F395968

General Info

Members Datasets Scaffolds Average Seq Length
301 188 602 246

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10130728|Ga0207640_101307282
Length 280
Sequence LTLKRISKMSNNVNSENKNHLQDEANAQLSTFNSPLNKAIICKNLSKKFGTFKAVDQITFDVAQGEIFGFLGANGAGKTTAIRMLCGLSFPTSGEASVAGFNVYKQQEKIKANIGYMSQKFSLYENLTVLENIEFYGGVYGLSRAEIKKRGDAMINTLGLAKEAKKFVGELPLGWKQKLAFSVAIFHRPKIVFLDEPTGGVDPVTRRQFWDLIYEAAADGITVFVTTHYMDEAEYCNRISIMVDGKVEALDTPSNLKNQFNTHSMDDVFYQLARRAERGE

Samples

Sample ID Description Type Environment
1 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
122 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
167 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
168 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
175 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
176 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
177 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
178 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
179 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
180 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
181 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
182 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
183 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
184 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
185 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
186 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
187 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
188 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 0
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 1
Rhizoplane 0.66
Rhizosphere 86.71
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207640_10130728 3300025981 Bacteria 1815
2 rootH1_10022152 3300003316 Bacteria 6816
3 rootH2_10190400 3300003320 Bacteria 1603
4 rootL2_10129015 3300003322 Bacteria 12337
5 rootH1_10110506 3300003323 Unclassified 4208
6 rootH1_10120013 3300003323 Bacteria 4859
7 rootH1_10178869 3300003323 Bacteria 2357
8 JGI25160J50197_1017155 3300003354 Bacteria 2304
9 Ga0055535_1004292 3300003761 Bacteria 3521
10 Ga0055542_1002688 3300003762 Bacteria 5484
11 Ga0065704_10150477 3300005289 Bacteria 1433
12 Ga0065715_10252852 3300005293 Bacteria 1161
13 Ga0070658_10025494 3300005327 Bacteria 4740
14 Ga0070658_10126965 3300005327 Bacteria 2123
15 Ga0070676_10032342 3300005328 Bacteria 2996
16 Ga0070690_100294723 3300005330 Bacteria 1161
17 Ga0070670_100009051 3300005331 Bacteria 8507
18 Ga0070670_100290551 3300005331 Bacteria 1428
19 Ga0070677_10059203 3300005333 Bacteria 1575
20 Ga0068869_100080018 3300005334 Bacteria 2436
21 Ga0068869_100088749 3300005334 Bacteria 2321
22 Ga0068869_100360430 3300005334 Bacteria 1187
23 Ga0070666_10000393 3300005335 Bacteria 27564
24 Ga0070666_10011544 3300005335 Bacteria 5548
25 Ga0070680_100002195 3300005336 Bacteria 14392
26 Ga0070682_100005068 3300005337 Bacteria 7321
27 Ga0068868_100015300 3300005338 Bacteria 5672
28 Ga0068868_100032671 3300005338 Bacteria 4005
29 Ga0068868_100084084 3300005338 Bacteria 2555
30 Ga0070689_100113400 3300005340 Bacteria 2159
31 Ga0070691_10008092 3300005341 Bacteria 4813
32 Ga0070687_100169844 3300005343 Bacteria 1297
33 Ga0070671_100083939 3300005355 Bacteria 2664
34 Ga0070671_100129417 3300005355 Bacteria 2126
35 Ga0070671_100264077 3300005355 Bacteria 1463
36 Ga0070673_100058155 3300005364 Bacteria 3056
37 Ga0070688_100128742 3300005365 Bacteria 1705
38 Ga0070667_100006365 3300005367 Bacteria 9812
39 Ga0070667_100304778 3300005367 Bacteria 1435
40 Ga0070700_100231171 3300005441 Bacteria 1316
41 Ga0070685_10005648 3300005466 Bacteria 6348
42 Ga0070685_10078452 3300005466 Bacteria 1974
43 Ga0070685_10537784 3300005466 Bacteria 832
44 Ga0070698_100005948 3300005471 Bacteria 13308
45 Ga0070698_100088828 3300005471 Bacteria 3075
46 Ga0070698_100149452 3300005471 Bacteria 2284
47 Ga0070679_100040246 3300005530 Bacteria 4650
48 Ga0068853_100017361 3300005539 Bacteria 5942
49 Ga0068853_100363812 3300005539 Bacteria 1348
50 Ga0068853_100430946 3300005539 Bacteria 1238
51 Ga0070672_100007610 3300005543 Bacteria 7367
52 Ga0068855_100125607 3300005563 Bacteria 2934
53 Ga0068855_100581229 3300005563 Bacteria 1210
54 Ga0070664_100563827 3300005564 Bacteria 1054
55 Ga0068852_100046888 3300005616 Bacteria 3684
56 Ga0068859_100000023 3300005617 Bacteria 221914
57 Ga0068859_100007692 3300005617 Bacteria 10944
58 Ga0068859_100564537 3300005617 Bacteria 1232
59 Ga0068864_100008973 3300005618 Bacteria 8244
60 Ga0068864_100115668 3300005618 Bacteria 2392
61 Ga0068864_100201385 3300005618 Bacteria 1829
62 Ga0068866_10368148 3300005718 Bacteria 918
63 Ga0068851_10062192 3300005834 Bacteria 1915
64 Ga0068851_10201341 3300005834 Bacteria 1111
65 Ga0068851_10244006 3300005834 Bacteria 1017
66 Ga0068863_100000424 3300005841 Bacteria 42794
67 Ga0068863_100003170 3300005841 Bacteria 16256
68 Ga0068863_100238929 3300005841 Bacteria 1753
69 Ga0068863_100397455 3300005841 Bacteria 1348
70 Ga0068858_100002164 3300005842 Bacteria 19931
71 Ga0068858_100585318 3300005842 Bacteria 1082
72 Ga0068860_100000502 3300005843 Bacteria 48523
73 Ga0068860_100007162 3300005843 Bacteria 11159
74 Ga0097621_100042761 3300006237 Bacteria 3651
75 Ga0097621_100077204 3300006237 Bacteria 2765
76 Ga0097621_100222331 3300006237 Bacteria 1646
77 Ga0068871_100002379 3300006358 Bacteria 12828
78 Ga0068871_100006163 3300006358 Bacteria 8454
79 Ga0075428_100540802 3300006844 Bacteria 1245
80 Ga0075428_100556140 3300006844 Bacteria 1226
81 Ga0075431_100005665 3300006847 Bacteria 12346
82 Ga0075431_100048364 3300006847 Bacteria 4387
83 Ga0075429_100224518 3300006880 Bacteria 1645
84 Ga0068865_100051982 3300006881 Bacteria 2838
85 Ga0097620_100000023 3300006931 Bacteria 221914
86 Ga0097620_100007692 3300006931 Bacteria 10944
87 Ga0097620_100564581 3300006931 Bacteria 1232
88 Ga0099824_1014056 3300006942 Bacteria 8094
89 Ga0099826_10001001 3300006948 Bacteria 15817
90 Ga0105240_10010583 3300009093 Bacteria 12959
91 Ga0105240_10846694 3300009093 Bacteria 987
92 Ga0111539_10025941 3300009094 Bacteria 7175
93 Ga0105245_10165877 3300009098 Bacteria 2099
94 Ga0105245_10182586 3300009098 Bacteria 2005
95 Ga0105241_10000527 3300009174 Bacteria 28775
96 Ga0105241_10001033 3300009174 Bacteria 21215
97 Ga0105241_10287233 3300009174 Bacteria 1407
98 Ga0105242_10030492 3300009176 Bacteria 4305
99 Ga0105242_10324278 3300009176 Bacteria 1414
100 Ga0105242_10817294 3300009176 Bacteria 924
101 Ga0105248_10015496 3300009177 Bacteria 8404
102 Ga0105237_10011764 3300009545 Bacteria 9257
103 Ga0105237_10034813 3300009545 Bacteria 5096
104 Ga0105237_10108170 3300009545 Bacteria 2772
105 Ga0105249_10005625 3300009553 Bacteria 10842
106 Ga0105249_10008664 3300009553 Bacteria 8860
107 Ga0105249_10015316 3300009553 Bacteria 6787
108 Ga0105249_10018187 3300009553 Bacteria 6247
109 Ga0105239_10029454 3300010375 Bacteria 6036
110 Ga0105239_10061281 3300010375 Bacteria 4129
111 Ga0105239_10080824 3300010375 Bacteria 3576
112 Ga0157370_10006784 3300013104 Bacteria 12559
113 Ga0157370_10015220 3300013104 Bacteria 7832
114 Ga0157370_10360677 3300013104 Bacteria 1339
115 Ga0157369_10445655 3300013105 Bacteria 1341
116 Ga0157374_10040860 3300013296 Bacteria 4272
117 Ga0157374_10095150 3300013296 Bacteria 2848
118 Ga0157374_10758593 3300013296 Bacteria 985
119 Ga0157378_10002966 3300013297 Bacteria 15095
120 Ga0157378_10007921 3300013297 Bacteria 9270
121 Ga0157378_10012333 3300013297 Bacteria 7483
122 Ga0157378_10068825 3300013297 Bacteria 3174
123 Ga0157378_10155740 3300013297 Bacteria 2133
124 Ga0157378_10357459 3300013297 Bacteria 1428
125 Ga0163162_10003718 3300013306 Bacteria 14620
126 Ga0163162_10015323 3300013306 Bacteria 7489
127 Ga0163162_10028008 3300013306 Bacteria 5573
128 Ga0163162_10031549 3300013306 Bacteria 5256
129 Ga0163162_10218472 3300013306 Bacteria 2036
130 Ga0163162_10336439 3300013306 Bacteria 1642
131 Ga0157372_10334017 3300013307 Bacteria 1765
132 Ga0157375_10019350 3300013308 Bacteria 6192
133 Ga0157375_10096809 3300013308 Bacteria 3025
134 Ga0157375_10139274 3300013308 Bacteria 2552
135 Ga0163163_10073538 3300014325 Bacteria 3409
136 Ga0163163_10121346 3300014325 Bacteria 2648
137 Ga0163163_10166841 3300014325 Bacteria 2248
138 Ga0157380_10002919 3300014326 Bacteria 11621
139 Ga0157380_10024325 3300014326 Bacteria 4582
140 Ga0157380_10068495 3300014326 Bacteria 2860
141 Ga0182008_10057788 3300014497 Bacteria 1915
142 Ga0182008_10096219 3300014497 Bacteria 1461
143 Ga0157379_10440221 3300014968 Bacteria 1202
144 Ga0157379_10466128 3300014968 Bacteria 1168
145 Ga0157376_10009950 3300014969 Bacteria 6937
146 Ga0157376_10023220 3300014969 Bacteria 4852
147 Ga0157376_10080444 3300014969 Bacteria 2795
148 Ga0157376_10250379 3300014969 Bacteria 1654
149 Ga0157376_10538186 3300014969 Bacteria 1154
150 Ga0182007_10036346 3300015262 Bacteria 1657
151 Ga0182007_10039753 3300015262 Bacteria 1572
152 Ga0163161_10111200 3300017792 Bacteria 2048
153 Ga0163161_10115151 3300017792 Bacteria 2015
154 Ga0163161_10173962 3300017792 Bacteria 1647
155 Ga0209258_100036 3300025242 Bacteria 428859
156 Ga0209148_1000230 3300025254 Bacteria 91940
157 Ga0209130_1002448 3300025284 Bacteria 9297
158 Ga0209758_1030088 3300025297 Bacteria 2256
159 Ga0207426_1000026 3300025302 Bacteria 515228
160 Ga0207426_1000135 3300025302 Bacteria 202216
161 Ga0209257_1000001 3300025304 Bacteria 2274655
162 Ga0207656_10039506 3300025321 Bacteria 1996
163 Ga0207680_10000373 3300025903 Bacteria 21488
164 Ga0207680_10001662 3300025903 Bacteria 10508
165 Ga0207645_10017184 3300025907 Bacteria 4778
166 Ga0207705_10027967 3300025909 Bacteria 4020
167 Ga0207707_10001394 3300025912 Bacteria 22410
168 Ga0207695_10031322 3300025913 Bacteria 5835
169 Ga0207671_10021878 3300025914 Bacteria 4844
170 Ga0207671_10032271 3300025914 Bacteria 3899
171 Ga0207660_10003302 3300025917 Bacteria 10550
172 Ga0207662_10198657 3300025918 Bacteria 1297
173 Ga0207657_10182103 3300025919 Bacteria 1698
174 Ga0207652_10002281 3300025921 Bacteria 16273
175 Ga0207681_10047060 3300025923 Bacteria 2904
176 Ga0207650_10079037 3300025925 Bacteria 2490
177 Ga0207650_10478600 3300025925 Bacteria 1039
178 Ga0207687_10199680 3300025927 Bacteria 1562
179 Ga0207644_10408181 3300025931 Bacteria 1111
180 Ga0207644_10509956 3300025931 Bacteria 993
181 Ga0207686_10001650 3300025934 Bacteria 12454
182 Ga0207686_10318654 3300025934 Unclassified 1161
183 Ga0207686_10590955 3300025934 Bacteria 872
184 Ga0207691_10002779 3300025940 Bacteria 17069
185 Ga0207691_10351633 3300025940 Unclassified 1261
186 Ga0207689_10001785 3300025942 Bacteria 20329
187 Ga0207689_10088900 3300025942 Bacteria 2537
188 Ga0207679_10511398 3300025945 Bacteria 1073
189 Ga0207667_10124051 3300025949 Bacteria 2661
190 Ga0207651_10199254 3300025960 Bacteria 1603
191 Ga0207651_10434679 3300025960 Bacteria 1123
192 Ga0207712_10014972 3300025961 Bacteria 4997
193 Ga0207712_10021102 3300025961 Bacteria 4272
194 Ga0207712_10029361 3300025961 Bacteria 3688
195 Ga0207712_10080159 3300025961 Bacteria 2374
196 Ga0207658_10003132 3300025986 Bacteria 11833
197 Ga0207658_10063218 3300025986 Bacteria 2773
198 Ga0207658_10382662 3300025986 Bacteria 1233
199 Ga0207677_10010240 3300026023 Bacteria 5300
200 Ga0207677_10023287 3300026023 Bacteria 3823
201 Ga0207703_10001211 3300026035 Bacteria 24154
202 Ga0207703_10252305 3300026035 Bacteria 1591
203 Ga0207639_10100924 3300026041 Bacteria 2332
204 Ga0207639_10318702 3300026041 Bacteria 1380
205 Ga0207708_10316572 3300026075 Bacteria 1272
206 Ga0207702_10454684 3300026078 Bacteria 1243
207 Ga0207641_10000250 3300026088 Bacteria 68774
208 Ga0207641_10010031 3300026088 Bacteria 7789
209 Ga0207641_10013599 3300026088 Bacteria 6675
210 Ga0207641_10087977 3300026088 Bacteria 2711
211 Ga0207648_10046199 3300026089 Bacteria 3818
212 Ga0207648_10195330 3300026089 Bacteria 1794
213 Ga0207676_10065515 3300026095 Bacteria 2893
214 Ga0207676_10242884 3300026095 Bacteria 1616
215 Ga0207676_10433151 3300026095 Bacteria 1236
216 Ga0207676_10558681 3300026095 Bacteria 1094
217 Ga0207675_100611337 3300026118 Bacteria 1094
218 Ga0207698_10034551 3300026142 Bacteria 3687
219 Ga0209282_1015457 3300027666 Bacteria 4857
220 Ga0268266_10105265 3300028379 Bacteria 2492
221 Ga0268264_10001683 3300028381 Bacteria 20375
222 Ga0268264_10004794 3300028381 Bacteria 11475
223 Ga0307517_10020027 3300028786 Bacteria 8546
224 Ga0316177_1107966 3300030731 Bacteria 2587
225 Ga0316176_1050619 3300030732 Bacteria 7785
226 Ga0314311_1023985 3300030733 Bacteria 1931
227 Ga0316183_1012319 3300030742 Bacteria 42053
228 Ga0316181_1010125 3300030744 Bacteria 44599
229 Ga0373937_0071517 3300036401 Bacteria 3199
230 Ga0373937_0113822 3300036401 Unclassified 2518
231 Ga0316584_0050958 3300036712 Bacteria 3095
232 Ga0466972_0000019 3300044658 Bacteria 198523
233 Ga0453683_0047628 3300044673 Bacteria 2688
234 Ga0495627_000025 3300046453 Bacteria 248825
235 Ga0495629_0079610 3300046459 Bacteria 2288
236 Ga0495662_0095465 3300046476 Bacteria 1453
237 Ga0495585_0001318 3300046492 Bacteria 19742
238 Ga0495652_0224171 3300046529 Bacteria 1411
239 Ga0495654_0000099 3300046530 Bacteria 98758
240 Ga0495586_0059436 3300046535 Bacteria 2077
241 Ga0495633_0000108 3300046558 Bacteria 111235
242 Ga0495657_0151870 3300046675 Bacteria 1438
243 Ga0495658_0005007 3300046683 Bacteria 6505
244 Ga0495670_0025392 3300046691 Bacteria 2931
245 Ga0495581_0243363 3300047315 Bacteria 1052
246 Ga0495674_0175891 3300047319 Bacteria 1784
247 Ga0495672_0166274 3300047320 Bacteria 1129
248 Ga0495676_0250356 3300047321 Bacteria 1209
249 Ga0495684_0093242 3300047471 Bacteria 2281
250 Ga0495686_0015579 3300047472 Bacteria 5185
251 Ga0496109_0089428 3300048912 Bacteria 2847
252 Ga0496115_0178918 3300048918 Bacteria 1754
253 Ga0496126_0034305 3300048929 Bacteria 4766
254 Ga0501032_0027794 3300049569 Bacteria 3887
255 Ga0501032_0035954 3300049569 Bacteria 3383
256 Ga0501034_0006827 3300049571 Bacteria 12211
257 Ga0501034_0019303 3300049571 Bacteria 6976
258 Ga0501034_0298852 3300049571 Bacteria 1547
259 Ga0501043_0106122 3300049579 Bacteria 2206
260 Ga0501046_0017485 3300049580 Bacteria 5982
261 Ga0501046_0192438 3300049580 Bacteria 1521
262 Ga0501048_0058369 3300049582 Bacteria 2735
263 Ga0501069_0280181 3300049585 Bacteria 975
264 Ga0501070_0101891 3300049586 Bacteria 2374
265 Ga0501071_0281364 3300049587 Bacteria 1259
266 Ga0501074_0004884 3300049590 Bacteria 9613
267 Ga0501257_003519 3300049686 Bacteria 3368
268 Ga0501080_0429161 3300049742 Bacteria 1186
269 Ga0501083_0018911 3300049744 Bacteria 4794
270 Ga0501044_0153433 3300049823 Bacteria 2284
271 Ga0501044_0211958 3300049823 Bacteria 1891
272 nmdc:mga05p37_63898_c1 3300050507 Bacteria 4530
273 nmdc:mga09592_216398_c1 3300050508 Bacteria 1660
274 nmdc:mga06r32_49565_c1 3300050510 Bacteria 4016
275 nmdc:mga08y16_150747_c1 3300050511 Bacteria 2417
276 Ga0500578_0017102 3300053086 Bacteria 4661
277 Ga0500578_0301047 3300053086 Bacteria 951
278 Ga0500644_0000071 3300053088 Bacteria 60641
279 Ga0500650_0157818 3300053098 Unclassified 1047
280 Ga0500607_054262 3300053121 Bacteria 2123
281 Ga0500588_0002623 3300053146 Bacteria 3689
282 Ga0500622_0000129 3300053156 Bacteria 79535
283 Ga0500622_0007274 3300053156 Bacteria 6304
284 Ga0500634_0022456 3300053161 Bacteria 3425
285 Ga0501084_0019212 3300054114 Bacteria 5691
286 Ga0501082_0138963 3300060353 Bacteria 2108
287 2585141431 2582581278 Bacteria 5296881
288 2587942143 2585428115 Bacteria 4420269
289 2588215210 2585428183 Bacteria 5166119
290 2729199446 2728369107 Bacteria 5082720
291 2740033497 2739367866 Bacteria 4215900
292 2740057812 2739367874 Bacteria 4872888
293 2765572779 2765235839 Bacteria 5314748
294 2819678494 2818991460 Bacteria 7595395
295 2842904172 2842903701 Bacteria 6986368
296 2903899511 2903895155 Bacteria 5258610
297 2929180756 2929177148 Bacteria 7883697
298 2929244397 2929239360 Bacteria 7745570
299 2945983152 2945977869 Bacteria 7777518
300 2946017456 2946013367 Bacteria 7766675
301 2958461665 2958458903 Bacteria 5301041
302 Ga0207640_10130728
303 rootH1_10022152
304 rootH2_10190400
305 rootL2_10129015
306 rootH1_10110506
307 rootH1_10120013
308 rootH1_10178869
309 JGI25160J50197_1017155
310 Ga0055535_1004292
311 Ga0055542_1002688
312 Ga0065704_10150477
313 Ga0065715_10252852
314 Ga0070658_10025494
315 Ga0070658_10126965
316 Ga0070676_10032342
317 Ga0070690_100294723
318 Ga0070670_100009051
319 Ga0070670_100290551
320 Ga0070677_10059203
321 Ga0068869_100080018
322 Ga0068869_100088749
323 Ga0068869_100360430
324 Ga0070666_10000393
325 Ga0070666_10011544
326 Ga0070680_100002195
327 Ga0070682_100005068
328 Ga0068868_100015300
329 Ga0068868_100032671
330 Ga0068868_100084084
331 Ga0070689_100113400
332 Ga0070691_10008092
333 Ga0070687_100169844
334 Ga0070671_100083939
335 Ga0070671_100129417
336 Ga0070671_100264077
337 Ga0070673_100058155
338 Ga0070688_100128742
339 Ga0070667_100006365
340 Ga0070667_100304778
341 Ga0070700_100231171
342 Ga0070685_10005648
343 Ga0070685_10078452
344 Ga0070685_10537784
345 Ga0070698_100005948
346 Ga0070698_100088828
347 Ga0070698_100149452
348 Ga0070679_100040246
349 Ga0068853_100017361
350 Ga0068853_100363812
351 Ga0068853_100430946
352 Ga0070672_100007610
353 Ga0068855_100125607
354 Ga0068855_100581229
355 Ga0070664_100563827
356 Ga0068852_100046888
357 Ga0068859_100000023
358 Ga0068859_100007692
359 Ga0068859_100564537
360 Ga0068864_100008973
361 Ga0068864_100115668
362 Ga0068864_100201385
363 Ga0068866_10368148
364 Ga0068851_10062192
365 Ga0068851_10201341
366 Ga0068851_10244006
367 Ga0068863_100000424
368 Ga0068863_100003170
369 Ga0068863_100238929
370 Ga0068863_100397455
371 Ga0068858_100002164
372 Ga0068858_100585318
373 Ga0068860_100000502
374 Ga0068860_100007162
375 Ga0097621_100042761
376 Ga0097621_100077204
377 Ga0097621_100222331
378 Ga0068871_100002379
379 Ga0068871_100006163
380 Ga0075428_100540802
381 Ga0075428_100556140
382 Ga0075431_100005665
383 Ga0075431_100048364
384 Ga0075429_100224518
385 Ga0068865_100051982
386 Ga0097620_100000023
387 Ga0097620_100007692
388 Ga0097620_100564581
389 Ga0099824_1014056
390 Ga0099826_10001001
391 Ga0105240_10010583
392 Ga0105240_10846694
393 Ga0111539_10025941
394 Ga0105245_10165877
395 Ga0105245_10182586
396 Ga0105241_10000527
397 Ga0105241_10001033
398 Ga0105241_10287233
399 Ga0105242_10030492
400 Ga0105242_10324278
401 Ga0105242_10817294
402 Ga0105248_10015496
403 Ga0105237_10011764
404 Ga0105237_10034813
405 Ga0105237_10108170
406 Ga0105249_10005625
407 Ga0105249_10008664
408 Ga0105249_10015316
409 Ga0105249_10018187
410 Ga0105239_10029454
411 Ga0105239_10061281
412 Ga0105239_10080824
413 Ga0157370_10006784
414 Ga0157370_10015220
415 Ga0157370_10360677
416 Ga0157369_10445655
417 Ga0157374_10040860
418 Ga0157374_10095150
419 Ga0157374_10758593
420 Ga0157378_10002966
421 Ga0157378_10007921
422 Ga0157378_10012333
423 Ga0157378_10068825
424 Ga0157378_10155740
425 Ga0157378_10357459
426 Ga0163162_10003718
427 Ga0163162_10015323
428 Ga0163162_10028008
429 Ga0163162_10031549
430 Ga0163162_10218472
431 Ga0163162_10336439
432 Ga0157372_10334017
433 Ga0157375_10019350
434 Ga0157375_10096809
435 Ga0157375_10139274
436 Ga0163163_10073538
437 Ga0163163_10121346
438 Ga0163163_10166841
439 Ga0157380_10002919
440 Ga0157380_10024325
441 Ga0157380_10068495
442 Ga0182008_10057788
443 Ga0182008_10096219
444 Ga0157379_10440221
445 Ga0157379_10466128
446 Ga0157376_10009950
447 Ga0157376_10023220
448 Ga0157376_10080444
449 Ga0157376_10250379
450 Ga0157376_10538186
451 Ga0182007_10036346
452 Ga0182007_10039753
453 Ga0163161_10111200
454 Ga0163161_10115151
455 Ga0163161_10173962
456 Ga0209258_100036
457 Ga0209148_1000230
458 Ga0209130_1002448
459 Ga0209758_1030088
460 Ga0207426_1000026
461 Ga0207426_1000135
462 Ga0209257_1000001
463 Ga0207656_10039506
464 Ga0207680_10000373
465 Ga0207680_10001662
466 Ga0207645_10017184
467 Ga0207705_10027967
468 Ga0207707_10001394
469 Ga0207695_10031322
470 Ga0207671_10021878
471 Ga0207671_10032271
472 Ga0207660_10003302
473 Ga0207662_10198657
474 Ga0207657_10182103
475 Ga0207652_10002281
476 Ga0207681_10047060
477 Ga0207650_10079037
478 Ga0207650_10478600
479 Ga0207687_10199680
480 Ga0207644_10408181
481 Ga0207644_10509956
482 Ga0207686_10001650
483 Ga0207686_10318654
484 Ga0207686_10590955
485 Ga0207691_10002779
486 Ga0207691_10351633
487 Ga0207689_10001785
488 Ga0207689_10088900
489 Ga0207679_10511398
490 Ga0207667_10124051
491 Ga0207651_10199254
492 Ga0207651_10434679
493 Ga0207712_10014972
494 Ga0207712_10021102
495 Ga0207712_10029361
496 Ga0207712_10080159
497 Ga0207658_10003132
498 Ga0207658_10063218
499 Ga0207658_10382662
500 Ga0207677_10010240
501 Ga0207677_10023287
502 Ga0207703_10001211
503 Ga0207703_10252305
504 Ga0207639_10100924
505 Ga0207639_10318702
506 Ga0207708_10316572
507 Ga0207702_10454684
508 Ga0207641_10000250
509 Ga0207641_10010031
510 Ga0207641_10013599
511 Ga0207641_10087977
512 Ga0207648_10046199
513 Ga0207648_10195330
514 Ga0207676_10065515
515 Ga0207676_10242884
516 Ga0207676_10433151
517 Ga0207676_10558681
518 Ga0207675_100611337
519 Ga0207698_10034551
520 Ga0209282_1015457
521 Ga0268266_10105265
522 Ga0268264_10001683
523 Ga0268264_10004794
524 Ga0307517_10020027
525 Ga0316177_1107966
526 Ga0316176_1050619
527 Ga0314311_1023985
528 Ga0316183_1012319
529 Ga0316181_1010125
530 Ga0373937_0071517
531 Ga0373937_0113822
532 Ga0316584_0050958
533 Ga0466972_0000019
534 Ga0453683_0047628
535 Ga0495627_000025
536 Ga0495629_0079610
537 Ga0495662_0095465
538 Ga0495585_0001318
539 Ga0495652_0224171
540 Ga0495654_0000099
541 Ga0495586_0059436
542 Ga0495633_0000108
543 Ga0495657_0151870
544 Ga0495658_0005007
545 Ga0495670_0025392
546 Ga0495581_0243363
547 Ga0495674_0175891
548 Ga0495672_0166274
549 Ga0495676_0250356
550 Ga0495684_0093242
551 Ga0495686_0015579
552 Ga0496109_0089428
553 Ga0496115_0178918
554 Ga0496126_0034305
555 Ga0501032_0027794
556 Ga0501032_0035954
557 Ga0501034_0006827
558 Ga0501034_0019303
559 Ga0501034_0298852
560 Ga0501043_0106122
561 Ga0501046_0017485
562 Ga0501046_0192438
563 Ga0501048_0058369
564 Ga0501069_0280181
565 Ga0501070_0101891
566 Ga0501071_0281364
567 Ga0501074_0004884
568 Ga0501257_003519
569 Ga0501080_0429161
570 Ga0501083_0018911
571 Ga0501044_0153433
572 Ga0501044_0211958
573 nmdc:mga05p37_63898_c1
574 nmdc:mga09592_216398_c1
575 nmdc:mga06r32_49565_c1
576 nmdc:mga08y16_150747_c1
577 Ga0500578_0017102
578 Ga0500578_0301047
579 Ga0500644_0000071
580 Ga0500650_0157818
581 Ga0500607_054262
582 Ga0500588_0002623
583 Ga0500622_0000129
584 Ga0500622_0007274
585 Ga0500634_0022456
586 Ga0501084_0019212
587 Ga0501082_0138963
588 2585141431
589 2587942143
590 2588215210
591 2729199446
592 2740033497
593 2740057812
594 2765572779
595 2819678494
596 2842904172
597 2903899511
598 2929180756
599 2929244397
600 2945983152
601 2946017456
602 2958461665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

199

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

168

230

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9505 1 223
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9461 1 216
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9428 2 224
7w01-assembly1.cif.gz_A cryo-em structure of nucleotide-free abca3 0.9408 3 224
7e7i-assembly1.cif.gz_A cryo-em structure of human abca4 in the apo state 0.9389 1 224
ID Description Score Start End Superfamily
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9556 2 222 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9543 2 235 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9527 1 227 3.40.50.300
af_Q8T5Z7_540_794_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 3 227 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9515 2 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7G9REB6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9761 2 223 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A428Z536-F1-model_v4 Transport permease protein 0.9756 1 223 GO:0005524
GO:0005886
GO:0016887
GO:0043215
GO:0046677
GO:0140359
GO:1900753
AF-A0A7C5MH17-F1-model_v4 ABC transporter ATP-binding protein 0.9676 1 224 GO:0005524
GO:0016887
AF-A0A4Y3RI34-F1-model_v4 Daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein 0.9669 3 223 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-N8YDR0-F1-model_v4 ABC transporter domain-containing protein 0.965 1 223 GO:0005524
GO:0016887

Map