bacteria | 11286 |
| 107 | Ga0105238_10078160 | 3300009551 | Bacteria | 3300 |
| 108 | Ga0105249_10001958 | 3300009553 | Bacteria | 17861 |
| 109 | Ga0105249_10041170 | 3300009553 | Bacteria | 4198 |
| 110 | Ga0105249_10114738 | 3300009553 | Bacteria | 2551 |
| 111 | Ga0105249_10330591 | 3300009553 | Bacteria | 1538 |
| 112 | Ga0105239_10001037 | 3300010375 | Bacteria | 38729 |
| 113 | Ga0105239_10011083 | 3300010375 | Bacteria | 10062 |
| 114 | Ga0105239_10017966 | 3300010375 | Bacteria | 7820 |
| 115 | Ga0105239_10043883 | 3300010375 | Bacteria | 4903 |
| 116 | Ga0105239_10127719 | 3300010375 | Bacteria | 2826 |
| 117 | Ga0105239_10179998 | 3300010375 | Bacteria | 2365 |
| 118 | Ga0157373_10110592 | 3300013100 | Unclassified | 1932 |
| 119 | Ga0157373_10111730 | 3300013100 | Unclassified | 1921 |
| 120 | Ga0157371_10011331 | 3300013102 | Bacteria | 6878 |
| 121 | Ga0157371_10137041 | 3300013102 | Bacteria | 1743 |
| 122 | Ga0157371_10189740 | 3300013102 | Bacteria | 1471 |
| 123 | Ga0157370_10005886 | 3300013104 | Bacteria | 13672 |
| 124 | Ga0157369_10059170 | 3300013105 | Bacteria | 4132 |
| 125 | Ga0157374_10006478 | 3300013296 | Bacteria | 9936 |
| 126 | Ga0157374_10015281 | 3300013296 | Bacteria | 6732 |
| 127 | Ga0157374_10098848 | 3300013296 | Bacteria | 2794 |
| 128 | Ga0157374_10154491 | 3300013296 | Bacteria | 2232 |
| 129 | Ga0157378_10023595 | 3300013297 | Bacteria | 5411 |
| 130 | Ga0163162_10000279 | 3300013306 | Bacteria | 46872 |
| 131 | Ga0163162_10004205 | 3300013306 | Bacteria | 13837 |
| 132 | Ga0163162_10006285 | 3300013306 | Bacteria | 11505 |
| 133 | Ga0163162_10038399 | 3300013306 | Bacteria | 4778 |
| 134 | Ga0163162_10163930 | 3300013306 | Bacteria | 2346 |
| 135 | Ga0157372_10002704 | 3300013307 | Bacteria | 19172 |
| 136 | Ga0157372_10010252 | 3300013307 | Bacteria | 9953 |
| 137 | Ga0157372_10199261 | 3300013307 | Bacteria | 2319 |
| 138 | Ga0157372_10356888 | 3300013307 | Bacteria | 1703 |
| 139 | Ga0157372_10398541 | 3300013307 | Unclassified | 1604 |
| 140 | Ga0157375_10039491 | 3300013308 | Bacteria | 4543 |
| 141 | Ga0157375_10064756 | 3300013308 | Bacteria | 3641 |
| 142 | Ga0157375_10449600 | 3300013308 | Bacteria | 1454 |
| 143 | Ga0157375_10501896 | 3300013308 | Bacteria | 1377 |
| 144 | Ga0163163_10002122 | 3300014325 | Bacteria | 16737 |
| 145 | Ga0163163_10009925 | 3300014325 | Bacteria | 8537 |
| 146 | Ga0163163_10020274 | 3300014325 | Bacteria | 6258 |
| 147 | Ga0163163_10456616 | 3300014325 | Bacteria | 1338 |
| 148 | Ga0157377_10057265 | 3300014745 | Unclassified | 2215 |
| 149 | Ga0157377_10147275 | 3300014745 | Bacteria | 1453 |
| 150 | Ga0157379_10123471 | 3300014968 | Bacteria | 2330 |
| 151 | Ga0157379_10132198 | 3300014968 | Bacteria | 2246 |
| 152 | Ga0157379_10246416 | 3300014968 | Bacteria | 1621 |
| 153 | Ga0157376_10004908 | 3300014969 | Bacteria | 9323 |
| 154 | Ga0157376_10007359 | 3300014969 | Bacteria | 7849 |
| 155 | Ga0157376_10453389 | 3300014969 | Unclassified | 1252 |
| 156 | Ga0163161_10048384 | 3300017792 | Bacteria | 3070 |
| 157 | Ga0163161_10058903 | 3300017792 | Bacteria | 2792 |
| 158 | Ga0163161_10104760 | 3300017792 | Bacteria | 2109 |
| 159 | Ga0207426_1000052 | 3300025302 | Bacteria | 389825 |
| 160 | Ga0207642_10212280 | 3300025899 | Bacteria | 1076 |
| 161 | Ga0207680_10000371 | 3300025903 | Bacteria | 21501 |
| 162 | Ga0207647_10004784 | 3300025904 | Bacteria | 10024 |
| 163 | Ga0207647_10019112 | 3300025904 | Bacteria | 4613 |
| 164 | Ga0207647_10076717 | 3300025904 | Bacteria | 2010 |
| 165 | Ga0207685_10010434 | 3300025905 | Bacteria | 2743 |
| 166 | Ga0207645_10017285 | 3300025907 | Unclassified | 4765 |
| 167 | Ga0207654_10001646 | 3300025911 | Bacteria | 11680 |
| 168 | Ga0207654_10025628 | 3300025911 | Bacteria | 3183 |
| 169 | Ga0207654_10121429 | 3300025911 | Bacteria | 1641 |
| 170 | Ga0207695_10000486 | 3300025913 | Bacteria | 84856 |
| 171 | Ga0207695_10003818 | 3300025913 | Bacteria | 20882 |
| 172 | Ga0207695_10008726 | 3300025913 | Bacteria | 12639 |
| 173 | Ga0207695_10038067 | 3300025913 | Bacteria | 5184 |
| 174 | Ga0207695_10152595 | 3300025913 | Unclassified | 2248 |
| 175 | Ga0207695_10182706 | 3300025913 | Bacteria | 2018 |
| 176 | Ga0207671_10001742 | 3300025914 | Bacteria | 24460 |
| 177 | Ga0207671_10003349 | 3300025914 | Bacteria | 16082 |
| 178 | Ga0207671_10004018 | 3300025914 | Bacteria | 14291 |
| 179 | Ga0207671_10006632 | 3300025914 | Bacteria | 10262 |
| 180 | Ga0207671_10344928 | 3300025914 | Unclassified | 1180 |
| 181 | Ga0207657_10209074 | 3300025919 | Bacteria | 1567 |
| 182 | Ga0207657_10283833 | 3300025919 | Bacteria | 1314 |
| 183 | Ga0207649_10006464 | 3300025920 | Bacteria | 6364 |
| 184 | Ga0207650_10134753 | 3300025925 | Bacteria | 1936 |
| 185 | Ga0207659_10508575 | 3300025926 | Bacteria | 1020 |
| 186 | Ga0207644_10340004 | 3300025931 | Bacteria | 1217 |
| 187 | Ga0207690_10084126 | 3300025932 | Bacteria | 2229 |
| 188 | Ga0207706_10003803 | 3300025933 | Bacteria | 14383 |
| 189 | Ga0207706_10023224 | 3300025933 | Bacteria | 5570 |
| 190 | Ga0207706_10031025 | 3300025933 | Bacteria | 4763 |
| 191 | Ga0207670_10012704 | 3300025936 | Bacteria | 4936 |
| 192 | Ga0207691_10012396 | 3300025940 | Bacteria | 8172 |
| 193 | Ga0207689_10000329 | 3300025942 | Bacteria | 44014 |
| 194 | Ga0207689_10010393 | 3300025942 | Bacteria | 8016 |
| 195 | Ga0207689_10021416 | 3300025942 | Bacteria | 5435 |
| 196 | Ga0207689_10044691 | 3300025942 | Bacteria | 3663 |
| 197 | Ga0207661_10020712 | 3300025944 | Bacteria | 4920 |
| 198 | Ga0207661_10043012 | 3300025944 | Bacteria | 3564 |
| 199 | Ga0207661_10370528 | 3300025944 | Bacteria | 1295 |
| 200 | Ga0207679_10000751 | 3300025945 | Bacteria | 21527 |
| 201 | Ga0207679_10001121 | 3300025945 | Bacteria | 17095 |
| 202 | Ga0207667_10009409 | 3300025949 | Bacteria | 11510 |
| 203 | Ga0207667_10061201 | 3300025949 | Bacteria | 3939 |
| 204 | Ga0207651_10399085 | 3300025960 | Bacteria | 1169 |
| 205 | Ga0207651_10455062 | 3300025960 | Unclassified | 1099 |
| 206 | Ga0207651_10483931 | 3300025960 | Bacteria | 1067 |
| 207 | Ga0207712_10001475 | 3300025961 | Bacteria | 16057 |
| 208 | Ga0207712_10012015 | 3300025961 | Bacteria | 5526 |
| 209 | Ga0207712_10211933 | 3300025961 | Bacteria | 1543 |
| 210 | Ga0207668_10219684 | 3300025972 | Unclassified | 1525 |
| 211 | Ga0207640_10017218 | 3300025981 | Bacteria | 4223 |
| 212 | Ga0207640_10081591 | 3300025981 | Bacteria | 2212 |
| 213 | Ga0207658_10051028 | 3300025986 | Bacteria | 3047 |
| 214 | Ga0207677_10007895 | 3300026023 | Bacteria | 5915 |
| 215 | Ga0207677_10481829 | 3300026023 | Unclassified | 1069 |
| 216 | Ga0207703_10002961 | 3300026035 | Bacteria | 14396 |
| 217 | Ga0207639_10019883 | 3300026041 | Bacteria | 4798 |
| 218 | Ga0207639_10026659 | 3300026041 | Bacteria | 4200 |
| 219 | Ga0207678_10078813 | 3300026067 | Bacteria | 2821 |
| 220 | Ga0207641_10000152 | 3300026088 | Bacteria | 98311 |
| 221 | Ga0207641_10051955 | 3300026088 | Bacteria | 3470 |
| 222 | Ga0207648_10108632 | 3300026089 | Bacteria | 2435 |
| 223 | Ga0207648_10218055 | 3300026089 | Unclassified | 1695 |
| 224 | Ga0207676_10013981 | 3300026095 | Bacteria | 5762 |
| 225 | Ga0207676_10053123 | 3300026095 | Bacteria | 3170 |
| 226 | Ga0207676_10062678 | 3300026095 | Bacteria | 2950 |
| 227 | Ga0207676_10163905 | 3300026095 | Bacteria | 1929 |
| 228 | Ga0207674_10006492 | 3300026116 | Bacteria | 13755 |
| 229 | Ga0207674_10012911 | 3300026116 | Bacteria | 9316 |
| 230 | Ga0207674_10030052 | 3300026116 | Bacteria | 5715 |
| 231 | Ga0207675_100082906 | 3300026118 | Bacteria | 3007 |
| 232 | Ga0207683_10031869 | 3300026121 | Bacteria | 4577 |
| 233 | Ga0207698_10008700 | 3300026142 | Bacteria | 6434 |
| 234 | Ga0207698_10023196 | 3300026142 | Bacteria | 4330 |
| 235 | Ga0207698_10049762 | 3300026142 | Bacteria | 3192 |
| 236 | Ga0207698_10309727 | 3300026142 | Bacteria | 1474 |
| 237 | Ga0268266_10000034 | 3300028379 | Bacteria | 354251 |
| 238 | Ga0268266_10300190 | 3300028379 | Bacteria | 1498 |
| 239 | Ga0268264_10000117 | 3300028381 | Bacteria | 195037 |
| 240 | Ga0268264_10024882 | 3300028381 | Bacteria | 4892 |
| 241 | Ga0268264_10090261 | 3300028381 | Bacteria | 2640 |
| 242 | Ga0268264_10103812 | 3300028381 | Unclassified | 2476 |
| 243 | Ga0307517_10108469 | 3300028786 | Bacteria | 2131 |
| 244 | Ga0265327_10000196 | 3300031251 | Bacteria | 127325 |
| 245 | Ga0265327_10043802 | 3300031251 | Bacteria | 2391 |
| 246 | Ga0307508_10000937 | 3300031616 | Bacteria | 33974 |
| 247 | Ga0307510_10000191 | 3300033180 | Bacteria | 53108 |
| 248 | Ga0373927_0084001 | 3300035695 | Bacteria | 2065 |
| 249 | Ga0395900_0578914 | 3300037418 | Unclassified | 1065 |
| 250 | Ga0395898_0084334 | 3300037466 | Bacteria | 3063 |
| 251 | Ga0395901_0105083 | 3300038443 | Bacteria | 2964 |
| 252 | Ga0400489_24444 | 3300039093 | Bacteria | 5765 |
| 253 | Ga0439436_0000773 | 3300041404 | Bacteria | 8667 |
| 254 | Ga0439465_0013898 | 3300041413 | Bacteria | 2507 |
| 255 | Ga0451853_2746119 | 3300041512 | Bacteria | 1676 |
| 256 | Ga0439449_0131099 | 3300042007 | Bacteria | 932 |
| 257 | Ga0439457_000175 | 3300042014 | Bacteria | 16689 |
| 258 | Ga0439457_020754 | 3300042014 | Bacteria | 1457 |
| 259 | Ga0439462_0036364 | 3300042015 | Bacteria | 1310 |
| 260 | Ga0466972_0000782 | 3300044658 | Bacteria | 15085 |
| 261 | Ga0453684_0038732 | 3300044712 | Bacteria | 6509 |
| 262 | Ga0453684_0814383 | 3300044712 | Bacteria | 1006 |
| 263 | Ga0466957_0010988 | 3300044842 | Bacteria | 5208 |
| 264 | Ga0495592_0125910 | 3300046454 | Bacteria | 1798 |
| 265 | Ga0495638_0072586 | 3300046460 | Unclassified | 2103 |
| 266 | Ga0495653_0078610 | 3300046463 | Bacteria | 2446 |
| 267 | Ga0495608_0156085 | 3300046511 | Bacteria | 1453 |
| 268 | Ga0495630_0019380 | 3300046517 | Bacteria | 5000 |
| 269 | Ga0495648_0002156 | 3300046524 | Bacteria | 18542 |
| 270 | Ga0495587_0097319 | 3300046536 | Bacteria | 1697 |
| 271 | Ga0495668_0001368 | 3300046616 | Bacteria | 23908 |
| 272 | Ga0495611_0000358 | 3300046648 | Bacteria | 29739 |
| 273 | Ga0495611_0095110 | 3300046648 | Unclassified | 1379 |
| 274 | Ga0495625_0275681 | 3300046660 | Bacteria | 1084 |
| 275 | Ga0495657_0025035 | 3300046675 | Bacteria | 4241 |
| 276 | Ga0495649_0070579 | 3300046694 | Bacteria | 1873 |
| 277 | Ga0495604_0130662 | 3300047317 | Bacteria | 1806 |
| 278 | Ga0495687_000079 | 3300047443 | Bacteria | 147704 |
| 279 | Ga0495686_0000041 | 3300047472 | Bacteria | 297599 |
| 280 | Ga0495686_0249040 | 3300047472 | Bacteria | 999 |
| 281 | Ga0496111_0017833 | 3300048914 | Unclassified | 4910 |
| 282 | Ga0501047_0237673 | 3300049581 | Bacteria | 1673 |
| 283 | Ga0501047_0316072 | 3300049581 | Bacteria | 1402 |
| 284 | Ga0501257_032622 | 3300049686 | Bacteria | 1260 |
| 285 | Ga0501225_0002625 | 3300049705 | Bacteria | 5520 |
| 286 | Ga0501044_0006672 | 3300049823 | Bacteria | 12724 |
| 287 | Ga0495619_0061916 | 3300053085 | Bacteria | 2491 |
| 288 | Ga0500578_0000017 | 3300053086 | Bacteria | 178494 |
| 289 | Ga0500578_0031997 | 3300053086 | Bacteria | 3382 |
| 290 | Ga0500646_0047096 | 3300053090 | Bacteria | 1232 |
| 291 | Ga0500650_0006567 | 3300053098 | Bacteria | 4454 |
| 292 | Ga0500555_010394 | 3300053103 | Bacteria | 2668 |
| 293 | Ga0500556_0087245 | 3300053104 | Bacteria | 1187 |
| 294 | Ga0500642_0022129 | 3300053130 | Bacteria | 2530 |
| 295 | Ga0500588_0004743 | 3300053146 | Bacteria | 2965 |
| 296 | Ga0500588_0044468 | 3300053146 | Bacteria | 1355 |
| 297 | Ga0500588_0060549 | 3300053146 | Unclassified | 1212 |
| 298 | Ga0500622_0001151 | 3300053156 | Bacteria | 22018 |
| 299 | Ga0500611_000018 | 3300053727 | Bacteria | 111023 |
| 300 | Ga0500611_020008 | 3300053727 | Bacteria | 1257 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100082906 | Ga0207675_1000829062 | 237 |
| 2 | 3300005539 | Ga0068853_100090645 | Ga0068853_1000906452 | 242 |
| 3 | 3300046454 | Ga0495592_0125910 | Ga0495592_0125910_325_1185 | 245 |
| 4 | 3300046463 | Ga0495653_0078610 | Ga0495653_0078610_355_1215 | 245 |
| 5 | 3300047317 | Ga0495604_0130662 | Ga0495604_0130662_291_1151 | 245 |
| 6 | 3300046536 | Ga0495587_0097319 | Ga0495587_0097319_825_1685 | 248 |
| 7 | 3300046616 | Ga0495668_0001368 | Ga0495668_0001368_19975_20808 | 249 |
| 8 | 3300006195 | Ga0075366_10069948 | Ga0075366_100699482 | 254 |
| 9 | 3300005329 | Ga0070683_100081163 | Ga0070683_1000811633 | 257 |
| 10 | 3300005334 | Ga0068869_100024126 | Ga0068869_1000241262 | 257 |
| 11 | 3300005457 | Ga0070662_100047930 | Ga0070662_1000479302 | 257 |
| 12 | 3300005535 | Ga0070684_100001060 | Ga0070684_10000106018 | 257 |
| 13 | 3300005564 | Ga0070664_100279457 | Ga0070664_1002794572 | 257 |
| 14 | 3300005577 | Ga0068857_100132177 | Ga0068857_1001321772 | 257 |
| 15 | 3300005618 | Ga0068864_100010946 | Ga0068864_1000109466 | 257 |
| 16 | 3300013296 | Ga0157374_10006478 | Ga0157374_100064788 | 257 |
| 17 | 3300013308 | Ga0157375_10501896 | Ga0157375_105018962 | 257 |
| 18 | 3300014325 | Ga0163163_10009925 | Ga0163163_100099256 | 257 |
| 19 | 3300014745 | Ga0157377_10057265 | Ga0157377_100572652 | 257 |
| 20 | 3300014968 | Ga0157379_10132198 | Ga0157379_101321983 | 257 |
| 21 | 3300025920 | Ga0207649_10006464 | Ga0207649_100064645 | 257 |
| 22 | 3300025933 | Ga0207706_10023224 | Ga0207706_100232241 | 257 |
| 23 | 3300025936 | Ga0207670_10012704 | Ga0207670_100127042 | 257 |
| 24 | 3300025940 | Ga0207691_10012396 | Ga0207691_100123964 | 257 |
| 25 | 3300025942 | Ga0207689_10010393 | Ga0207689_100103933 | 257 |
| 26 | 3300025944 | Ga0207661_10020712 | Ga0207661_100207125 | 257 |
| 27 | 3300025945 | Ga0207679_10001121 | Ga0207679_100011217 | 257 |
| 28 | 3300025960 | Ga0207651_10399085 | Ga0207651_103990851 | 257 |
| 29 | 3300025986 | Ga0207658_10051028 | Ga0207658_100510282 | 257 |
| 30 | 3300026095 | Ga0207676_10013981 | Ga0207676_100139813 | 257 |
| 31 | 3300026116 | Ga0207674_10030052 | Ga0207674_100300522 | 257 |
| 32 | 3300048914 | Ga0496111_0017833 | Ga0496111_0017833_3885_4880 | 257 |
| 33 | 3300046694 | Ga0495649_0070579 | Ga0495649_0070579_495_1340 | 258 |
| 34 | 3300041404 | Ga0439436_0000773 | Ga0439436_0000773_754_1569 | 259 |
| 35 | 3300042014 | Ga0439457_000175 | Ga0439457_000175_15093_15908 | 259 |
| 36 | 3300042015 | Ga0439462_0036364 | Ga0439462_0036364_212_1027 | 259 |
| 37 | 3300005334 | Ga0068869_100031526 | Ga0068869_1000315263 | 262 |
| 38 | 3300005338 | Ga0068868_100022584 | Ga0068868_1000225842 | 262 |
| 39 | 3300005354 | Ga0070675_100313413 | Ga0070675_1003134131 | 262 |
| 40 | 3300005367 | Ga0070667_100028595 | Ga0070667_1000285953 | 262 |
| 41 | 3300005456 | Ga0070678_100034523 | Ga0070678_1000345232 | 262 |
| 42 | 3300005459 | Ga0068867_100068162 | Ga0068867_1000681621 | 262 |
| 43 | 3300006163 | Ga0070715_10006819 | Ga0070715_100068192 | 262 |
| 44 | 3300006237 | Ga0097621_100085134 | Ga0097621_1000851342 | 262 |
| 45 | 3300006358 | Ga0068871_100112386 | Ga0068871_1001123862 | 262 |
| 46 | 3300009174 | Ga0105241_10204702 | Ga0105241_102047022 | 262 |
| 47 | 3300010375 | Ga0105239_10179998 | Ga0105239_101799982 | 262 |
| 48 | 3300013102 | Ga0157371_10189740 | Ga0157371_101897401 | 262 |
| 49 | 3300013296 | Ga0157374_10015281 | Ga0157374_100152816 | 262 |
| 50 | 3300013306 | Ga0163162_10163930 | Ga0163162_101639302 | 262 |
| 51 | 3300013308 | Ga0157375_10039491 | Ga0157375_100394914 | 262 |
| 52 | 3300014968 | Ga0157379_10123471 | Ga0157379_101234712 | 262 |
| 53 | 3300014969 | Ga0157376_10007359 | Ga0157376_100073594 | 262 |
| 54 | 3300017792 | Ga0163161_10058903 | Ga0163161_100589032 | 262 |
| 55 | 3300025899 | Ga0207642_10212280 | Ga0207642_102122801 | 262 |
| 56 | 3300025905 | Ga0207685_10010434 | Ga0207685_100104343 | 262 |
| 57 | 3300025911 | Ga0207654_10121429 | Ga0207654_101214292 | 262 |
| 58 | 3300025931 | Ga0207644_10340004 | Ga0207644_103400042 | 262 |
| 59 | 3300025933 | Ga0207706_10003803 | Ga0207706_100038033 | 262 |
| 60 | 3300025942 | Ga0207689_10044691 | Ga0207689_100446912 | 262 |
| 61 | 3300026121 | Ga0207683_10031869 | Ga0207683_100318693 | 262 |
| 62 | 3300005341 | Ga0070691_10007717 | Ga0070691_100077174 | 263 |
| 63 | 3300005617 | Ga0068859_100180962 | Ga0068859_1001809622 | 263 |
| 64 | 3300006931 | Ga0097620_100180977 | Ga0097620_1001809772 | 263 |
| 65 | 3300046511 | Ga0495608_0156085 | Ga0495608_0156085_362_1222 | 263 |
| 66 | 3300046517 | Ga0495630_0019380 | Ga0495630_0019380_3499_4359 | 263 |
| 67 | 3300053085 | Ga0495619_0061916 | Ga0495619_0061916_731_1591 | 263 |
| 68 | 3300005334 | Ga0068869_100055895 | Ga0068869_1000558952 | 264 |
| 69 | 3300005353 | Ga0070669_100278882 | Ga0070669_1002788822 | 264 |
| 70 | 3300005457 | Ga0070662_100039341 | Ga0070662_1000393413 | 264 |
| 71 | 3300005578 | Ga0068854_100043746 | Ga0068854_1000437462 | 264 |
| 72 | 3300005718 | Ga0068866_10190177 | Ga0068866_101901772 | 264 |
| 73 | 3300013297 | Ga0157378_10023595 | Ga0157378_100235954 | 264 |
| 74 | 3300013306 | Ga0163162_10004205 | Ga0163162_1000420516 | 264 |
| 75 | 3300013308 | Ga0157375_10064756 | Ga0157375_100647562 | 264 |
| 76 | 3300017792 | Ga0163161_10104760 | Ga0163161_101047603 | 264 |
| 77 | 3300025907 | Ga0207645_10017285 | Ga0207645_100172856 | 264 |
| 78 | 3300025926 | Ga0207659_10508575 | Ga0207659_105085751 | 264 |
| 79 | 3300025942 | Ga0207689_10021416 | Ga0207689_100214163 | 264 |
| 80 | 3300025960 | Ga0207651_10483931 | Ga0207651_104839311 | 264 |
| 81 | 3300025981 | Ga0207640_10081591 | Ga0207640_100815912 | 264 |
| 82 | 3300026023 | Ga0207677_10007895 | Ga0207677_100078955 | 264 |
| 83 | 3300026089 | Ga0207648_10108632 | Ga0207648_101086322 | 264 |
| 84 | 3300005331 | Ga0070670_100150728 | Ga0070670_1001507281 | 265 |
| 85 | 3300013102 | Ga0157371_10011331 | Ga0157371_100113313 | 265 |
| 86 | 3300013307 | Ga0157372_10010252 | Ga0157372_1001025210 | 265 |
| 87 | 3300014325 | Ga0163163_10002122 | Ga0163163_100021225 | 265 |
| 88 | 3300025919 | Ga0207657_10209074 | Ga0207657_102090742 | 265 |
| 89 | 3300037466 | Ga0395898_0084334 | Ga0395898_0084334_1500_2306 | 265 |
| 90 | 3300038443 | Ga0395901_0105083 | Ga0395901_0105083_1288_2094 | 265 |
| 91 | iso_pu_bacteria | 2738541278 | 2738729416 | 267 |
| 92 | 3300005539 | Ga0068853_100000520 | Ga0068853_10000052023 | 268 |
| 93 | 3300009093 | Ga0105240_10004553 | Ga0105240_100045532 | 268 |
| 94 | 3300009093 | Ga0105240_10004621 | Ga0105240_100046213 | 268 |
| 95 | 3300009093 | Ga0105240_10039801 | Ga0105240_100398012 | 268 |
| 96 | 3300009174 | Ga0105241_10546049 | Ga0105241_105460492 | 268 |
| 97 | 3300009545 | Ga0105237_10000654 | Ga0105237_1000065416 | 268 |
| 98 | 3300009553 | Ga0105249_10041170 | Ga0105249_100411702 | 268 |
| 99 | 3300010375 | Ga0105239_10017966 | Ga0105239_100179663 | 268 |
| 100 | 3300010375 | Ga0105239_10127719 | Ga0105239_101277193 | 268 |
| 101 | 3300013307 | Ga0157372_10356888 | Ga0157372_103568882 | 268 |
| 102 | 3300025913 | Ga0207695_10000486 | Ga0207695_1000048671 | 268 |
| 103 | 3300025913 | Ga0207695_10003818 | Ga0207695_1000381820 | 268 |
| 104 | 3300025913 | Ga0207695_10182706 | Ga0207695_101827062 | 268 |
| 105 | 3300025914 | Ga0207671_10003349 | Ga0207671_100033492 | 268 |
| 106 | 3300026041 | Ga0207639_10026659 | Ga0207639_100266592 | 268 |
| 107 | 3300028786 | Ga0307517_10108469 | Ga0307517_101084692 | 268 |
| 108 | 3300033180 | Ga0307510_10000191 | Ga0307510_1000019115 | 268 |
| 109 | 3300044712 | Ga0453684_0038732 | Ga0453684_0038732_2349_3170 | 268 |
| 110 | 3300046648 | Ga0495611_0000358 | Ga0495611_0000358_1083_1901 | 268 |
| 111 | 3300053146 | Ga0500588_0044468 | Ga0500588_0044468_138_956 | 268 |
| 112 | 3300003316 | rootH1_10125848 | rootH1_101258484 | 269 |
| 113 | 3300003320 | rootH2_10168450 | rootH2_101684501 | 269 |
| 114 | 3300003320 | rootH2_10197471 | rootH2_101974713 | 269 |
| 115 | 3300003322 | rootL2_10097124 | rootL2_100971242 | 269 |
| 116 | 3300003322 | rootL2_10140161 | rootL2_101401612 | 269 |
| 117 | 3300003322 | rootL2_10277332 | rootL2_102773321 | 269 |
| 118 | 3300003323 | rootH1_10277108 | rootH1_102771082 | 269 |
| 119 | 3300003354 | JGI25160J50197_1003110 | JGI25160J50197_10031106 | 269 |
| 120 | 3300005329 | Ga0070683_100000329 | Ga0070683_10000032918 | 269 |
| 121 | 3300005331 | Ga0070670_100053200 | Ga0070670_1000532001 | 269 |
| 122 | 3300005335 | Ga0070666_10000043 | Ga0070666_100000436 | 269 |
| 123 | 3300005335 | Ga0070666_10031370 | Ga0070666_100313702 | 269 |
| 124 | 3300005344 | Ga0070661_100004831 | Ga0070661_1000048317 | 269 |
| 125 | 3300005347 | Ga0070668_100275096 | Ga0070668_1002750961 | 269 |
| 126 | 3300005365 | Ga0070688_100345312 | Ga0070688_1003453121 | 269 |
| 127 | 3300005457 | Ga0070662_100041094 | Ga0070662_1000410943 | 269 |
| 128 | 3300005466 | Ga0070685_10071691 | Ga0070685_100716912 | 269 |
| 129 | 3300005535 | Ga0070684_100000768 | Ga0070684_10000076820 | 269 |
| 130 | 3300005535 | Ga0070684_100453788 | Ga0070684_1004537881 | 269 |
| 131 | 3300005539 | Ga0068853_100059557 | Ga0068853_1000595573 | 269 |
| 132 | 3300005539 | Ga0068853_100074904 | Ga0068853_1000749042 | 269 |
| 133 | 3300005539 | Ga0068853_100238521 | Ga0068853_1002385212 | 269 |
| 134 | 3300005544 | Ga0070686_100142662 | Ga0070686_1001426621 | 269 |
| 135 | 3300005548 | Ga0070665_100000016 | Ga0070665_100000016319 | 269 |
| 136 | 3300005548 | Ga0070665_100263449 | Ga0070665_1002634492 | 269 |
| 137 | 3300005563 | Ga0068855_100174465 | Ga0068855_1001744653 | 269 |
| 138 | 3300005564 | Ga0070664_100007325 | Ga0070664_1000073257 | 269 |
| 139 | 3300005564 | Ga0070664_100386011 | Ga0070664_1003860111 | 269 |
| 140 | 3300005577 | Ga0068857_100008614 | Ga0068857_1000086147 | 269 |
| 141 | 3300005577 | Ga0068857_100032917 | Ga0068857_1000329173 | 269 |
| 142 | 3300005577 | Ga0068857_100357987 | Ga0068857_1003579872 | 269 |
| 143 | 3300005578 | Ga0068854_100003899 | Ga0068854_1000038999 | 269 |
| 144 | 3300005578 | Ga0068854_100390590 | Ga0068854_1003905902 | 269 |
| 145 | 3300005614 | Ga0068856_100113099 | Ga0068856_1001130994 | 269 |
| 146 | 3300005614 | Ga0068856_100360980 | Ga0068856_1003609802 | 269 |
| 147 | 3300005616 | Ga0068852_100003948 | Ga0068852_1000039483 | 269 |
| 148 | 3300005616 | Ga0068852_100358506 | Ga0068852_1003585062 | 269 |
| 149 | 3300005616 | Ga0068852_100426275 | Ga0068852_1004262752 | 269 |
| 150 | 3300005617 | Ga0068859_100000012 | Ga0068859_100000012176 | 269 |
| 151 | 3300005617 | Ga0068859_100016918 | Ga0068859_1000169183 | 269 |
| 152 | 3300005618 | Ga0068864_100030323 | Ga0068864_1000303235 | 269 |
| 153 | 3300005618 | Ga0068864_100064925 | Ga0068864_1000649252 | 269 |
| 154 | 3300005618 | Ga0068864_100083935 | Ga0068864_1000839352 | 269 |
| 155 | 3300005841 | Ga0068863_100025383 | Ga0068863_1000253833 | 269 |
| 156 | 3300005842 | Ga0068858_100001362 | Ga0068858_10000136217 | 269 |
| 157 | 3300005842 | Ga0068858_100047034 | Ga0068858_1000470342 | 269 |
| 158 | 3300005843 | Ga0068860_100000026 | Ga0068860_10000002667 | 269 |
| 159 | 3300005843 | Ga0068860_100002209 | Ga0068860_1000022099 | 269 |
| 160 | 3300005843 | Ga0068860_100010129 | Ga0068860_1000101292 | 269 |
| 161 | 3300005843 | Ga0068860_100072785 | Ga0068860_1000727852 | 269 |
| 162 | 3300005985 | Ga0081539_10029290 | Ga0081539_100292903 | 269 |
| 163 | 3300005985 | Ga0081539_10053064 | Ga0081539_100530644 | 269 |
| 164 | 3300006195 | Ga0075366_10076952 | Ga0075366_100769522 | 269 |
| 165 | 3300006237 | Ga0097621_100194998 | Ga0097621_1001949982 | 269 |
| 166 | 3300006237 | Ga0097621_100225857 | Ga0097621_1002258572 | 269 |
| 167 | 3300006237 | Ga0097621_100404986 | Ga0097621_1004049861 | 269 |
| 168 | 3300006931 | Ga0097620_100000012 | Ga0097620_100000012176 | 269 |
| 169 | 3300006931 | Ga0097620_100016919 | Ga0097620_1000169193 | 269 |
| 170 | 3300009093 | Ga0105240_10000258 | Ga0105240_1000025832 | 269 |
| 171 | 3300009093 | Ga0105240_10054842 | Ga0105240_100548422 | 269 |
| 172 | 3300009093 | Ga0105240_10060026 | Ga0105240_100600265 | 269 |
| 173 | 3300009098 | Ga0105245_10410015 | Ga0105245_104100152 | 269 |
| 174 | 3300009101 | Ga0105247_10001409 | Ga0105247_100014092 | 269 |
| 175 | 3300009101 | Ga0105247_10234417 | Ga0105247_102344172 | 269 |
| 176 | 3300009174 | Ga0105241_10000533 | Ga0105241_100005332 | 269 |
| 177 | 3300009174 | Ga0105241_10000721 | Ga0105241_1000072111 | 269 |
| 178 | 3300009545 | Ga0105237_10005490 | Ga0105237_100054909 | 269 |
| 179 | 3300009545 | Ga0105237_10005694 | Ga0105237_100056943 | 269 |
| 180 | 3300009545 | Ga0105237_10022472 | Ga0105237_100224725 | 269 |
| 181 | 3300009545 | Ga0105237_10064862 | Ga0105237_100648623 | 269 |
| 182 | 3300009545 | Ga0105237_10126957 | Ga0105237_101269573 | 269 |
| 183 | 3300009551 | Ga0105238_10006981 | Ga0105238_100069818 | 269 |
| 184 | 3300009551 | Ga0105238_10078160 | Ga0105238_100781601 | 269 |
| 185 | 3300009553 | Ga0105249_10001958 | Ga0105249_1000195810 | 269 |
| 186 | 3300009553 | Ga0105249_10114738 | Ga0105249_101147381 | 269 |
| 187 | 3300009553 | Ga0105249_10330591 | Ga0105249_103305912 | 269 |
| 188 | 3300010375 | Ga0105239_10001037 | Ga0105239_1000103730 | 269 |
| 189 | 3300010375 | Ga0105239_10011083 | Ga0105239_1001108310 | 269 |
| 190 | 3300010375 | Ga0105239_10043883 | Ga0105239_100438835 | 269 |
| 191 | 3300013100 | Ga0157373_10110592 | Ga0157373_101105923 | 269 |
| 192 | 3300013100 | Ga0157373_10111730 | Ga0157373_101117302 | 269 |
| 193 | 3300013102 | Ga0157371_10137041 | Ga0157371_101370412 | 269 |
| 194 | 3300013104 | Ga0157370_10005886 | Ga0157370_100058864 | 269 |
| 195 | 3300013105 | Ga0157369_10059170 | Ga0157369_100591703 | 269 |
| 196 | 3300013296 | Ga0157374_10098848 | Ga0157374_100988482 | 269 |
| 197 | 3300013296 | Ga0157374_10154491 | Ga0157374_101544912 | 269 |
| 198 | 3300013306 | Ga0163162_10000279 | Ga0163162_1000027925 | 269 |
| 199 | 3300013306 | Ga0163162_10006285 | Ga0163162_100062853 | 269 |
| 200 | 3300013306 | Ga0163162_10038399 | Ga0163162_100383992 | 269 |
| 201 | 3300013307 | Ga0157372_10002704 | Ga0157372_100027045 | 269 |
| 202 | 3300013307 | Ga0157372_10199261 | Ga0157372_101992611 | 269 |
| 203 | 3300013307 | Ga0157372_10398541 | Ga0157372_103985412 | 269 |
| 204 | 3300013308 | Ga0157375_10449600 | Ga0157375_104496002 | 269 |
| 205 | 3300014325 | Ga0163163_10020274 | Ga0163163_100202742 | 269 |
| 206 | 3300014325 | Ga0163163_10456616 | Ga0163163_104566162 | 269 |
| 207 | 3300014745 | Ga0157377_10147275 | Ga0157377_101472752 | 269 |
| 208 | 3300014968 | Ga0157379_10246416 | Ga0157379_102464162 | 269 |
| 209 | 3300014969 | Ga0157376_10004908 | Ga0157376_100049089 | 269 |
| 210 | 3300014969 | Ga0157376_10453389 | Ga0157376_104533892 | 269 |
| 211 | 3300017792 | Ga0163161_10048384 | Ga0163161_100483842 | 269 |
| 212 | 3300025302 | Ga0207426_1000052 | Ga0207426_1000052137 | 269 |
| 213 | 3300025903 | Ga0207680_10000371 | Ga0207680_1000037112 | 269 |
| 214 | 3300025904 | Ga0207647_10004784 | Ga0207647_100047842 | 269 |
| 215 | 3300025904 | Ga0207647_10019112 | Ga0207647_100191122 | 269 |
| 216 | 3300025904 | Ga0207647_10076717 | Ga0207647_100767172 | 269 |
| 217 | 3300025911 | Ga0207654_10001646 | Ga0207654_100016468 | 269 |
| 218 | 3300025911 | Ga0207654_10025628 | Ga0207654_100256282 | 269 |
| 219 | 3300025913 | Ga0207695_10008726 | Ga0207695_100087269 | 269 |
| 220 | 3300025913 | Ga0207695_10038067 | Ga0207695_100380673 | 269 |
| 221 | 3300025913 | Ga0207695_10152595 | Ga0207695_101525952 | 269 |
| 222 | 3300025914 | Ga0207671_10001742 | Ga0207671_100017427 | 269 |
| 223 | 3300025914 | Ga0207671_10004018 | Ga0207671_1000401810 | 269 |
| 224 | 3300025914 | Ga0207671_10006632 | Ga0207671_1000663211 | 269 |
| 225 | 3300025914 | Ga0207671_10344928 | Ga0207671_103449282 | 269 |
| 226 | 3300025919 | Ga0207657_10283833 | Ga0207657_102838331 | 269 |
| 227 | 3300025925 | Ga0207650_10134753 | Ga0207650_101347531 | 269 |
| 228 | 3300025932 | Ga0207690_10084126 | Ga0207690_100841262 | 269 |
| 229 | 3300025933 | Ga0207706_10031025 | Ga0207706_100310252 | 269 |
| 230 | 3300025942 | Ga0207689_10000329 | Ga0207689_1000032925 | 269 |
| 231 | 3300025944 | Ga0207661_10043012 | Ga0207661_100430125 | 269 |
| 232 | 3300025944 | Ga0207661_10370528 | Ga0207661_103705282 | 269 |
| 233 | 3300025945 | Ga0207679_10000751 | Ga0207679_1000075116 | 269 |
| 234 | 3300025949 | Ga0207667_10009409 | Ga0207667_100094097 | 269 |
| 235 | 3300025949 | Ga0207667_10061201 | Ga0207667_100612015 | 269 |
| 236 | 3300025960 | Ga0207651_10455062 | Ga0207651_104550622 | 269 |
| 237 | 3300025961 | Ga0207712_10001475 | Ga0207712_100014759 | 269 |
| 238 | 3300025961 | Ga0207712_10012015 | Ga0207712_100120154 | 269 |
| 239 | 3300025961 | Ga0207712_10211933 | Ga0207712_102119332 | 269 |
| 240 | 3300025972 | Ga0207668_10219684 | Ga0207668_102196842 | 269 |
| 241 | 3300025981 | Ga0207640_10017218 | Ga0207640_100172182 | 269 |
| 242 | 3300026023 | Ga0207677_10481829 | Ga0207677_104818291 | 269 |
| 243 | 3300026035 | Ga0207703_10002961 | Ga0207703_1000296111 | 269 |
| 244 | 3300026041 | Ga0207639_10019883 | Ga0207639_100198832 | 269 |
| 245 | 3300026067 | Ga0207678_10078813 | Ga0207678_100788131 | 269 |
| 246 | 3300026088 | Ga0207641_10000152 | Ga0207641_1000015260 | 269 |
| 247 | 3300026088 | Ga0207641_10051955 | Ga0207641_100519552 | 269 |
| 248 | 3300026089 | Ga0207648_10218055 | Ga0207648_102180552 | 269 |
| 249 | 3300026095 | Ga0207676_10053123 | Ga0207676_100531232 | 269 |
| 250 | 3300026095 | Ga0207676_10062678 | Ga0207676_100626782 | 269 |
| 251 | 3300026095 | Ga0207676_10163905 | Ga0207676_101639052 | 269 |
| 252 | 3300026116 | Ga0207674_10006492 | Ga0207674_100064922 | 269 |
| 253 | 3300026116 | Ga0207674_10012911 | Ga0207674_100129117 | 269 |
| 254 | 3300026142 | Ga0207698_10008700 | Ga0207698_100087008 | 269 |
| 255 | 3300026142 | Ga0207698_10023196 | Ga0207698_100231963 | 269 |
| 256 | 3300026142 | Ga0207698_10049762 | Ga0207698_100497622 | 269 |
| 257 | 3300026142 | Ga0207698_10309727 | Ga0207698_103097272 | 269 |
| 258 | 3300028379 | Ga0268266_10000034 | Ga0268266_10000034187 | 269 |
| 259 | 3300028379 | Ga0268266_10300190 | Ga0268266_103001902 | 269 |
| 260 | 3300028381 | Ga0268264_10000117 | Ga0268264_1000011743 | 269 |
| 261 | 3300028381 | Ga0268264_10024882 | Ga0268264_100248822 | 269 |
| 262 | 3300028381 | Ga0268264_10090261 | Ga0268264_100902611 | 269 |
| 263 | 3300028381 | Ga0268264_10103812 | Ga0268264_101038123 | 269 |
| 264 | 3300031251 | Ga0265327_10000196 | Ga0265327_1000019678 | 269 |
| 265 | 3300031251 | Ga0265327_10043802 | Ga0265327_100438023 | 269 |
| 266 | 3300031616 | Ga0307508_10000937 | Ga0307508_1000093717 | 269 |
| 267 | 3300035695 | Ga0373927_0084001 | Ga0373927_0084001_204_1019 | 269 |
| 268 | 3300037418 | Ga0395900_0578914 | Ga0395900_0578914_60_887 | 269 |
| 269 | 3300039093 | Ga0400489_24444 | Ga0400489_24444_2135_2986 | 269 |
| 270 | 3300041413 | Ga0439465_0013898 | Ga0439465_0013898_714_1529 | 269 |
| 271 | 3300041512 | Ga0451853_2746119 | Ga0451853_2746119_733_1653 | 269 |
| 272 | 3300042007 | Ga0439449_0131099 | Ga0439449_0131099_78_893 | 269 |
| 273 | 3300042014 | Ga0439457_020754 | Ga0439457_020754_528_1343 | 269 |
| 274 | 3300044658 | Ga0466972_0000782 | Ga0466972_0000782_12238_13050 | 269 |
| 275 | 3300044712 | Ga0453684_0814383 | Ga0453684_0814383_143_961 | 269 |
| 276 | 3300044842 | Ga0466957_0010988 | Ga0466957_0010988_2687_3502 | 269 |
| 277 | 3300046460 | Ga0495638_0072586 | Ga0495638_0072586_334_1155 | 269 |
| 278 | 3300046524 | Ga0495648_0002156 | Ga0495648_0002156_12612_13421 | 269 |
| 279 | 3300046648 | Ga0495611_0095110 | Ga0495611_0095110_454_1263 | 269 |
| 280 | 3300046660 | Ga0495625_0275681 | Ga0495625_0275681_215_1054 | 269 |
| 281 | 3300046675 | Ga0495657_0025035 | Ga0495657_0025035_1597_2457 | 269 |
| 282 | 3300047443 | Ga0495687_000079 | Ga0495687_000079_22826_23635 | 269 |
| 283 | 3300047472 | Ga0495686_0000041 | Ga0495686_0000041_77414_78247 | 269 |
| 284 | 3300047472 | Ga0495686_0249040 | Ga0495686_0249040_136_945 | 269 |
| 285 | 3300049581 | Ga0501047_0237673 | Ga0501047_0237673_23_838 | 269 |
| 286 | 3300049581 | Ga0501047_0316072 | Ga0501047_0316072_437_1252 | 269 |
| 287 | 3300049686 | Ga0501257_032622 | Ga0501257_032622_417_1232 | 269 |
| 288 | 3300049705 | Ga0501225_0002625 | Ga0501225_0002625_977_1792 | 269 |
| 289 | 3300049823 | Ga0501044_0006672 | Ga0501044_0006672_2691_3506 | 269 |
| 290 | 3300053086 | Ga0500578_0000017 | Ga0500578_0000017_60039_60854 | 269 |
| 291 | 3300053086 | Ga0500578_0031997 | Ga0500578_0031997_1829_2644 | 269 |
| 292 | 3300053090 | Ga0500646_0047096 | Ga0500646_0047096_31_846 | 269 |
| 293 | 3300053098 | Ga0500650_0006567 | Ga0500650_0006567_3616_4431 | 269 |
| 294 | 3300053103 | Ga0500555_010394 | Ga0500555_010394_292_1107 | 269 |
| 295 | 3300053104 | Ga0500556_0087245 | Ga0500556_0087245_315_1130 | 269 |
| 296 | 3300053130 | Ga0500642_0022129 | Ga0500642_0022129_305_1114 | 269 |
| 297 | 3300053146 | Ga0500588_0004743 | Ga0500588_0004743_1237_2076 | 269 |
| 298 | 3300053146 | Ga0500588_0060549 | Ga0500588_0060549_46_867 | 269 |
| 299 | 3300053156 | Ga0500622_0001151 | Ga0500622_0001151_11498_12307 | 269 |
| 300 | 3300053727 | Ga0500611_000018 | Ga0500611_000018_6595_7416 | 269 |
| 301 | 3300053727 | Ga0500611_020008 | Ga0500611_020008_126_947 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3grz-assembly1.cif.gz_B | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.9334 | 80 | 269 |
| 3grz-assembly1.cif.gz_A | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.9329 | 80 | 269 |
| 3grz-assembly1.cif.gz_B | crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus | 0.9148 | 80 | 269 |
| 4lwo-assembly2.cif.gz_G | crystal structure of prmt6 | 0.9138 | 133 | 189 |
| 4lwp-assembly1.cif.gz_A | crystal structure of prmt6-sah | 0.912 | 133 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXZ4_114_311_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9619 | 79 | 269 | 3.40.50.150 |
| 3grzA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9592 | 117 | 269 | 3.40.50.150 |
| 4m36A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9415 | 137 | 204 | 3.40.50.150 |
| 3grzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9334 | 80 | 269 | 3.40.50.150 |
| 2nxjB03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.933 | 119 | 269 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6H9LJW5-F1-model_v4 | deleted | 0.9833 | 110 | 269 |
|
| AF-A0A2M7RW94-F1-model_v4 | 50S ribosomal protein L11 methyltransferase | 0.9785 | 198 | 269 |
GO:0005840
GO:0008168 GO:0032259 |
| AF-A0A090W7D0-F1-model_v4 | Ribosomal protein L11 methyltransferase | 0.9784 | 84 | 269 |
GO:0005840
GO:0008276 GO:0032259 |
| AF-A0A090W7D0-F1-model_v4 | Ribosomal protein L11 methyltransferase | 0.9732 | 84 | 269 |
GO:0005840
GO:0008276 GO:0032259 |
| AF-F9MS34-F1-model_v4 | deleted | 0.971 | 112 | 268 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar