F396135

General Info

Members Datasets Scaffolds Average Seq Length
301 154 300 274

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0017833|Ga0496111_0017833_3885_4880
Length 319
Sequence LEPIQNQGNLNCRERCYYQNQKDRISHRINLPDLKKEINPDKSGFLIMGDYIKVEFEHLNIEQKEIIIALLAEMNYDGFEENDDVLKAFIPSNIYDENKLKALSKDRKLFFSVSKLENKNWINHSIXHTPWVAIRAAFHESISDIKYELIITPKMSFGTGHHATTSMMIKMMSELDFSGKTVLDFGTGTGILAILAEKLGASKIVAIDNDDQSIKNAGENLGSNDCSKIRLLQGSTANVDIKFDIILANIIKGVILDNLAAFTKEMVTDGVILLSGLLADDEREVMEKATGYNLILNKKIEDKNWICLQMTYKSSSFRR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
148 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
152 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0
Rhizoplane 0.33
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10125848 3300003316 Bacteria 3347
2 rootH2_10168450 3300003320 Bacteria 1176
3 rootH2_10197471 3300003320 Bacteria 2933
4 rootL2_10097124 3300003322 Unclassified 2320
5 rootL2_10140161 3300003322 Bacteria 1817
6 rootL2_10277332 3300003322 Bacteria 1204
7 rootH1_10277108 3300003323 Bacteria 1871
8 JGI25160J50197_1003110 3300003354 Bacteria 7555
9 Ga0070683_100000329 3300005329 Bacteria 32745
10 Ga0070683_100081163 3300005329 Bacteria 3036
11 Ga0070670_100053200 3300005331 Bacteria 3477
12 Ga0070670_100150728 3300005331 Bacteria 2012
13 Ga0068869_100024126 3300005334 Bacteria 4211
14 Ga0068869_100031526 3300005334 Bacteria 3729
15 Ga0068869_100055895 3300005334 Bacteria 2877
16 Ga0070666_10000043 3300005335 Bacteria 111402
17 Ga0070666_10031370 3300005335 Bacteria 3508
18 Ga0068868_100022584 3300005338 Bacteria 4750
19 Ga0070691_10007717 3300005341 Bacteria 4928
20 Ga0070661_100004831 3300005344 Bacteria 9277
21 Ga0070668_100275096 3300005347 Unclassified 1405
22 Ga0070669_100278882 3300005353 Bacteria 1339
23 Ga0070675_100313413 3300005354 Bacteria 1385
24 Ga0070688_100345312 3300005365 Unclassified 1088
25 Ga0070667_100028595 3300005367 Bacteria 4642
26 Ga0070678_100034523 3300005456 Bacteria 3524
27 Ga0070662_100039341 3300005457 Bacteria 3362
28 Ga0070662_100041094 3300005457 Bacteria 3297
29 Ga0070662_100047930 3300005457 Unclassified 3076
30 Ga0068867_100068162 3300005459 Bacteria 2655
31 Ga0070685_10071691 3300005466 Bacteria 2054
32 Ga0070684_100000768 3300005535 Bacteria 22215
33 Ga0070684_100001060 3300005535 Bacteria 19661
34 Ga0070684_100453788 3300005535 Bacteria 1185
35 Ga0068853_100000520 3300005539 Bacteria 26128
36 Ga0068853_100059557 3300005539 Bacteria 3299
37 Ga0068853_100074904 3300005539 Bacteria 2954
38 Ga0068853_100090645 3300005539 Bacteria 2687
39 Ga0068853_100238521 3300005539 Bacteria 1666
40 Ga0070686_100142662 3300005544 Unclassified 1669
41 Ga0070665_100000016 3300005548 Bacteria 451538
42 Ga0070665_100263449 3300005548 Bacteria 1725
43 Ga0068855_100174465 3300005563 Unclassified 2433
44 Ga0070664_100007325 3300005564 Bacteria 8896
45 Ga0070664_100279457 3300005564 Bacteria 1505
46 Ga0070664_100386011 3300005564 Bacteria 1279
47 Ga0068857_100008614 3300005577 Bacteria 8827
48 Ga0068857_100032917 3300005577 Bacteria 4583
49 Ga0068857_100132177 3300005577 Bacteria 2251
50 Ga0068857_100357987 3300005577 Bacteria 1352
51 Ga0068854_100003899 3300005578 Bacteria 9349
52 Ga0068854_100043746 3300005578 Bacteria 3176
53 Ga0068854_100390590 3300005578 Bacteria 1149
54 Ga0068856_100113099 3300005614 Bacteria 2713
55 Ga0068856_100360980 3300005614 Bacteria 1471
56 Ga0068852_100003948 3300005616 Bacteria 10424
57 Ga0068852_100358506 3300005616 Bacteria 1426
58 Ga0068852_100426275 3300005616 Bacteria 1309
59 Ga0068859_100000012 3300005617 Bacteria 300376
60 Ga0068859_100016918 3300005617 Bacteria 7320
61 Ga0068859_100180962 3300005617 Bacteria 2191
62 Ga0068864_100010946 3300005618 Bacteria 7499
63 Ga0068864_100030323 3300005618 Bacteria 4583
64 Ga0068864_100064925 3300005618 Bacteria 3167
65 Ga0068864_100083935 3300005618 Bacteria 2798
66 Ga0068866_10190177 3300005718 Bacteria 1219
67 Ga0068863_100025383 3300005841 Bacteria 5650
68 Ga0068858_100001362 3300005842 Bacteria 25148
69 Ga0068858_100047034 3300005842 Bacteria 4001
70 Ga0068860_100000026 3300005843 Bacteria 270483
71 Ga0068860_100002209 3300005843 Bacteria 20481
72 Ga0068860_100010129 3300005843 Bacteria 9342
73 Ga0068860_100072785 3300005843 Bacteria 3267
74 Ga0081539_10029290 3300005985 Bacteria 3442
75 Ga0081539_10053064 3300005985 Bacteria 2272
76 Ga0070715_10006819 3300006163 Bacteria 3899
77 Ga0075366_10069948 3300006195 Bacteria 2089
78 Ga0075366_10076952 3300006195 Bacteria 1991
79 Ga0097621_100085134 3300006237 Bacteria 2636
80 Ga0097621_100194998 3300006237 Bacteria 1756
81 Ga0097621_100225857 3300006237 Bacteria 1633
82 Ga0097621_100404986 3300006237 Bacteria 1222
83 Ga0068871_100112386 3300006358 Bacteria 2292
84 Ga0097620_100000012 3300006931 Bacteria 300376
85 Ga0097620_100016919 3300006931 Bacteria 7320
86 Ga0097620_100180977 3300006931 Bacteria 2191
87 Ga0105240_10000258 3300009093 Bacteria 105011
88 Ga0105240_10004553 3300009093 Bacteria 21043
89 Ga0105240_10004621 3300009093 Bacteria 20878
90 Ga0105240_10039801 3300009093 Bacteria 6017
91 Ga0105240_10054842 3300009093 Bacteria 4993
92 Ga0105240_10060026 3300009093 Bacteria 4742
93 Ga0105245_10410015 3300009098 Bacteria 1356
94 Ga0105247_10001409 3300009101 Bacteria 17436
95 Ga0105247_10234417 3300009101 Bacteria 1248
96 Ga0105241_10000533 3300009174 Bacteria 28600
97 Ga0105241_10000721 3300009174 Bacteria 25017
98 Ga0105241_10204702 3300009174 Bacteria 1650
99 Ga0105241_10546049 3300009174 Bacteria 1040
100 Ga0105237_10000654 3300009545 Bacteria 48395
101 Ga0105237_10005490 3300009545 Bacteria 14294
102 Ga0105237_10005694 3300009545 Bacteria 14017
103 Ga0105237_10022472 3300009545 Bacteria 6471
104 Ga0105237_10064862 3300009545 Bacteria 3648
105 Ga0105237_10126957 3300009545 Unclassified 2545
106 Ga0105238_10006981 3300009551 Bacteria 11286
107 Ga0105238_10078160 3300009551 Bacteria 3300
108 Ga0105249_10001958 3300009553 Bacteria 17861
109 Ga0105249_10041170 3300009553 Bacteria 4198
110 Ga0105249_10114738 3300009553 Bacteria 2551
111 Ga0105249_10330591 3300009553 Bacteria 1538
112 Ga0105239_10001037 3300010375 Bacteria 38729
113 Ga0105239_10011083 3300010375 Bacteria 10062
114 Ga0105239_10017966 3300010375 Bacteria 7820
115 Ga0105239_10043883 3300010375 Bacteria 4903
116 Ga0105239_10127719 3300010375 Bacteria 2826
117 Ga0105239_10179998 3300010375 Bacteria 2365
118 Ga0157373_10110592 3300013100 Unclassified 1932
119 Ga0157373_10111730 3300013100 Unclassified 1921
120 Ga0157371_10011331 3300013102 Bacteria 6878
121 Ga0157371_10137041 3300013102 Bacteria 1743
122 Ga0157371_10189740 3300013102 Bacteria 1471
123 Ga0157370_10005886 3300013104 Bacteria 13672
124 Ga0157369_10059170 3300013105 Bacteria 4132
125 Ga0157374_10006478 3300013296 Bacteria 9936
126 Ga0157374_10015281 3300013296 Bacteria 6732
127 Ga0157374_10098848 3300013296 Bacteria 2794
128 Ga0157374_10154491 3300013296 Bacteria 2232
129 Ga0157378_10023595 3300013297 Bacteria 5411
130 Ga0163162_10000279 3300013306 Bacteria 46872
131 Ga0163162_10004205 3300013306 Bacteria 13837
132 Ga0163162_10006285 3300013306 Bacteria 11505
133 Ga0163162_10038399 3300013306 Bacteria 4778
134 Ga0163162_10163930 3300013306 Bacteria 2346
135 Ga0157372_10002704 3300013307 Bacteria 19172
136 Ga0157372_10010252 3300013307 Bacteria 9953
137 Ga0157372_10199261 3300013307 Bacteria 2319
138 Ga0157372_10356888 3300013307 Bacteria 1703
139 Ga0157372_10398541 3300013307 Unclassified 1604
140 Ga0157375_10039491 3300013308 Bacteria 4543
141 Ga0157375_10064756 3300013308 Bacteria 3641
142 Ga0157375_10449600 3300013308 Bacteria 1454
143 Ga0157375_10501896 3300013308 Bacteria 1377
144 Ga0163163_10002122 3300014325 Bacteria 16737
145 Ga0163163_10009925 3300014325 Bacteria 8537
146 Ga0163163_10020274 3300014325 Bacteria 6258
147 Ga0163163_10456616 3300014325 Bacteria 1338
148 Ga0157377_10057265 3300014745 Unclassified 2215
149 Ga0157377_10147275 3300014745 Bacteria 1453
150 Ga0157379_10123471 3300014968 Bacteria 2330
151 Ga0157379_10132198 3300014968 Bacteria 2246
152 Ga0157379_10246416 3300014968 Bacteria 1621
153 Ga0157376_10004908 3300014969 Bacteria 9323
154 Ga0157376_10007359 3300014969 Bacteria 7849
155 Ga0157376_10453389 3300014969 Unclassified 1252
156 Ga0163161_10048384 3300017792 Bacteria 3070
157 Ga0163161_10058903 3300017792 Bacteria 2792
158 Ga0163161_10104760 3300017792 Bacteria 2109
159 Ga0207426_1000052 3300025302 Bacteria 389825
160 Ga0207642_10212280 3300025899 Bacteria 1076
161 Ga0207680_10000371 3300025903 Bacteria 21501
162 Ga0207647_10004784 3300025904 Bacteria 10024
163 Ga0207647_10019112 3300025904 Bacteria 4613
164 Ga0207647_10076717 3300025904 Bacteria 2010
165 Ga0207685_10010434 3300025905 Bacteria 2743
166 Ga0207645_10017285 3300025907 Unclassified 4765
167 Ga0207654_10001646 3300025911 Bacteria 11680
168 Ga0207654_10025628 3300025911 Bacteria 3183
169 Ga0207654_10121429 3300025911 Bacteria 1641
170 Ga0207695_10000486 3300025913 Bacteria 84856
171 Ga0207695_10003818 3300025913 Bacteria 20882
172 Ga0207695_10008726 3300025913 Bacteria 12639
173 Ga0207695_10038067 3300025913 Bacteria 5184
174 Ga0207695_10152595 3300025913 Unclassified 2248
175 Ga0207695_10182706 3300025913 Bacteria 2018
176 Ga0207671_10001742 3300025914 Bacteria 24460
177 Ga0207671_10003349 3300025914 Bacteria 16082
178 Ga0207671_10004018 3300025914 Bacteria 14291
179 Ga0207671_10006632 3300025914 Bacteria 10262
180 Ga0207671_10344928 3300025914 Unclassified 1180
181 Ga0207657_10209074 3300025919 Bacteria 1567
182 Ga0207657_10283833 3300025919 Bacteria 1314
183 Ga0207649_10006464 3300025920 Bacteria 6364
184 Ga0207650_10134753 3300025925 Bacteria 1936
185 Ga0207659_10508575 3300025926 Bacteria 1020
186 Ga0207644_10340004 3300025931 Bacteria 1217
187 Ga0207690_10084126 3300025932 Bacteria 2229
188 Ga0207706_10003803 3300025933 Bacteria 14383
189 Ga0207706_10023224 3300025933 Bacteria 5570
190 Ga0207706_10031025 3300025933 Bacteria 4763
191 Ga0207670_10012704 3300025936 Bacteria 4936
192 Ga0207691_10012396 3300025940 Bacteria 8172
193 Ga0207689_10000329 3300025942 Bacteria 44014
194 Ga0207689_10010393 3300025942 Bacteria 8016
195 Ga0207689_10021416 3300025942 Bacteria 5435
196 Ga0207689_10044691 3300025942 Bacteria 3663
197 Ga0207661_10020712 3300025944 Bacteria 4920
198 Ga0207661_10043012 3300025944 Bacteria 3564
199 Ga0207661_10370528 3300025944 Bacteria 1295
200 Ga0207679_10000751 3300025945 Bacteria 21527
201 Ga0207679_10001121 3300025945 Bacteria 17095
202 Ga0207667_10009409 3300025949 Bacteria 11510
203 Ga0207667_10061201 3300025949 Bacteria 3939
204 Ga0207651_10399085 3300025960 Bacteria 1169
205 Ga0207651_10455062 3300025960 Unclassified 1099
206 Ga0207651_10483931 3300025960 Bacteria 1067
207 Ga0207712_10001475 3300025961 Bacteria 16057
208 Ga0207712_10012015 3300025961 Bacteria 5526
209 Ga0207712_10211933 3300025961 Bacteria 1543
210 Ga0207668_10219684 3300025972 Unclassified 1525
211 Ga0207640_10017218 3300025981 Bacteria 4223
212 Ga0207640_10081591 3300025981 Bacteria 2212
213 Ga0207658_10051028 3300025986 Bacteria 3047
214 Ga0207677_10007895 3300026023 Bacteria 5915
215 Ga0207677_10481829 3300026023 Unclassified 1069
216 Ga0207703_10002961 3300026035 Bacteria 14396
217 Ga0207639_10019883 3300026041 Bacteria 4798
218 Ga0207639_10026659 3300026041 Bacteria 4200
219 Ga0207678_10078813 3300026067 Bacteria 2821
220 Ga0207641_10000152 3300026088 Bacteria 98311
221 Ga0207641_10051955 3300026088 Bacteria 3470
222 Ga0207648_10108632 3300026089 Bacteria 2435
223 Ga0207648_10218055 3300026089 Unclassified 1695
224 Ga0207676_10013981 3300026095 Bacteria 5762
225 Ga0207676_10053123 3300026095 Bacteria 3170
226 Ga0207676_10062678 3300026095 Bacteria 2950
227 Ga0207676_10163905 3300026095 Bacteria 1929
228 Ga0207674_10006492 3300026116 Bacteria 13755
229 Ga0207674_10012911 3300026116 Bacteria 9316
230 Ga0207674_10030052 3300026116 Bacteria 5715
231 Ga0207675_100082906 3300026118 Bacteria 3007
232 Ga0207683_10031869 3300026121 Bacteria 4577
233 Ga0207698_10008700 3300026142 Bacteria 6434
234 Ga0207698_10023196 3300026142 Bacteria 4330
235 Ga0207698_10049762 3300026142 Bacteria 3192
236 Ga0207698_10309727 3300026142 Bacteria 1474
237 Ga0268266_10000034 3300028379 Bacteria 354251
238 Ga0268266_10300190 3300028379 Bacteria 1498
239 Ga0268264_10000117 3300028381 Bacteria 195037
240 Ga0268264_10024882 3300028381 Bacteria 4892
241 Ga0268264_10090261 3300028381 Bacteria 2640
242 Ga0268264_10103812 3300028381 Unclassified 2476
243 Ga0307517_10108469 3300028786 Bacteria 2131
244 Ga0265327_10000196 3300031251 Bacteria 127325
245 Ga0265327_10043802 3300031251 Bacteria 2391
246 Ga0307508_10000937 3300031616 Bacteria 33974
247 Ga0307510_10000191 3300033180 Bacteria 53108
248 Ga0373927_0084001 3300035695 Bacteria 2065
249 Ga0395900_0578914 3300037418 Unclassified 1065
250 Ga0395898_0084334 3300037466 Bacteria 3063
251 Ga0395901_0105083 3300038443 Bacteria 2964
252 Ga0400489_24444 3300039093 Bacteria 5765
253 Ga0439436_0000773 3300041404 Bacteria 8667
254 Ga0439465_0013898 3300041413 Bacteria 2507
255 Ga0451853_2746119 3300041512 Bacteria 1676
256 Ga0439449_0131099 3300042007 Bacteria 932
257 Ga0439457_000175 3300042014 Bacteria 16689
258 Ga0439457_020754 3300042014 Bacteria 1457
259 Ga0439462_0036364 3300042015 Bacteria 1310
260 Ga0466972_0000782 3300044658 Bacteria 15085
261 Ga0453684_0038732 3300044712 Bacteria 6509
262 Ga0453684_0814383 3300044712 Bacteria 1006
263 Ga0466957_0010988 3300044842 Bacteria 5208
264 Ga0495592_0125910 3300046454 Bacteria 1798
265 Ga0495638_0072586 3300046460 Unclassified 2103
266 Ga0495653_0078610 3300046463 Bacteria 2446
267 Ga0495608_0156085 3300046511 Bacteria 1453
268 Ga0495630_0019380 3300046517 Bacteria 5000
269 Ga0495648_0002156 3300046524 Bacteria 18542
270 Ga0495587_0097319 3300046536 Bacteria 1697
271 Ga0495668_0001368 3300046616 Bacteria 23908
272 Ga0495611_0000358 3300046648 Bacteria 29739
273 Ga0495611_0095110 3300046648 Unclassified 1379
274 Ga0495625_0275681 3300046660 Bacteria 1084
275 Ga0495657_0025035 3300046675 Bacteria 4241
276 Ga0495649_0070579 3300046694 Bacteria 1873
277 Ga0495604_0130662 3300047317 Bacteria 1806
278 Ga0495687_000079 3300047443 Bacteria 147704
279 Ga0495686_0000041 3300047472 Bacteria 297599
280 Ga0495686_0249040 3300047472 Bacteria 999
281 Ga0496111_0017833 3300048914 Unclassified 4910
282 Ga0501047_0237673 3300049581 Bacteria 1673
283 Ga0501047_0316072 3300049581 Bacteria 1402
284 Ga0501257_032622 3300049686 Bacteria 1260
285 Ga0501225_0002625 3300049705 Bacteria 5520
286 Ga0501044_0006672 3300049823 Bacteria 12724
287 Ga0495619_0061916 3300053085 Bacteria 2491
288 Ga0500578_0000017 3300053086 Bacteria 178494
289 Ga0500578_0031997 3300053086 Bacteria 3382
290 Ga0500646_0047096 3300053090 Bacteria 1232
291 Ga0500650_0006567 3300053098 Bacteria 4454
292 Ga0500555_010394 3300053103 Bacteria 2668
293 Ga0500556_0087245 3300053104 Bacteria 1187
294 Ga0500642_0022129 3300053130 Bacteria 2530
295 Ga0500588_0004743 3300053146 Bacteria 2965
296 Ga0500588_0044468 3300053146 Bacteria 1355
297 Ga0500588_0060549 3300053146 Unclassified 1212
298 Ga0500622_0001151 3300053156 Bacteria 22018
299 Ga0500611_000018 3300053727 Bacteria 111023
300 Ga0500611_020008 3300053727 Bacteria 1257

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100082906 Ga0207675_1000829062 237
2 3300005539 Ga0068853_100090645 Ga0068853_1000906452 242
3 3300046454 Ga0495592_0125910 Ga0495592_0125910_325_1185 245
4 3300046463 Ga0495653_0078610 Ga0495653_0078610_355_1215 245
5 3300047317 Ga0495604_0130662 Ga0495604_0130662_291_1151 245
6 3300046536 Ga0495587_0097319 Ga0495587_0097319_825_1685 248
7 3300046616 Ga0495668_0001368 Ga0495668_0001368_19975_20808 249
8 3300006195 Ga0075366_10069948 Ga0075366_100699482 254
9 3300005329 Ga0070683_100081163 Ga0070683_1000811633 257
10 3300005334 Ga0068869_100024126 Ga0068869_1000241262 257
11 3300005457 Ga0070662_100047930 Ga0070662_1000479302 257
12 3300005535 Ga0070684_100001060 Ga0070684_10000106018 257
13 3300005564 Ga0070664_100279457 Ga0070664_1002794572 257
14 3300005577 Ga0068857_100132177 Ga0068857_1001321772 257
15 3300005618 Ga0068864_100010946 Ga0068864_1000109466 257
16 3300013296 Ga0157374_10006478 Ga0157374_100064788 257
17 3300013308 Ga0157375_10501896 Ga0157375_105018962 257
18 3300014325 Ga0163163_10009925 Ga0163163_100099256 257
19 3300014745 Ga0157377_10057265 Ga0157377_100572652 257
20 3300014968 Ga0157379_10132198 Ga0157379_101321983 257
21 3300025920 Ga0207649_10006464 Ga0207649_100064645 257
22 3300025933 Ga0207706_10023224 Ga0207706_100232241 257
23 3300025936 Ga0207670_10012704 Ga0207670_100127042 257
24 3300025940 Ga0207691_10012396 Ga0207691_100123964 257
25 3300025942 Ga0207689_10010393 Ga0207689_100103933 257
26 3300025944 Ga0207661_10020712 Ga0207661_100207125 257
27 3300025945 Ga0207679_10001121 Ga0207679_100011217 257
28 3300025960 Ga0207651_10399085 Ga0207651_103990851 257
29 3300025986 Ga0207658_10051028 Ga0207658_100510282 257
30 3300026095 Ga0207676_10013981 Ga0207676_100139813 257
31 3300026116 Ga0207674_10030052 Ga0207674_100300522 257
32 3300048914 Ga0496111_0017833 Ga0496111_0017833_3885_4880 257
33 3300046694 Ga0495649_0070579 Ga0495649_0070579_495_1340 258
34 3300041404 Ga0439436_0000773 Ga0439436_0000773_754_1569 259
35 3300042014 Ga0439457_000175 Ga0439457_000175_15093_15908 259
36 3300042015 Ga0439462_0036364 Ga0439462_0036364_212_1027 259
37 3300005334 Ga0068869_100031526 Ga0068869_1000315263 262
38 3300005338 Ga0068868_100022584 Ga0068868_1000225842 262
39 3300005354 Ga0070675_100313413 Ga0070675_1003134131 262
40 3300005367 Ga0070667_100028595 Ga0070667_1000285953 262
41 3300005456 Ga0070678_100034523 Ga0070678_1000345232 262
42 3300005459 Ga0068867_100068162 Ga0068867_1000681621 262
43 3300006163 Ga0070715_10006819 Ga0070715_100068192 262
44 3300006237 Ga0097621_100085134 Ga0097621_1000851342 262
45 3300006358 Ga0068871_100112386 Ga0068871_1001123862 262
46 3300009174 Ga0105241_10204702 Ga0105241_102047022 262
47 3300010375 Ga0105239_10179998 Ga0105239_101799982 262
48 3300013102 Ga0157371_10189740 Ga0157371_101897401 262
49 3300013296 Ga0157374_10015281 Ga0157374_100152816 262
50 3300013306 Ga0163162_10163930 Ga0163162_101639302 262
51 3300013308 Ga0157375_10039491 Ga0157375_100394914 262
52 3300014968 Ga0157379_10123471 Ga0157379_101234712 262
53 3300014969 Ga0157376_10007359 Ga0157376_100073594 262
54 3300017792 Ga0163161_10058903 Ga0163161_100589032 262
55 3300025899 Ga0207642_10212280 Ga0207642_102122801 262
56 3300025905 Ga0207685_10010434 Ga0207685_100104343 262
57 3300025911 Ga0207654_10121429 Ga0207654_101214292 262
58 3300025931 Ga0207644_10340004 Ga0207644_103400042 262
59 3300025933 Ga0207706_10003803 Ga0207706_100038033 262
60 3300025942 Ga0207689_10044691 Ga0207689_100446912 262
61 3300026121 Ga0207683_10031869 Ga0207683_100318693 262
62 3300005341 Ga0070691_10007717 Ga0070691_100077174 263
63 3300005617 Ga0068859_100180962 Ga0068859_1001809622 263
64 3300006931 Ga0097620_100180977 Ga0097620_1001809772 263
65 3300046511 Ga0495608_0156085 Ga0495608_0156085_362_1222 263
66 3300046517 Ga0495630_0019380 Ga0495630_0019380_3499_4359 263
67 3300053085 Ga0495619_0061916 Ga0495619_0061916_731_1591 263
68 3300005334 Ga0068869_100055895 Ga0068869_1000558952 264
69 3300005353 Ga0070669_100278882 Ga0070669_1002788822 264
70 3300005457 Ga0070662_100039341 Ga0070662_1000393413 264
71 3300005578 Ga0068854_100043746 Ga0068854_1000437462 264
72 3300005718 Ga0068866_10190177 Ga0068866_101901772 264
73 3300013297 Ga0157378_10023595 Ga0157378_100235954 264
74 3300013306 Ga0163162_10004205 Ga0163162_1000420516 264
75 3300013308 Ga0157375_10064756 Ga0157375_100647562 264
76 3300017792 Ga0163161_10104760 Ga0163161_101047603 264
77 3300025907 Ga0207645_10017285 Ga0207645_100172856 264
78 3300025926 Ga0207659_10508575 Ga0207659_105085751 264
79 3300025942 Ga0207689_10021416 Ga0207689_100214163 264
80 3300025960 Ga0207651_10483931 Ga0207651_104839311 264
81 3300025981 Ga0207640_10081591 Ga0207640_100815912 264
82 3300026023 Ga0207677_10007895 Ga0207677_100078955 264
83 3300026089 Ga0207648_10108632 Ga0207648_101086322 264
84 3300005331 Ga0070670_100150728 Ga0070670_1001507281 265
85 3300013102 Ga0157371_10011331 Ga0157371_100113313 265
86 3300013307 Ga0157372_10010252 Ga0157372_1001025210 265
87 3300014325 Ga0163163_10002122 Ga0163163_100021225 265
88 3300025919 Ga0207657_10209074 Ga0207657_102090742 265
89 3300037466 Ga0395898_0084334 Ga0395898_0084334_1500_2306 265
90 3300038443 Ga0395901_0105083 Ga0395901_0105083_1288_2094 265
91 iso_pu_bacteria 2738541278 2738729416 267
92 3300005539 Ga0068853_100000520 Ga0068853_10000052023 268
93 3300009093 Ga0105240_10004553 Ga0105240_100045532 268
94 3300009093 Ga0105240_10004621 Ga0105240_100046213 268
95 3300009093 Ga0105240_10039801 Ga0105240_100398012 268
96 3300009174 Ga0105241_10546049 Ga0105241_105460492 268
97 3300009545 Ga0105237_10000654 Ga0105237_1000065416 268
98 3300009553 Ga0105249_10041170 Ga0105249_100411702 268
99 3300010375 Ga0105239_10017966 Ga0105239_100179663 268
100 3300010375 Ga0105239_10127719 Ga0105239_101277193 268
101 3300013307 Ga0157372_10356888 Ga0157372_103568882 268
102 3300025913 Ga0207695_10000486 Ga0207695_1000048671 268
103 3300025913 Ga0207695_10003818 Ga0207695_1000381820 268
104 3300025913 Ga0207695_10182706 Ga0207695_101827062 268
105 3300025914 Ga0207671_10003349 Ga0207671_100033492 268
106 3300026041 Ga0207639_10026659 Ga0207639_100266592 268
107 3300028786 Ga0307517_10108469 Ga0307517_101084692 268
108 3300033180 Ga0307510_10000191 Ga0307510_1000019115 268
109 3300044712 Ga0453684_0038732 Ga0453684_0038732_2349_3170 268
110 3300046648 Ga0495611_0000358 Ga0495611_0000358_1083_1901 268
111 3300053146 Ga0500588_0044468 Ga0500588_0044468_138_956 268
112 3300003316 rootH1_10125848 rootH1_101258484 269
113 3300003320 rootH2_10168450 rootH2_101684501 269
114 3300003320 rootH2_10197471 rootH2_101974713 269
115 3300003322 rootL2_10097124 rootL2_100971242 269
116 3300003322 rootL2_10140161 rootL2_101401612 269
117 3300003322 rootL2_10277332 rootL2_102773321 269
118 3300003323 rootH1_10277108 rootH1_102771082 269
119 3300003354 JGI25160J50197_1003110 JGI25160J50197_10031106 269
120 3300005329 Ga0070683_100000329 Ga0070683_10000032918 269
121 3300005331 Ga0070670_100053200 Ga0070670_1000532001 269
122 3300005335 Ga0070666_10000043 Ga0070666_100000436 269
123 3300005335 Ga0070666_10031370 Ga0070666_100313702 269
124 3300005344 Ga0070661_100004831 Ga0070661_1000048317 269
125 3300005347 Ga0070668_100275096 Ga0070668_1002750961 269
126 3300005365 Ga0070688_100345312 Ga0070688_1003453121 269
127 3300005457 Ga0070662_100041094 Ga0070662_1000410943 269
128 3300005466 Ga0070685_10071691 Ga0070685_100716912 269
129 3300005535 Ga0070684_100000768 Ga0070684_10000076820 269
130 3300005535 Ga0070684_100453788 Ga0070684_1004537881 269
131 3300005539 Ga0068853_100059557 Ga0068853_1000595573 269
132 3300005539 Ga0068853_100074904 Ga0068853_1000749042 269
133 3300005539 Ga0068853_100238521 Ga0068853_1002385212 269
134 3300005544 Ga0070686_100142662 Ga0070686_1001426621 269
135 3300005548 Ga0070665_100000016 Ga0070665_100000016319 269
136 3300005548 Ga0070665_100263449 Ga0070665_1002634492 269
137 3300005563 Ga0068855_100174465 Ga0068855_1001744653 269
138 3300005564 Ga0070664_100007325 Ga0070664_1000073257 269
139 3300005564 Ga0070664_100386011 Ga0070664_1003860111 269
140 3300005577 Ga0068857_100008614 Ga0068857_1000086147 269
141 3300005577 Ga0068857_100032917 Ga0068857_1000329173 269
142 3300005577 Ga0068857_100357987 Ga0068857_1003579872 269
143 3300005578 Ga0068854_100003899 Ga0068854_1000038999 269
144 3300005578 Ga0068854_100390590 Ga0068854_1003905902 269
145 3300005614 Ga0068856_100113099 Ga0068856_1001130994 269
146 3300005614 Ga0068856_100360980 Ga0068856_1003609802 269
147 3300005616 Ga0068852_100003948 Ga0068852_1000039483 269
148 3300005616 Ga0068852_100358506 Ga0068852_1003585062 269
149 3300005616 Ga0068852_100426275 Ga0068852_1004262752 269
150 3300005617 Ga0068859_100000012 Ga0068859_100000012176 269
151 3300005617 Ga0068859_100016918 Ga0068859_1000169183 269
152 3300005618 Ga0068864_100030323 Ga0068864_1000303235 269
153 3300005618 Ga0068864_100064925 Ga0068864_1000649252 269
154 3300005618 Ga0068864_100083935 Ga0068864_1000839352 269
155 3300005841 Ga0068863_100025383 Ga0068863_1000253833 269
156 3300005842 Ga0068858_100001362 Ga0068858_10000136217 269
157 3300005842 Ga0068858_100047034 Ga0068858_1000470342 269
158 3300005843 Ga0068860_100000026 Ga0068860_10000002667 269
159 3300005843 Ga0068860_100002209 Ga0068860_1000022099 269
160 3300005843 Ga0068860_100010129 Ga0068860_1000101292 269
161 3300005843 Ga0068860_100072785 Ga0068860_1000727852 269
162 3300005985 Ga0081539_10029290 Ga0081539_100292903 269
163 3300005985 Ga0081539_10053064 Ga0081539_100530644 269
164 3300006195 Ga0075366_10076952 Ga0075366_100769522 269
165 3300006237 Ga0097621_100194998 Ga0097621_1001949982 269
166 3300006237 Ga0097621_100225857 Ga0097621_1002258572 269
167 3300006237 Ga0097621_100404986 Ga0097621_1004049861 269
168 3300006931 Ga0097620_100000012 Ga0097620_100000012176 269
169 3300006931 Ga0097620_100016919 Ga0097620_1000169193 269
170 3300009093 Ga0105240_10000258 Ga0105240_1000025832 269
171 3300009093 Ga0105240_10054842 Ga0105240_100548422 269
172 3300009093 Ga0105240_10060026 Ga0105240_100600265 269
173 3300009098 Ga0105245_10410015 Ga0105245_104100152 269
174 3300009101 Ga0105247_10001409 Ga0105247_100014092 269
175 3300009101 Ga0105247_10234417 Ga0105247_102344172 269
176 3300009174 Ga0105241_10000533 Ga0105241_100005332 269
177 3300009174 Ga0105241_10000721 Ga0105241_1000072111 269
178 3300009545 Ga0105237_10005490 Ga0105237_100054909 269
179 3300009545 Ga0105237_10005694 Ga0105237_100056943 269
180 3300009545 Ga0105237_10022472 Ga0105237_100224725 269
181 3300009545 Ga0105237_10064862 Ga0105237_100648623 269
182 3300009545 Ga0105237_10126957 Ga0105237_101269573 269
183 3300009551 Ga0105238_10006981 Ga0105238_100069818 269
184 3300009551 Ga0105238_10078160 Ga0105238_100781601 269
185 3300009553 Ga0105249_10001958 Ga0105249_1000195810 269
186 3300009553 Ga0105249_10114738 Ga0105249_101147381 269
187 3300009553 Ga0105249_10330591 Ga0105249_103305912 269
188 3300010375 Ga0105239_10001037 Ga0105239_1000103730 269
189 3300010375 Ga0105239_10011083 Ga0105239_1001108310 269
190 3300010375 Ga0105239_10043883 Ga0105239_100438835 269
191 3300013100 Ga0157373_10110592 Ga0157373_101105923 269
192 3300013100 Ga0157373_10111730 Ga0157373_101117302 269
193 3300013102 Ga0157371_10137041 Ga0157371_101370412 269
194 3300013104 Ga0157370_10005886 Ga0157370_100058864 269
195 3300013105 Ga0157369_10059170 Ga0157369_100591703 269
196 3300013296 Ga0157374_10098848 Ga0157374_100988482 269
197 3300013296 Ga0157374_10154491 Ga0157374_101544912 269
198 3300013306 Ga0163162_10000279 Ga0163162_1000027925 269
199 3300013306 Ga0163162_10006285 Ga0163162_100062853 269
200 3300013306 Ga0163162_10038399 Ga0163162_100383992 269
201 3300013307 Ga0157372_10002704 Ga0157372_100027045 269
202 3300013307 Ga0157372_10199261 Ga0157372_101992611 269
203 3300013307 Ga0157372_10398541 Ga0157372_103985412 269
204 3300013308 Ga0157375_10449600 Ga0157375_104496002 269
205 3300014325 Ga0163163_10020274 Ga0163163_100202742 269
206 3300014325 Ga0163163_10456616 Ga0163163_104566162 269
207 3300014745 Ga0157377_10147275 Ga0157377_101472752 269
208 3300014968 Ga0157379_10246416 Ga0157379_102464162 269
209 3300014969 Ga0157376_10004908 Ga0157376_100049089 269
210 3300014969 Ga0157376_10453389 Ga0157376_104533892 269
211 3300017792 Ga0163161_10048384 Ga0163161_100483842 269
212 3300025302 Ga0207426_1000052 Ga0207426_1000052137 269
213 3300025903 Ga0207680_10000371 Ga0207680_1000037112 269
214 3300025904 Ga0207647_10004784 Ga0207647_100047842 269
215 3300025904 Ga0207647_10019112 Ga0207647_100191122 269
216 3300025904 Ga0207647_10076717 Ga0207647_100767172 269
217 3300025911 Ga0207654_10001646 Ga0207654_100016468 269
218 3300025911 Ga0207654_10025628 Ga0207654_100256282 269
219 3300025913 Ga0207695_10008726 Ga0207695_100087269 269
220 3300025913 Ga0207695_10038067 Ga0207695_100380673 269
221 3300025913 Ga0207695_10152595 Ga0207695_101525952 269
222 3300025914 Ga0207671_10001742 Ga0207671_100017427 269
223 3300025914 Ga0207671_10004018 Ga0207671_1000401810 269
224 3300025914 Ga0207671_10006632 Ga0207671_1000663211 269
225 3300025914 Ga0207671_10344928 Ga0207671_103449282 269
226 3300025919 Ga0207657_10283833 Ga0207657_102838331 269
227 3300025925 Ga0207650_10134753 Ga0207650_101347531 269
228 3300025932 Ga0207690_10084126 Ga0207690_100841262 269
229 3300025933 Ga0207706_10031025 Ga0207706_100310252 269
230 3300025942 Ga0207689_10000329 Ga0207689_1000032925 269
231 3300025944 Ga0207661_10043012 Ga0207661_100430125 269
232 3300025944 Ga0207661_10370528 Ga0207661_103705282 269
233 3300025945 Ga0207679_10000751 Ga0207679_1000075116 269
234 3300025949 Ga0207667_10009409 Ga0207667_100094097 269
235 3300025949 Ga0207667_10061201 Ga0207667_100612015 269
236 3300025960 Ga0207651_10455062 Ga0207651_104550622 269
237 3300025961 Ga0207712_10001475 Ga0207712_100014759 269
238 3300025961 Ga0207712_10012015 Ga0207712_100120154 269
239 3300025961 Ga0207712_10211933 Ga0207712_102119332 269
240 3300025972 Ga0207668_10219684 Ga0207668_102196842 269
241 3300025981 Ga0207640_10017218 Ga0207640_100172182 269
242 3300026023 Ga0207677_10481829 Ga0207677_104818291 269
243 3300026035 Ga0207703_10002961 Ga0207703_1000296111 269
244 3300026041 Ga0207639_10019883 Ga0207639_100198832 269
245 3300026067 Ga0207678_10078813 Ga0207678_100788131 269
246 3300026088 Ga0207641_10000152 Ga0207641_1000015260 269
247 3300026088 Ga0207641_10051955 Ga0207641_100519552 269
248 3300026089 Ga0207648_10218055 Ga0207648_102180552 269
249 3300026095 Ga0207676_10053123 Ga0207676_100531232 269
250 3300026095 Ga0207676_10062678 Ga0207676_100626782 269
251 3300026095 Ga0207676_10163905 Ga0207676_101639052 269
252 3300026116 Ga0207674_10006492 Ga0207674_100064922 269
253 3300026116 Ga0207674_10012911 Ga0207674_100129117 269
254 3300026142 Ga0207698_10008700 Ga0207698_100087008 269
255 3300026142 Ga0207698_10023196 Ga0207698_100231963 269
256 3300026142 Ga0207698_10049762 Ga0207698_100497622 269
257 3300026142 Ga0207698_10309727 Ga0207698_103097272 269
258 3300028379 Ga0268266_10000034 Ga0268266_10000034187 269
259 3300028379 Ga0268266_10300190 Ga0268266_103001902 269
260 3300028381 Ga0268264_10000117 Ga0268264_1000011743 269
261 3300028381 Ga0268264_10024882 Ga0268264_100248822 269
262 3300028381 Ga0268264_10090261 Ga0268264_100902611 269
263 3300028381 Ga0268264_10103812 Ga0268264_101038123 269
264 3300031251 Ga0265327_10000196 Ga0265327_1000019678 269
265 3300031251 Ga0265327_10043802 Ga0265327_100438023 269
266 3300031616 Ga0307508_10000937 Ga0307508_1000093717 269
267 3300035695 Ga0373927_0084001 Ga0373927_0084001_204_1019 269
268 3300037418 Ga0395900_0578914 Ga0395900_0578914_60_887 269
269 3300039093 Ga0400489_24444 Ga0400489_24444_2135_2986 269
270 3300041413 Ga0439465_0013898 Ga0439465_0013898_714_1529 269
271 3300041512 Ga0451853_2746119 Ga0451853_2746119_733_1653 269
272 3300042007 Ga0439449_0131099 Ga0439449_0131099_78_893 269
273 3300042014 Ga0439457_020754 Ga0439457_020754_528_1343 269
274 3300044658 Ga0466972_0000782 Ga0466972_0000782_12238_13050 269
275 3300044712 Ga0453684_0814383 Ga0453684_0814383_143_961 269
276 3300044842 Ga0466957_0010988 Ga0466957_0010988_2687_3502 269
277 3300046460 Ga0495638_0072586 Ga0495638_0072586_334_1155 269
278 3300046524 Ga0495648_0002156 Ga0495648_0002156_12612_13421 269
279 3300046648 Ga0495611_0095110 Ga0495611_0095110_454_1263 269
280 3300046660 Ga0495625_0275681 Ga0495625_0275681_215_1054 269
281 3300046675 Ga0495657_0025035 Ga0495657_0025035_1597_2457 269
282 3300047443 Ga0495687_000079 Ga0495687_000079_22826_23635 269
283 3300047472 Ga0495686_0000041 Ga0495686_0000041_77414_78247 269
284 3300047472 Ga0495686_0249040 Ga0495686_0249040_136_945 269
285 3300049581 Ga0501047_0237673 Ga0501047_0237673_23_838 269
286 3300049581 Ga0501047_0316072 Ga0501047_0316072_437_1252 269
287 3300049686 Ga0501257_032622 Ga0501257_032622_417_1232 269
288 3300049705 Ga0501225_0002625 Ga0501225_0002625_977_1792 269
289 3300049823 Ga0501044_0006672 Ga0501044_0006672_2691_3506 269
290 3300053086 Ga0500578_0000017 Ga0500578_0000017_60039_60854 269
291 3300053086 Ga0500578_0031997 Ga0500578_0031997_1829_2644 269
292 3300053090 Ga0500646_0047096 Ga0500646_0047096_31_846 269
293 3300053098 Ga0500650_0006567 Ga0500650_0006567_3616_4431 269
294 3300053103 Ga0500555_010394 Ga0500555_010394_292_1107 269
295 3300053104 Ga0500556_0087245 Ga0500556_0087245_315_1130 269
296 3300053130 Ga0500642_0022129 Ga0500642_0022129_305_1114 269
297 3300053146 Ga0500588_0004743 Ga0500588_0004743_1237_2076 269
298 3300053146 Ga0500588_0060549 Ga0500588_0060549_46_867 269
299 3300053156 Ga0500622_0001151 Ga0500622_0001151_11498_12307 269
300 3300053727 Ga0500611_000018 Ga0500611_000018_6595_7416 269
301 3300053727 Ga0500611_020008 Ga0500611_020008_126_947 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

150

312

0.88

PF08241

Methyltransf_11

Methyltransferase domain

183

268

0.84

PF13649

Methyltransf_25

Methyltransferase domain

182

268

0.84

PF13847

Methyltransf_31

Methyltransferase domain

176

302

0.83

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

36

313

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9334 80 269
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9329 80 269
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9148 80 269
4lwo-assembly2.cif.gz_G crystal structure of prmt6 0.9138 133 189
4lwp-assembly1.cif.gz_A crystal structure of prmt6-sah 0.912 133 190
ID Description Score Start End Superfamily
af_Q2FXZ4_114_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9619 79 269 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9592 117 269 3.40.50.150
4m36A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9415 137 204 3.40.50.150
3grzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9334 80 269 3.40.50.150
2nxjB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.933 119 269 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6H9LJW5-F1-model_v4 deleted 0.9833 110 269
AF-A0A2M7RW94-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9785 198 269 GO:0005840
GO:0008168
GO:0032259
AF-A0A090W7D0-F1-model_v4 Ribosomal protein L11 methyltransferase 0.9784 84 269 GO:0005840
GO:0008276
GO:0032259
AF-A0A090W7D0-F1-model_v4 Ribosomal protein L11 methyltransferase 0.9732 84 269 GO:0005840
GO:0008276
GO:0032259
AF-F9MS34-F1-model_v4 deleted 0.971 112 268

Feature Viewer

pLDDT pTM Quality
92.59 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map