F395963
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 173 | 301 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300025942|Ga0207689_10186558|Ga0207689_101865582 |
| Length | 328 |
| Sequence | MASPVRHPAVAGRFYPRDRDDLRAEVEFYLSPPQKTVPALGCVVPHAGYMYSGHVAGAVYARLDVPQRSILMCPNHTGMGHPLSIMSVGAWDTPLGRVSIDAELAAELKRRFTPLGEDSEAHRAEHGAEVQLPFLQVRNPQCSFVPIALGTSQFELLQGLGEAIADAVWALGERVLLIASSDMNHYENDTITRVKDQKAIERILVMDARGLFDVVMDEDISMCGFGPTVAMLTAARRLGAVSTDLVRYATSGDVSGDRDFALDLLLIKIRDGVALIDAEKAVRGSGGEEQPGGERCLTGIAVAHHTDVPNVLAFVDFHWRVSRLKTEW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 145 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.64 |
| Rhizosphere | 91.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_6047714 | 2162886012 | Bacteria | 2922 |
| 2 | rootH1_10404163 | 3300003323 | Bacteria | 1183 |
| 3 | Ga0065712_10003628 | 3300005290 | Bacteria | 5983 |
| 4 | Ga0070676_10003362 | 3300005328 | Bacteria | 8325 |
| 5 | Ga0070683_100010980 | 3300005329 | Bacteria | 7803 |
| 6 | Ga0070666_10030297 | 3300005335 | Bacteria | 3563 |
| 7 | Ga0070680_100212172 | 3300005336 | Bacteria | 1633 |
| 8 | Ga0068868_100006717 | 3300005338 | Bacteria | 8165 |
| 9 | Ga0070660_100018690 | 3300005339 | Bacteria | 5068 |
| 10 | Ga0070661_100008680 | 3300005344 | Bacteria | 7032 |
| 11 | Ga0070668_100052769 | 3300005347 | Bacteria | 3135 |
| 12 | Ga0070669_100058514 | 3300005353 | Bacteria | 2828 |
| 13 | Ga0070671_100377879 | 3300005355 | Unclassified | 1211 |
| 14 | Ga0070659_100016405 | 3300005366 | Bacteria | 5561 |
| 15 | Ga0070659_100030662 | 3300005366 | Bacteria | 4162 |
| 16 | Ga0070667_100004110 | 3300005367 | Bacteria | 12322 |
| 17 | Ga0070709_10011780 | 3300005434 | Bacteria | 4882 |
| 18 | Ga0070709_10047505 | 3300005434 | Unclassified | 2674 |
| 19 | Ga0070714_100419065 | 3300005435 | Bacteria | 1268 |
| 20 | Ga0070714_100530623 | 3300005435 | Bacteria | 1125 |
| 21 | Ga0070713_100022625 | 3300005436 | Bacteria | 4860 |
| 22 | Ga0070713_100041732 | 3300005436 | Unclassified | 3740 |
| 23 | Ga0070713_100139799 | 3300005436 | Bacteria | 2144 |
| 24 | Ga0070713_100194280 | 3300005436 | Bacteria | 1830 |
| 25 | Ga0070713_100288137 | 3300005436 | Bacteria | 1508 |
| 26 | Ga0070713_100325481 | 3300005436 | Unclassified | 1420 |
| 27 | Ga0070710_10072151 | 3300005437 | Unclassified | 1993 |
| 28 | Ga0070710_10097368 | 3300005437 | Bacteria | 1746 |
| 29 | Ga0070710_10201163 | 3300005437 | Unclassified | 1258 |
| 30 | Ga0070711_100029520 | 3300005439 | Unclassified | 3619 |
| 31 | Ga0070711_100134274 | 3300005439 | Unclassified | 1847 |
| 32 | Ga0070694_100060353 | 3300005444 | Bacteria | 2586 |
| 33 | Ga0070708_100000298 | 3300005445 | Bacteria | 37307 |
| 34 | Ga0070708_100017425 | 3300005445 | Bacteria | 5991 |
| 35 | Ga0070708_100031102 | 3300005445 | Bacteria | 4618 |
| 36 | Ga0070663_100027656 | 3300005455 | Bacteria | 3853 |
| 37 | Ga0070678_100021305 | 3300005456 | Bacteria | 4272 |
| 38 | Ga0070662_100018503 | 3300005457 | Bacteria | 4713 |
| 39 | Ga0070662_100307489 | 3300005457 | Bacteria | 1290 |
| 40 | Ga0070681_10680370 | 3300005458 | Bacteria | 944 |
| 41 | Ga0068867_100211616 | 3300005459 | Bacteria | 1557 |
| 42 | Ga0070706_100000529 | 3300005467 | Bacteria | 44433 |
| 43 | Ga0070706_100042911 | 3300005467 | Bacteria | 4178 |
| 44 | Ga0070707_100006081 | 3300005468 | Bacteria | 11261 |
| 45 | Ga0070707_100041846 | 3300005468 | Bacteria | 4385 |
| 46 | Ga0070707_100294300 | 3300005468 | Unclassified | 1577 |
| 47 | Ga0070698_100000171 | 3300005471 | Bacteria | 60242 |
| 48 | Ga0070698_100075335 | 3300005471 | Unclassified | 3378 |
| 49 | Ga0070699_100020718 | 3300005518 | Bacteria | 5671 |
| 50 | Ga0070699_100096264 | 3300005518 | Bacteria | 2592 |
| 51 | Ga0070679_100307562 | 3300005530 | Bacteria | 1535 |
| 52 | Ga0070679_100518165 | 3300005530 | Unclassified | 1136 |
| 53 | Ga0070684_100033500 | 3300005535 | Bacteria | 4386 |
| 54 | Ga0070684_100211335 | 3300005535 | Bacteria | 1768 |
| 55 | Ga0070697_100000054 | 3300005536 | Bacteria | 88022 |
| 56 | Ga0070697_100047363 | 3300005536 | Unclassified | 3485 |
| 57 | Ga0070697_100234813 | 3300005536 | Bacteria | 1565 |
| 58 | Ga0068853_100175016 | 3300005539 | Bacteria | 1943 |
| 59 | Ga0070696_100235641 | 3300005546 | Bacteria | 1378 |
| 60 | Ga0070665_100033884 | 3300005548 | Bacteria | 5137 |
| 61 | Ga0070664_100153272 | 3300005564 | Bacteria | 2035 |
| 62 | Ga0070664_100421518 | 3300005564 | Bacteria | 1222 |
| 63 | Ga0068854_100084687 | 3300005578 | Unclassified | 2346 |
| 64 | Ga0068854_100310568 | 3300005578 | Bacteria | 1278 |
| 65 | Ga0068856_100107046 | 3300005614 | Bacteria | 2791 |
| 66 | Ga0068852_100008382 | 3300005616 | Bacteria | 7617 |
| 67 | Ga0068852_100309332 | 3300005616 | Bacteria | 1532 |
| 68 | Ga0068859_100034026 | 3300005617 | Bacteria | 5116 |
| 69 | Ga0068864_100280587 | 3300005618 | Bacteria | 1555 |
| 70 | Ga0068866_10036677 | 3300005718 | Bacteria | 2403 |
| 71 | Ga0068851_10009864 | 3300005834 | Bacteria | 4447 |
| 72 | Ga0068851_10025635 | 3300005834 | Bacteria | 2894 |
| 73 | Ga0068863_100019773 | 3300005841 | Bacteria | 6440 |
| 74 | Ga0068863_100397424 | 3300005841 | Bacteria | 1348 |
| 75 | Ga0068858_100015899 | 3300005842 | Bacteria | 7071 |
| 76 | Ga0068858_100091029 | 3300005842 | Bacteria | 2839 |
| 77 | Ga0068860_100009175 | 3300005843 | Bacteria | 9833 |
| 78 | Ga0068860_100490568 | 3300005843 | Bacteria | 1225 |
| 79 | Ga0068862_100019123 | 3300005844 | Bacteria | 5712 |
| 80 | Ga0070717_10003073 | 3300006028 | Bacteria | 11898 |
| 81 | Ga0070717_10017657 | 3300006028 | Bacteria | 5555 |
| 82 | Ga0070717_10378579 | 3300006028 | Unclassified | 1269 |
| 83 | Ga0070717_10409508 | 3300006028 | Unclassified | 1219 |
| 84 | Ga0070717_10548013 | 3300006028 | Bacteria | 1047 |
| 85 | Ga0070715_10001215 | 3300006163 | Bacteria | 7408 |
| 86 | Ga0070716_100033022 | 3300006173 | Bacteria | 2828 |
| 87 | Ga0070716_100085684 | 3300006173 | Unclassified | 1893 |
| 88 | Ga0070716_100193350 | 3300006173 | Bacteria | 1346 |
| 89 | Ga0070712_100000624 | 3300006175 | Bacteria | 20825 |
| 90 | Ga0070712_100012811 | 3300006175 | Bacteria | 5338 |
| 91 | Ga0097621_100035806 | 3300006237 | Bacteria | 3968 |
| 92 | Ga0097621_100051250 | 3300006237 | Bacteria | 3358 |
| 93 | Ga0097621_100075255 | 3300006237 | Bacteria | 2798 |
| 94 | Ga0097621_100602856 | 3300006237 | Unclassified | 1004 |
| 95 | Ga0068871_100011680 | 3300006358 | Bacteria | 6449 |
| 96 | Ga0068871_100075971 | 3300006358 | Bacteria | 2774 |
| 97 | Ga0068871_100148504 | 3300006358 | Bacteria | 1998 |
| 98 | Ga0075428_100005245 | 3300006844 | Bacteria | 14413 |
| 99 | Ga0075431_100072087 | 3300006847 | Bacteria | 3564 |
| 100 | Ga0075431_100119465 | 3300006847 | Unclassified | 2720 |
| 101 | Ga0075433_10003272 | 3300006852 | Bacteria | 12508 |
| 102 | Ga0075433_10005559 | 3300006852 | Bacteria | 9898 |
| 103 | Ga0075433_10088716 | 3300006852 | Bacteria | 2733 |
| 104 | Ga0075434_100009603 | 3300006871 | Bacteria | 9033 |
| 105 | Ga0075434_100017175 | 3300006871 | Bacteria | 6967 |
| 106 | Ga0075434_100023195 | 3300006871 | Bacteria | 6046 |
| 107 | Ga0075434_100464204 | 3300006871 | Bacteria | 1287 |
| 108 | Ga0068865_100329613 | 3300006881 | Bacteria | 1230 |
| 109 | Ga0075436_100000367 | 3300006914 | Bacteria | 28887 |
| 110 | Ga0075436_100011060 | 3300006914 | Bacteria | 6191 |
| 111 | Ga0075436_100036830 | 3300006914 | Bacteria | 3378 |
| 112 | Ga0075436_100056138 | 3300006914 | Bacteria | 2720 |
| 113 | Ga0097620_100034027 | 3300006931 | Bacteria | 5116 |
| 114 | Ga0075435_100000357 | 3300007076 | Bacteria | 27987 |
| 115 | Ga0105240_10029062 | 3300009093 | Bacteria | 7208 |
| 116 | Ga0105240_10059590 | 3300009093 | Bacteria | 4763 |
| 117 | Ga0105240_10221687 | 3300009093 | Unclassified | 2203 |
| 118 | Ga0105240_10243350 | 3300009093 | Bacteria | 2084 |
| 119 | Ga0105247_10048726 | 3300009101 | Bacteria | 2603 |
| 120 | Ga0105247_10093619 | 3300009101 | Unclassified | 1910 |
| 121 | Ga0114129_10050033 | 3300009147 | Bacteria | 5871 |
| 122 | Ga0114129_10109519 | 3300009147 | Bacteria | 3813 |
| 123 | Ga0114129_10307384 | 3300009147 | Bacteria | 2111 |
| 124 | Ga0105243_10108711 | 3300009148 | Bacteria | 2315 |
| 125 | Ga0105241_10018088 | 3300009174 | Bacteria | 5182 |
| 126 | Ga0105241_10256345 | 3300009174 | Bacteria | 1485 |
| 127 | Ga0105242_10186054 | 3300009176 | Bacteria | 1835 |
| 128 | Ga0105242_10196835 | 3300009176 | Bacteria | 1787 |
| 129 | Ga0105248_10079686 | 3300009177 | Bacteria | 3681 |
| 130 | Ga0105237_10191698 | 3300009545 | Unclassified | 2044 |
| 131 | Ga0105237_10194142 | 3300009545 | Bacteria | 2030 |
| 132 | Ga0105238_10390864 | 3300009551 | Bacteria | 1383 |
| 133 | Ga0105249_10016918 | 3300009553 | Bacteria | 6471 |
| 134 | Ga0105239_10655607 | 3300010375 | Bacteria | 1199 |
| 135 | Ga0105246_10044143 | 3300011119 | Unclassified | 3028 |
| 136 | Ga0157373_10001224 | 3300013100 | Bacteria | 19643 |
| 137 | Ga0157369_10118745 | 3300013105 | Bacteria | 2807 |
| 138 | Ga0157374_10018109 | 3300013296 | Bacteria | 6212 |
| 139 | Ga0157374_10280447 | 3300013296 | Bacteria | 1645 |
| 140 | Ga0157378_10094409 | 3300013297 | Bacteria | 2724 |
| 141 | Ga0163162_10021711 | 3300013306 | Bacteria | 6323 |
| 142 | Ga0163162_10247942 | 3300013306 | Bacteria | 1913 |
| 143 | Ga0157372_10002375 | 3300013307 | Bacteria | 20375 |
| 144 | Ga0157372_10018387 | 3300013307 | Bacteria | 7512 |
| 145 | Ga0157372_10129751 | 3300013307 | Bacteria | 2899 |
| 146 | Ga0157375_10179111 | 3300013308 | Bacteria | 2270 |
| 147 | Ga0163163_10022035 | 3300014325 | Bacteria | 6024 |
| 148 | Ga0163163_10223083 | 3300014325 | Unclassified | 1934 |
| 149 | Ga0182008_10015893 | 3300014497 | Bacteria | 3918 |
| 150 | Ga0157379_10005147 | 3300014968 | Bacteria | 11224 |
| 151 | Ga0157379_10292980 | 3300014968 | Bacteria | 1482 |
| 152 | Ga0182007_10002727 | 3300015262 | Bacteria | 8638 |
| 153 | Ga0182005_1009564 | 3300015265 | Bacteria | 2816 |
| 154 | Ga0207692_10041808 | 3300025898 | Unclassified | 2272 |
| 155 | Ga0207642_10170856 | 3300025899 | Bacteria | 1176 |
| 156 | Ga0207710_10029441 | 3300025900 | Bacteria | 2390 |
| 157 | Ga0207680_10110814 | 3300025903 | Unclassified | 1780 |
| 158 | Ga0207685_10005386 | 3300025905 | Bacteria | 3373 |
| 159 | Ga0207685_10124191 | 3300025905 | Bacteria | 1137 |
| 160 | Ga0207699_10009737 | 3300025906 | Bacteria | 4797 |
| 161 | Ga0207699_10020463 | 3300025906 | Unclassified | 3547 |
| 162 | Ga0207699_10047165 | 3300025906 | Bacteria | 2525 |
| 163 | Ga0207645_10003674 | 3300025907 | Bacteria | 11569 |
| 164 | Ga0207684_10000702 | 3300025910 | Bacteria | 39479 |
| 165 | Ga0207684_10041127 | 3300025910 | Unclassified | 3921 |
| 166 | Ga0207654_10002903 | 3300025911 | Bacteria | 8686 |
| 167 | Ga0207654_10003653 | 3300025911 | Bacteria | 7757 |
| 168 | Ga0207654_10010827 | 3300025911 | Bacteria | 4643 |
| 169 | Ga0207707_10012920 | 3300025912 | Bacteria | 7268 |
| 170 | Ga0207707_10170787 | 3300025912 | Bacteria | 1900 |
| 171 | Ga0207707_10347282 | 3300025912 | Bacteria | 1279 |
| 172 | Ga0207695_10033324 | 3300025913 | Bacteria | 5620 |
| 173 | Ga0207695_10043117 | 3300025913 | Bacteria | 4811 |
| 174 | Ga0207695_10129302 | 3300025913 | Bacteria | 2484 |
| 175 | Ga0207671_10022859 | 3300025914 | Bacteria | 4721 |
| 176 | Ga0207693_10000173 | 3300025915 | Bacteria | 58862 |
| 177 | Ga0207693_10014694 | 3300025915 | Bacteria | 6290 |
| 178 | Ga0207693_10121195 | 3300025915 | Bacteria | 2054 |
| 179 | Ga0207693_10250125 | 3300025915 | Bacteria | 1391 |
| 180 | Ga0207663_10100890 | 3300025916 | Bacteria | 1938 |
| 181 | Ga0207663_10126973 | 3300025916 | Unclassified | 1756 |
| 182 | Ga0207663_10131899 | 3300025916 | Bacteria | 1728 |
| 183 | Ga0207660_10028785 | 3300025917 | Bacteria | 3804 |
| 184 | Ga0207657_10000215 | 3300025919 | Bacteria | 60239 |
| 185 | Ga0207649_10031565 | 3300025920 | Bacteria | 3150 |
| 186 | Ga0207649_10286543 | 3300025920 | Bacteria | 1199 |
| 187 | Ga0207646_10005506 | 3300025922 | Bacteria | 13307 |
| 188 | Ga0207646_10030672 | 3300025922 | Bacteria | 4871 |
| 189 | Ga0207646_10131197 | 3300025922 | Unclassified | 2255 |
| 190 | Ga0207687_10001479 | 3300025927 | Bacteria | 16100 |
| 191 | Ga0207687_10037245 | 3300025927 | Bacteria | 3317 |
| 192 | Ga0207700_10020713 | 3300025928 | Bacteria | 4474 |
| 193 | Ga0207700_10085447 | 3300025928 | Bacteria | 2476 |
| 194 | Ga0207700_10154454 | 3300025928 | Bacteria | 1900 |
| 195 | Ga0207700_10316752 | 3300025928 | Bacteria | 1351 |
| 196 | Ga0207664_10026515 | 3300025929 | Unclassified | 4382 |
| 197 | Ga0207664_10092031 | 3300025929 | Bacteria | 2488 |
| 198 | Ga0207664_10134988 | 3300025929 | Bacteria | 2081 |
| 199 | Ga0207644_10329053 | 3300025931 | Unclassified | 1237 |
| 200 | Ga0207690_10151365 | 3300025932 | Bacteria | 1720 |
| 201 | Ga0207706_10004908 | 3300025933 | Bacteria | 12508 |
| 202 | Ga0207706_10019278 | 3300025933 | Bacteria | 6135 |
| 203 | Ga0207686_10129792 | 3300025934 | Bacteria | 1727 |
| 204 | Ga0207709_10111224 | 3300025935 | Bacteria | 1832 |
| 205 | Ga0207665_10080245 | 3300025939 | Unclassified | 2244 |
| 206 | Ga0207665_10122235 | 3300025939 | Bacteria | 1840 |
| 207 | Ga0207665_10179016 | 3300025939 | Unclassified | 1535 |
| 208 | Ga0207665_10553608 | 3300025939 | Unclassified | 894 |
| 209 | Ga0207711_10025317 | 3300025941 | Bacteria | 4979 |
| 210 | Ga0207711_10230301 | 3300025941 | Bacteria | 1697 |
| 211 | Ga0207689_10186558 | 3300025942 | Unclassified | 1711 |
| 212 | Ga0207689_10523349 | 3300025942 | Bacteria | 995 |
| 213 | Ga0207679_10014735 | 3300025945 | Bacteria | 5149 |
| 214 | Ga0207679_10592333 | 3300025945 | Bacteria | 998 |
| 215 | Ga0207712_10486567 | 3300025961 | Bacteria | 1053 |
| 216 | Ga0207668_10041205 | 3300025972 | Bacteria | 3120 |
| 217 | Ga0207640_10016000 | 3300025981 | Bacteria | 4354 |
| 218 | Ga0207677_10072688 | 3300026023 | Bacteria | 2432 |
| 219 | Ga0207703_10573221 | 3300026035 | Bacteria | 1066 |
| 220 | Ga0207678_10000874 | 3300026067 | Bacteria | 27662 |
| 221 | Ga0207702_10002369 | 3300026078 | Bacteria | 17997 |
| 222 | Ga0207702_10214569 | 3300026078 | Bacteria | 1791 |
| 223 | Ga0207648_10017065 | 3300026089 | Bacteria | 6618 |
| 224 | Ga0207674_10448564 | 3300026116 | Bacteria | 1247 |
| 225 | Ga0207683_10020514 | 3300026121 | Bacteria | 5653 |
| 226 | Ga0207698_10043325 | 3300026142 | Bacteria | 3370 |
| 227 | Ga0268266_10025409 | 3300028379 | Bacteria | 5039 |
| 228 | Ga0268264_10093079 | 3300028381 | Bacteria | 2603 |
| 229 | Ga0265338_10260179 | 3300028800 | Bacteria | 1276 |
| 230 | Ga0265340_10005319 | 3300031247 | Bacteria | 7148 |
| 231 | Ga0307412_10143735 | 3300031911 | Bacteria | 1751 |
| 232 | Ga0307411_10111748 | 3300032005 | Bacteria | 1957 |
| 233 | Ga0373948_0014649 | 3300034817 | Bacteria | 1431 |
| 234 | Ga0373942_0004055 | 3300035207 | Bacteria | 3418 |
| 235 | Ga0373931_0035901 | 3300035691 | Bacteria | 2580 |
| 236 | Ga0373935_0037868 | 3300035692 | Unclassified | 3019 |
| 237 | Ga0373927_0028986 | 3300035695 | Bacteria | 3609 |
| 238 | Ga0373937_0092387 | 3300036401 | Bacteria | 2805 |
| 239 | Ga0373937_0292798 | 3300036401 | Bacteria | 1538 |
| 240 | Ga0373925_0126705 | 3300037068 | Unclassified | 1987 |
| 241 | Ga0373925_0533008 | 3300037068 | Unclassified | 965 |
| 242 | Ga0395901_0310634 | 3300038443 | Bacteria | 1633 |
| 243 | Ga0436363_0441117 | 3300039450 | Unclassified | 2885 |
| 244 | Ga0436363_1484408 | 3300039450 | Unclassified | 1150 |
| 245 | Ga0451577_0001074 | 3300042876 | Bacteria | 39277 |
| 246 | Ga0453683_0032700 | 3300044673 | Bacteria | 3281 |
| 247 | Ga0453683_0076391 | 3300044673 | Bacteria | 2097 |
| 248 | Ga0453684_0000801 | 3300044712 | Bacteria | 107237 |
| 249 | Ga0466967_0097195 | 3300045976 | Unclassified | 2688 |
| 250 | Ga0466967_0574965 | 3300045976 | Bacteria | 1110 |
| 251 | Ga0495580_0001362 | 3300046472 | Bacteria | 21499 |
| 252 | Ga0495580_0033708 | 3300046472 | Bacteria | 3688 |
| 253 | Ga0495580_0061680 | 3300046472 | Bacteria | 2632 |
| 254 | Ga0495642_0094107 | 3300046528 | Bacteria | 1270 |
| 255 | Ga0495665_0026925 | 3300046531 | Bacteria | 3087 |
| 256 | Ga0495623_0135377 | 3300046679 | Unclassified | 1471 |
| 257 | Ga0495669_0032944 | 3300046684 | Unclassified | 2280 |
| 258 | Ga0495604_0252112 | 3300047317 | Bacteria | 1203 |
| 259 | Ga0495675_0061795 | 3300047444 | Bacteria | 2373 |
| 260 | Ga0495675_0259393 | 3300047444 | Unclassified | 1042 |
| 261 | Ga0495602_0190539 | 3300048088 | Bacteria | 1573 |
| 262 | Ga0496100_0058292 | 3300048903 | Bacteria | 2534 |
| 263 | Ga0496101_0118009 | 3300048904 | Unclassified | 2004 |
| 264 | Ga0496102_0005869 | 3300048905 | Bacteria | 10453 |
| 265 | Ga0496102_0098832 | 3300048905 | Bacteria | 2708 |
| 266 | Ga0496102_0532494 | 3300048905 | Bacteria | 1097 |
| 267 | Ga0496103_0004547 | 3300048906 | Bacteria | 8397 |
| 268 | Ga0496103_0034632 | 3300048906 | Bacteria | 3089 |
| 269 | Ga0496103_0160272 | 3300048906 | Bacteria | 1443 |
| 270 | Ga0496104_0004711 | 3300048907 | Bacteria | 11872 |
| 271 | Ga0496104_0081651 | 3300048907 | Bacteria | 3083 |
| 272 | Ga0496105_0098705 | 3300048908 | Bacteria | 2411 |
| 273 | Ga0496105_0154703 | 3300048908 | Bacteria | 1884 |
| 274 | Ga0496107_0034138 | 3300048910 | Bacteria | 3642 |
| 275 | Ga0496107_0436852 | 3300048910 | Bacteria | 973 |
| 276 | Ga0496109_0426144 | 3300048912 | Bacteria | 1253 |
| 277 | Ga0496110_0081757 | 3300048913 | Unclassified | 2880 |
| 278 | Ga0496110_0321764 | 3300048913 | Bacteria | 1409 |
| 279 | Ga0496112_0057191 | 3300048915 | Bacteria | 3839 |
| 280 | Ga0496112_0090185 | 3300048915 | Bacteria | 3034 |
| 281 | Ga0496112_0174516 | 3300048915 | Bacteria | 2114 |
| 282 | Ga0496113_0013536 | 3300048916 | Bacteria | 5532 |
| 283 | Ga0496113_0135841 | 3300048916 | Bacteria | 1932 |
| 284 | Ga0496114_0027200 | 3300048917 | Bacteria | 4683 |
| 285 | nmdc:mga05p37_255732_c1 | 3300050507 | Unclassified | 2099 |
| 286 | nmdc:mga05p37_294369_c1 | 3300050507 | Bacteria | 1931 |
| 287 | nmdc:mga05p37_75992_c1 | 3300050507 | Bacteria | 4135 |
| 288 | nmdc:mga06r32_69958_c1 | 3300050510 | Bacteria | 3393 |
| 289 | nmdc:mga0n895_1794_c1 | 3300050512 | Bacteria | 16309 |
| 290 | nmdc:mga0n895_2289_c1 | 3300050512 | Bacteria | 14867 |
| 291 | nmdc:mga0n895_438317_c1 | 3300050512 | Bacteria | 1320 |
| 292 | nmdc:mga0n895_7350_c1 | 3300050512 | Bacteria | 9448 |
| 293 | nmdc:mga0rr50_39288_c1 | 3300050513 | Bacteria | 3431 |
| 294 | nmdc:mga0rr50_709_c1 | 3300050513 | Bacteria | 17907 |
| 295 | nmdc:mga08x19_6686_c1 | 3300050514 | Bacteria | 6842 |
| 296 | nmdc:mga08x19_69499_c1 | 3300050514 | Bacteria | 2294 |
| 297 | nmdc:mga08x19_943_c1 | 3300050514 | Bacteria | 18303 |
| 298 | nmdc:mga0a205_2764_c1 | 3300050515 | Bacteria | 15499 |
| 299 | nmdc:mga0a205_64071_c1 | 3300050515 | Bacteria | 3550 |
| 300 | nmdc:mga0a205_6595_c1 | 3300050515 | Bacteria | 10499 |
| 301 | nmdc:mga0a205_95055_c1 | 3300050515 | Bacteria | 1953 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10250125 | Ga0207693_102501252 | 266 |
| 2 | 3300005435 | Ga0070714_100530623 | Ga0070714_1005306232 | 267 |
| 3 | 3300005436 | Ga0070713_100288137 | Ga0070713_1002881371 | 267 |
| 4 | 3300005437 | Ga0070710_10201163 | Ga0070710_102011631 | 267 |
| 5 | 3300005445 | Ga0070708_100017425 | Ga0070708_1000174253 | 267 |
| 6 | 3300006028 | Ga0070717_10548013 | Ga0070717_105480132 | 267 |
| 7 | 3300006175 | Ga0070712_100000624 | Ga0070712_10000062419 | 267 |
| 8 | 3300006237 | Ga0097621_100035806 | Ga0097621_1000358063 | 267 |
| 9 | 3300006358 | Ga0068871_100075971 | Ga0068871_1000759712 | 267 |
| 10 | 3300006844 | Ga0075428_100005245 | Ga0075428_1000052452 | 267 |
| 11 | 3300006847 | Ga0075431_100072087 | Ga0075431_1000720873 | 267 |
| 12 | 3300013100 | Ga0157373_10001224 | Ga0157373_1000122411 | 267 |
| 13 | 3300025911 | Ga0207654_10003653 | Ga0207654_100036533 | 267 |
| 14 | 3300025915 | Ga0207693_10014694 | Ga0207693_100146943 | 267 |
| 15 | 3300025928 | Ga0207700_10316752 | Ga0207700_103167521 | 267 |
| 16 | 3300026078 | Ga0207702_10002369 | Ga0207702_100023695 | 267 |
| 17 | 3300035207 | Ga0373942_0004055 | Ga0373942_0004055_308_1111 | 267 |
| 18 | 3300036401 | Ga0373937_0092387 | Ga0373937_0092387_1111_1914 | 267 |
| 19 | 3300036401 | Ga0373937_0292798 | Ga0373937_0292798_662_1465 | 267 |
| 20 | 3300037068 | Ga0373925_0126705 | Ga0373925_0126705_159_962 | 267 |
| 21 | 3300039450 | Ga0436363_0441117 | Ga0436363_0441117_1692_2495 | 267 |
| 22 | 3300039450 | Ga0436363_1484408 | Ga0436363_1484408_323_1126 | 267 |
| 23 | 3300045976 | Ga0466967_0574965 | Ga0466967_0574965_152_955 | 267 |
| 24 | 3300046472 | Ga0495580_0033708 | Ga0495580_0033708_401_1204 | 267 |
| 25 | 3300046472 | Ga0495580_0061680 | Ga0495580_0061680_1520_2323 | 267 |
| 26 | 3300046679 | Ga0495623_0135377 | Ga0495623_0135377_638_1441 | 267 |
| 27 | 3300047444 | Ga0495675_0061795 | Ga0495675_0061795_609_1412 | 267 |
| 28 | 3300050510 | nmdc:mga06r32_69958_c1 | nmdc:mga06r32_69958_c1_1609_2412 | 267 |
| 29 | 3300050515 | nmdc:mga0a205_95055_c1 | nmdc:mga0a205_95055_c1_851_1654 | 267 |
| 30 | 3300006852 | Ga0075433_10005559 | Ga0075433_1000555910 | 268 |
| 31 | 3300006871 | Ga0075434_100023195 | Ga0075434_1000231952 | 268 |
| 32 | 3300009147 | Ga0114129_10050033 | Ga0114129_100500336 | 268 |
| 33 | 3300050507 | nmdc:mga05p37_255732_c1 | nmdc:mga05p37_255732_c1_1064_1870 | 268 |
| 34 | 3300050512 | nmdc:mga0n895_2289_c1 | nmdc:mga0n895_2289_c1_810_1616 | 268 |
| 35 | 3300050515 | nmdc:mga0a205_2764_c1 | nmdc:mga0a205_2764_c1_14079_14885 | 268 |
| 36 | 3300005436 | Ga0070713_100041732 | Ga0070713_1000417324 | 269 |
| 37 | 3300005445 | Ga0070708_100031102 | Ga0070708_1000311023 | 269 |
| 38 | 3300005468 | Ga0070707_100294300 | Ga0070707_1002943002 | 269 |
| 39 | 3300006028 | Ga0070717_10017657 | Ga0070717_100176576 | 269 |
| 40 | 3300006847 | Ga0075431_100119465 | Ga0075431_1001194653 | 269 |
| 41 | 3300009093 | Ga0105240_10221687 | Ga0105240_102216873 | 269 |
| 42 | 3300009093 | Ga0105240_10243350 | Ga0105240_102433502 | 269 |
| 43 | 3300009147 | Ga0114129_10109519 | Ga0114129_101095193 | 269 |
| 44 | 3300009545 | Ga0105237_10194142 | Ga0105237_101941422 | 269 |
| 45 | 3300013307 | Ga0157372_10002375 | Ga0157372_1000237516 | 269 |
| 46 | 3300013307 | Ga0157372_10018387 | Ga0157372_100183873 | 269 |
| 47 | 3300025906 | Ga0207699_10020463 | Ga0207699_100204634 | 269 |
| 48 | 3300025913 | Ga0207695_10033324 | Ga0207695_100333243 | 269 |
| 49 | 3300025922 | Ga0207646_10131197 | Ga0207646_101311972 | 269 |
| 50 | 3300025929 | Ga0207664_10092031 | Ga0207664_100920313 | 269 |
| 51 | 3300025929 | Ga0207664_10134988 | Ga0207664_101349883 | 269 |
| 52 | 3300025939 | Ga0207665_10080245 | Ga0207665_100802452 | 269 |
| 53 | 3300028800 | Ga0265338_10260179 | Ga0265338_102601791 | 269 |
| 54 | 3300035692 | Ga0373935_0037868 | Ga0373935_0037868_434_1243 | 269 |
| 55 | 3300035695 | Ga0373927_0028986 | Ga0373927_0028986_448_1257 | 269 |
| 56 | 3300037068 | Ga0373925_0533008 | Ga0373925_0533008_137_946 | 269 |
| 57 | 3300038443 | Ga0395901_0310634 | Ga0395901_0310634_668_1477 | 269 |
| 58 | 3300046472 | Ga0495580_0001362 | Ga0495580_0001362_20477_21286 | 269 |
| 59 | 3300046531 | Ga0495665_0026925 | Ga0495665_0026925_240_1049 | 269 |
| 60 | 3300048088 | Ga0495602_0190539 | Ga0495602_0190539_707_1516 | 269 |
| 61 | 3300050507 | nmdc:mga05p37_75992_c1 | nmdc:mga05p37_75992_c1_2377_3192 | 269 |
| 62 | 2162886012 | MBSR1b_contig_6047714 | MBSR1b_0040.00000480 | 270 |
| 63 | 3300003323 | rootH1_10404163 | rootH1_104041632 | 270 |
| 64 | 3300005290 | Ga0065712_10003628 | Ga0065712_100036285 | 270 |
| 65 | 3300005328 | Ga0070676_10003362 | Ga0070676_100033625 | 270 |
| 66 | 3300005329 | Ga0070683_100010980 | Ga0070683_1000109803 | 270 |
| 67 | 3300005335 | Ga0070666_10030297 | Ga0070666_100302973 | 270 |
| 68 | 3300005336 | Ga0070680_100212172 | Ga0070680_1002121721 | 270 |
| 69 | 3300005338 | Ga0068868_100006717 | Ga0068868_1000067172 | 270 |
| 70 | 3300005339 | Ga0070660_100018690 | Ga0070660_1000186903 | 270 |
| 71 | 3300005344 | Ga0070661_100008680 | Ga0070661_1000086806 | 270 |
| 72 | 3300005347 | Ga0070668_100052769 | Ga0070668_1000527691 | 270 |
| 73 | 3300005353 | Ga0070669_100058514 | Ga0070669_1000585141 | 270 |
| 74 | 3300005355 | Ga0070671_100377879 | Ga0070671_1003778792 | 270 |
| 75 | 3300005366 | Ga0070659_100016405 | Ga0070659_1000164054 | 270 |
| 76 | 3300005366 | Ga0070659_100030662 | Ga0070659_1000306623 | 270 |
| 77 | 3300005367 | Ga0070667_100004110 | Ga0070667_1000041102 | 270 |
| 78 | 3300005434 | Ga0070709_10011780 | Ga0070709_100117802 | 270 |
| 79 | 3300005434 | Ga0070709_10047505 | Ga0070709_100475053 | 270 |
| 80 | 3300005435 | Ga0070714_100419065 | Ga0070714_1004190652 | 270 |
| 81 | 3300005436 | Ga0070713_100022625 | Ga0070713_1000226254 | 270 |
| 82 | 3300005436 | Ga0070713_100139799 | Ga0070713_1001397992 | 270 |
| 83 | 3300005436 | Ga0070713_100194280 | Ga0070713_1001942802 | 270 |
| 84 | 3300005436 | Ga0070713_100325481 | Ga0070713_1003254811 | 270 |
| 85 | 3300005437 | Ga0070710_10072151 | Ga0070710_100721511 | 270 |
| 86 | 3300005437 | Ga0070710_10097368 | Ga0070710_100973682 | 270 |
| 87 | 3300005439 | Ga0070711_100029520 | Ga0070711_1000295201 | 270 |
| 88 | 3300005439 | Ga0070711_100134274 | Ga0070711_1001342741 | 270 |
| 89 | 3300005444 | Ga0070694_100060353 | Ga0070694_1000603532 | 270 |
| 90 | 3300005445 | Ga0070708_100000298 | Ga0070708_10000029816 | 270 |
| 91 | 3300005455 | Ga0070663_100027656 | Ga0070663_1000276562 | 270 |
| 92 | 3300005456 | Ga0070678_100021305 | Ga0070678_1000213054 | 270 |
| 93 | 3300005457 | Ga0070662_100018503 | Ga0070662_1000185031 | 270 |
| 94 | 3300005457 | Ga0070662_100307489 | Ga0070662_1003074892 | 270 |
| 95 | 3300005458 | Ga0070681_10680370 | Ga0070681_106803701 | 270 |
| 96 | 3300005459 | Ga0068867_100211616 | Ga0068867_1002116162 | 270 |
| 97 | 3300005467 | Ga0070706_100000529 | Ga0070706_10000052931 | 270 |
| 98 | 3300005467 | Ga0070706_100042911 | Ga0070706_1000429114 | 270 |
| 99 | 3300005468 | Ga0070707_100006081 | Ga0070707_1000060812 | 270 |
| 100 | 3300005468 | Ga0070707_100041846 | Ga0070707_1000418463 | 270 |
| 101 | 3300005471 | Ga0070698_100000171 | Ga0070698_10000017117 | 270 |
| 102 | 3300005471 | Ga0070698_100075335 | Ga0070698_1000753353 | 270 |
| 103 | 3300005518 | Ga0070699_100020718 | Ga0070699_1000207183 | 270 |
| 104 | 3300005518 | Ga0070699_100096264 | Ga0070699_1000962642 | 270 |
| 105 | 3300005530 | Ga0070679_100307562 | Ga0070679_1003075622 | 270 |
| 106 | 3300005530 | Ga0070679_100518165 | Ga0070679_1005181652 | 270 |
| 107 | 3300005535 | Ga0070684_100033500 | Ga0070684_1000335004 | 270 |
| 108 | 3300005535 | Ga0070684_100211335 | Ga0070684_1002113351 | 270 |
| 109 | 3300005536 | Ga0070697_100000054 | Ga0070697_10000005420 | 270 |
| 110 | 3300005536 | Ga0070697_100047363 | Ga0070697_1000473633 | 270 |
| 111 | 3300005536 | Ga0070697_100234813 | Ga0070697_1002348132 | 270 |
| 112 | 3300005539 | Ga0068853_100175016 | Ga0068853_1001750162 | 270 |
| 113 | 3300005546 | Ga0070696_100235641 | Ga0070696_1002356411 | 270 |
| 114 | 3300005548 | Ga0070665_100033884 | Ga0070665_1000338843 | 270 |
| 115 | 3300005564 | Ga0070664_100153272 | Ga0070664_1001532723 | 270 |
| 116 | 3300005564 | Ga0070664_100421518 | Ga0070664_1004215182 | 270 |
| 117 | 3300005578 | Ga0068854_100084687 | Ga0068854_1000846872 | 270 |
| 118 | 3300005578 | Ga0068854_100310568 | Ga0068854_1003105682 | 270 |
| 119 | 3300005614 | Ga0068856_100107046 | Ga0068856_1001070462 | 270 |
| 120 | 3300005616 | Ga0068852_100008382 | Ga0068852_1000083823 | 270 |
| 121 | 3300005616 | Ga0068852_100309332 | Ga0068852_1003093322 | 270 |
| 122 | 3300005617 | Ga0068859_100034026 | Ga0068859_1000340264 | 270 |
| 123 | 3300005618 | Ga0068864_100280587 | Ga0068864_1002805872 | 270 |
| 124 | 3300005718 | Ga0068866_10036677 | Ga0068866_100366771 | 270 |
| 125 | 3300005834 | Ga0068851_10009864 | Ga0068851_100098644 | 270 |
| 126 | 3300005834 | Ga0068851_10025635 | Ga0068851_100256352 | 270 |
| 127 | 3300005841 | Ga0068863_100019773 | Ga0068863_1000197737 | 270 |
| 128 | 3300005841 | Ga0068863_100397424 | Ga0068863_1003974242 | 270 |
| 129 | 3300005842 | Ga0068858_100015899 | Ga0068858_1000158996 | 270 |
| 130 | 3300005842 | Ga0068858_100091029 | Ga0068858_1000910292 | 270 |
| 131 | 3300005843 | Ga0068860_100009175 | Ga0068860_1000091755 | 270 |
| 132 | 3300005843 | Ga0068860_100490568 | Ga0068860_1004905682 | 270 |
| 133 | 3300005844 | Ga0068862_100019123 | Ga0068862_1000191234 | 270 |
| 134 | 3300006028 | Ga0070717_10003073 | Ga0070717_100030736 | 270 |
| 135 | 3300006028 | Ga0070717_10378579 | Ga0070717_103785791 | 270 |
| 136 | 3300006028 | Ga0070717_10409508 | Ga0070717_104095082 | 270 |
| 137 | 3300006163 | Ga0070715_10001215 | Ga0070715_100012155 | 270 |
| 138 | 3300006173 | Ga0070716_100033022 | Ga0070716_1000330222 | 270 |
| 139 | 3300006173 | Ga0070716_100085684 | Ga0070716_1000856842 | 270 |
| 140 | 3300006173 | Ga0070716_100193350 | Ga0070716_1001933502 | 270 |
| 141 | 3300006175 | Ga0070712_100012811 | Ga0070712_1000128111 | 270 |
| 142 | 3300006237 | Ga0097621_100051250 | Ga0097621_1000512503 | 270 |
| 143 | 3300006237 | Ga0097621_100075255 | Ga0097621_1000752552 | 270 |
| 144 | 3300006237 | Ga0097621_100602856 | Ga0097621_1006028561 | 270 |
| 145 | 3300006358 | Ga0068871_100011680 | Ga0068871_1000116803 | 270 |
| 146 | 3300006358 | Ga0068871_100148504 | Ga0068871_1001485042 | 270 |
| 147 | 3300006852 | Ga0075433_10003272 | Ga0075433_1000327210 | 270 |
| 148 | 3300006852 | Ga0075433_10088716 | Ga0075433_100887162 | 270 |
| 149 | 3300006871 | Ga0075434_100009603 | Ga0075434_1000096036 | 270 |
| 150 | 3300006871 | Ga0075434_100017175 | Ga0075434_1000171756 | 270 |
| 151 | 3300006871 | Ga0075434_100464204 | Ga0075434_1004642042 | 270 |
| 152 | 3300006881 | Ga0068865_100329613 | Ga0068865_1003296132 | 270 |
| 153 | 3300006914 | Ga0075436_100000367 | Ga0075436_10000036723 | 270 |
| 154 | 3300006914 | Ga0075436_100011060 | Ga0075436_1000110601 | 270 |
| 155 | 3300006914 | Ga0075436_100036830 | Ga0075436_1000368302 | 270 |
| 156 | 3300006914 | Ga0075436_100056138 | Ga0075436_1000561382 | 270 |
| 157 | 3300006931 | Ga0097620_100034027 | Ga0097620_1000340274 | 270 |
| 158 | 3300007076 | Ga0075435_100000357 | Ga0075435_10000035713 | 270 |
| 159 | 3300009093 | Ga0105240_10029062 | Ga0105240_100290624 | 270 |
| 160 | 3300009093 | Ga0105240_10059590 | Ga0105240_100595903 | 270 |
| 161 | 3300009101 | Ga0105247_10048726 | Ga0105247_100487262 | 270 |
| 162 | 3300009101 | Ga0105247_10093619 | Ga0105247_100936191 | 270 |
| 163 | 3300009147 | Ga0114129_10307384 | Ga0114129_103073842 | 270 |
| 164 | 3300009148 | Ga0105243_10108711 | Ga0105243_101087111 | 270 |
| 165 | 3300009174 | Ga0105241_10018088 | Ga0105241_100180885 | 270 |
| 166 | 3300009174 | Ga0105241_10256345 | Ga0105241_102563453 | 270 |
| 167 | 3300009176 | Ga0105242_10186054 | Ga0105242_101860542 | 270 |
| 168 | 3300009176 | Ga0105242_10196835 | Ga0105242_101968352 | 270 |
| 169 | 3300009177 | Ga0105248_10079686 | Ga0105248_100796862 | 270 |
| 170 | 3300009545 | Ga0105237_10191698 | Ga0105237_101916981 | 270 |
| 171 | 3300009551 | Ga0105238_10390864 | Ga0105238_103908642 | 270 |
| 172 | 3300009553 | Ga0105249_10016918 | Ga0105249_100169182 | 270 |
| 173 | 3300010375 | Ga0105239_10655607 | Ga0105239_106556072 | 270 |
| 174 | 3300011119 | Ga0105246_10044143 | Ga0105246_100441431 | 270 |
| 175 | 3300013105 | Ga0157369_10118745 | Ga0157369_101187451 | 270 |
| 176 | 3300013296 | Ga0157374_10018109 | Ga0157374_100181096 | 270 |
| 177 | 3300013296 | Ga0157374_10280447 | Ga0157374_102804473 | 270 |
| 178 | 3300013297 | Ga0157378_10094409 | Ga0157378_100944092 | 270 |
| 179 | 3300013306 | Ga0163162_10021711 | Ga0163162_100217112 | 270 |
| 180 | 3300013306 | Ga0163162_10247942 | Ga0163162_102479422 | 270 |
| 181 | 3300013307 | Ga0157372_10129751 | Ga0157372_101297512 | 270 |
| 182 | 3300013308 | Ga0157375_10179111 | Ga0157375_101791113 | 270 |
| 183 | 3300014325 | Ga0163163_10022035 | Ga0163163_100220354 | 270 |
| 184 | 3300014325 | Ga0163163_10223083 | Ga0163163_102230832 | 270 |
| 185 | 3300014497 | Ga0182008_10015893 | Ga0182008_100158933 | 270 |
| 186 | 3300014968 | Ga0157379_10005147 | Ga0157379_100051474 | 270 |
| 187 | 3300014968 | Ga0157379_10292980 | Ga0157379_102929801 | 270 |
| 188 | 3300015262 | Ga0182007_10002727 | Ga0182007_100027272 | 270 |
| 189 | 3300015265 | Ga0182005_1009564 | Ga0182005_10095643 | 270 |
| 190 | 3300025898 | Ga0207692_10041808 | Ga0207692_100418082 | 270 |
| 191 | 3300025899 | Ga0207642_10170856 | Ga0207642_101708562 | 270 |
| 192 | 3300025900 | Ga0207710_10029441 | Ga0207710_100294412 | 270 |
| 193 | 3300025903 | Ga0207680_10110814 | Ga0207680_101108142 | 270 |
| 194 | 3300025905 | Ga0207685_10005386 | Ga0207685_100053862 | 270 |
| 195 | 3300025905 | Ga0207685_10124191 | Ga0207685_101241911 | 270 |
| 196 | 3300025906 | Ga0207699_10009737 | Ga0207699_100097372 | 270 |
| 197 | 3300025906 | Ga0207699_10047165 | Ga0207699_100471651 | 270 |
| 198 | 3300025907 | Ga0207645_10003674 | Ga0207645_1000367411 | 270 |
| 199 | 3300025910 | Ga0207684_10000702 | Ga0207684_1000070228 | 270 |
| 200 | 3300025910 | Ga0207684_10041127 | Ga0207684_100411273 | 270 |
| 201 | 3300025911 | Ga0207654_10002903 | Ga0207654_100029038 | 270 |
| 202 | 3300025911 | Ga0207654_10010827 | Ga0207654_100108272 | 270 |
| 203 | 3300025912 | Ga0207707_10012920 | Ga0207707_100129202 | 270 |
| 204 | 3300025912 | Ga0207707_10170787 | Ga0207707_101707872 | 270 |
| 205 | 3300025912 | Ga0207707_10347282 | Ga0207707_103472821 | 270 |
| 206 | 3300025913 | Ga0207695_10043117 | Ga0207695_100431172 | 270 |
| 207 | 3300025913 | Ga0207695_10129302 | Ga0207695_101293022 | 270 |
| 208 | 3300025914 | Ga0207671_10022859 | Ga0207671_100228594 | 270 |
| 209 | 3300025915 | Ga0207693_10000173 | Ga0207693_1000017334 | 270 |
| 210 | 3300025915 | Ga0207693_10121195 | Ga0207693_101211952 | 270 |
| 211 | 3300025916 | Ga0207663_10100890 | Ga0207663_101008902 | 270 |
| 212 | 3300025916 | Ga0207663_10126973 | Ga0207663_101269731 | 270 |
| 213 | 3300025916 | Ga0207663_10131899 | Ga0207663_101318992 | 270 |
| 214 | 3300025917 | Ga0207660_10028785 | Ga0207660_100287854 | 270 |
| 215 | 3300025919 | Ga0207657_10000215 | Ga0207657_1000021548 | 270 |
| 216 | 3300025920 | Ga0207649_10031565 | Ga0207649_100315653 | 270 |
| 217 | 3300025920 | Ga0207649_10286543 | Ga0207649_102865432 | 270 |
| 218 | 3300025922 | Ga0207646_10005506 | Ga0207646_1000550615 | 270 |
| 219 | 3300025922 | Ga0207646_10030672 | Ga0207646_100306723 | 270 |
| 220 | 3300025927 | Ga0207687_10001479 | Ga0207687_100014792 | 270 |
| 221 | 3300025927 | Ga0207687_10037245 | Ga0207687_100372453 | 270 |
| 222 | 3300025928 | Ga0207700_10020713 | Ga0207700_100207134 | 270 |
| 223 | 3300025928 | Ga0207700_10085447 | Ga0207700_100854472 | 270 |
| 224 | 3300025928 | Ga0207700_10154454 | Ga0207700_101544542 | 270 |
| 225 | 3300025929 | Ga0207664_10026515 | Ga0207664_100265153 | 270 |
| 226 | 3300025931 | Ga0207644_10329053 | Ga0207644_103290532 | 270 |
| 227 | 3300025932 | Ga0207690_10151365 | Ga0207690_101513651 | 270 |
| 228 | 3300025933 | Ga0207706_10004908 | Ga0207706_1000490811 | 270 |
| 229 | 3300025933 | Ga0207706_10019278 | Ga0207706_100192786 | 270 |
| 230 | 3300025934 | Ga0207686_10129792 | Ga0207686_101297922 | 270 |
| 231 | 3300025935 | Ga0207709_10111224 | Ga0207709_101112241 | 270 |
| 232 | 3300025939 | Ga0207665_10122235 | Ga0207665_101222352 | 270 |
| 233 | 3300025939 | Ga0207665_10179016 | Ga0207665_101790162 | 270 |
| 234 | 3300025939 | Ga0207665_10553608 | Ga0207665_105536081 | 270 |
| 235 | 3300025941 | Ga0207711_10025317 | Ga0207711_100253174 | 270 |
| 236 | 3300025941 | Ga0207711_10230301 | Ga0207711_102303012 | 270 |
| 237 | 3300025942 | Ga0207689_10186558 | Ga0207689_101865582 | 270 |
| 238 | 3300025942 | Ga0207689_10523349 | Ga0207689_105233491 | 270 |
| 239 | 3300025945 | Ga0207679_10014735 | Ga0207679_100147352 | 270 |
| 240 | 3300025945 | Ga0207679_10592333 | Ga0207679_105923331 | 270 |
| 241 | 3300025961 | Ga0207712_10486567 | Ga0207712_104865671 | 270 |
| 242 | 3300025972 | Ga0207668_10041205 | Ga0207668_100412053 | 270 |
| 243 | 3300025981 | Ga0207640_10016000 | Ga0207640_100160004 | 270 |
| 244 | 3300026023 | Ga0207677_10072688 | Ga0207677_100726882 | 270 |
| 245 | 3300026035 | Ga0207703_10573221 | Ga0207703_105732211 | 270 |
| 246 | 3300026067 | Ga0207678_10000874 | Ga0207678_1000087419 | 270 |
| 247 | 3300026078 | Ga0207702_10214569 | Ga0207702_102145692 | 270 |
| 248 | 3300026089 | Ga0207648_10017065 | Ga0207648_100170656 | 270 |
| 249 | 3300026116 | Ga0207674_10448564 | Ga0207674_104485641 | 270 |
| 250 | 3300026121 | Ga0207683_10020514 | Ga0207683_100205142 | 270 |
| 251 | 3300026142 | Ga0207698_10043325 | Ga0207698_100433252 | 270 |
| 252 | 3300028379 | Ga0268266_10025409 | Ga0268266_100254093 | 270 |
| 253 | 3300028381 | Ga0268264_10093079 | Ga0268264_100930792 | 270 |
| 254 | 3300031247 | Ga0265340_10005319 | Ga0265340_100053194 | 270 |
| 255 | 3300031911 | Ga0307412_10143735 | Ga0307412_101437352 | 270 |
| 256 | 3300032005 | Ga0307411_10111748 | Ga0307411_101117482 | 270 |
| 257 | 3300034817 | Ga0373948_0014649 | Ga0373948_0014649_413_1225 | 270 |
| 258 | 3300035691 | Ga0373931_0035901 | Ga0373931_0035901_75_887 | 270 |
| 259 | 3300042876 | Ga0451577_0001074 | Ga0451577_0001074_21715_22527 | 270 |
| 260 | 3300044673 | Ga0453683_0032700 | Ga0453683_0032700_2341_3153 | 270 |
| 261 | 3300044673 | Ga0453683_0076391 | Ga0453683_0076391_553_1365 | 270 |
| 262 | 3300044712 | Ga0453684_0000801 | Ga0453684_0000801_42022_42834 | 270 |
| 263 | 3300045976 | Ga0466967_0097195 | Ga0466967_0097195_247_1059 | 270 |
| 264 | 3300046528 | Ga0495642_0094107 | Ga0495642_0094107_88_900 | 270 |
| 265 | 3300046684 | Ga0495669_0032944 | Ga0495669_0032944_551_1363 | 270 |
| 266 | 3300047317 | Ga0495604_0252112 | Ga0495604_0252112_26_841 | 270 |
| 267 | 3300047444 | Ga0495675_0259393 | Ga0495675_0259393_154_969 | 270 |
| 268 | 3300048903 | Ga0496100_0058292 | Ga0496100_0058292_1202_2059 | 270 |
| 269 | 3300048904 | Ga0496101_0118009 | Ga0496101_0118009_66_887 | 270 |
| 270 | 3300048905 | Ga0496102_0005869 | Ga0496102_0005869_6374_7210 | 270 |
| 271 | 3300048905 | Ga0496102_0098832 | Ga0496102_0098832_1413_2225 | 270 |
| 272 | 3300048905 | Ga0496102_0532494 | Ga0496102_0532494_244_1056 | 270 |
| 273 | 3300048906 | Ga0496103_0004547 | Ga0496103_0004547_3823_4659 | 270 |
| 274 | 3300048906 | Ga0496103_0034632 | Ga0496103_0034632_1973_2785 | 270 |
| 275 | 3300048906 | Ga0496103_0160272 | Ga0496103_0160272_485_1342 | 270 |
| 276 | 3300048907 | Ga0496104_0004711 | Ga0496104_0004711_9068_9904 | 270 |
| 277 | 3300048907 | Ga0496104_0081651 | Ga0496104_0081651_1918_2775 | 270 |
| 278 | 3300048908 | Ga0496105_0098705 | Ga0496105_0098705_805_1641 | 270 |
| 279 | 3300048908 | Ga0496105_0154703 | Ga0496105_0154703_979_1791 | 270 |
| 280 | 3300048910 | Ga0496107_0034138 | Ga0496107_0034138_2086_2922 | 270 |
| 281 | 3300048910 | Ga0496107_0436852 | Ga0496107_0436852_86_898 | 270 |
| 282 | 3300048912 | Ga0496109_0426144 | Ga0496109_0426144_113_925 | 270 |
| 283 | 3300048913 | Ga0496110_0081757 | Ga0496110_0081757_1861_2718 | 270 |
| 284 | 3300048913 | Ga0496110_0321764 | Ga0496110_0321764_240_1052 | 270 |
| 285 | 3300048915 | Ga0496112_0057191 | Ga0496112_0057191_2415_3227 | 270 |
| 286 | 3300048915 | Ga0496112_0090185 | Ga0496112_0090185_1230_2087 | 270 |
| 287 | 3300048915 | Ga0496112_0174516 | Ga0496112_0174516_505_1362 | 270 |
| 288 | 3300048916 | Ga0496113_0013536 | Ga0496113_0013536_1902_2759 | 270 |
| 289 | 3300048916 | Ga0496113_0135841 | Ga0496113_0135841_714_1526 | 270 |
| 290 | 3300048917 | Ga0496114_0027200 | Ga0496114_0027200_2076_2888 | 270 |
| 291 | 3300050507 | nmdc:mga05p37_294369_c1 | nmdc:mga05p37_294369_c1_322_1140 | 270 |
| 292 | 3300050512 | nmdc:mga0n895_1794_c1 | nmdc:mga0n895_1794_c1_343_1161 | 270 |
| 293 | 3300050512 | nmdc:mga0n895_438317_c1 | nmdc:mga0n895_438317_c1_256_1068 | 270 |
| 294 | 3300050512 | nmdc:mga0n895_7350_c1 | nmdc:mga0n895_7350_c1_4859_5674 | 270 |
| 295 | 3300050513 | nmdc:mga0rr50_39288_c1 | nmdc:mga0rr50_39288_c1_1639_2484 | 270 |
| 296 | 3300050513 | nmdc:mga0rr50_709_c1 | nmdc:mga0rr50_709_c1_2401_3219 | 270 |
| 297 | 3300050514 | nmdc:mga08x19_6686_c1 | nmdc:mga08x19_6686_c1_1350_2162 | 270 |
| 298 | 3300050514 | nmdc:mga08x19_69499_c1 | nmdc:mga08x19_69499_c1_1368_2186 | 270 |
| 299 | 3300050514 | nmdc:mga08x19_943_c1 | nmdc:mga08x19_943_c1_14950_15762 | 270 |
| 300 | 3300050515 | nmdc:mga0a205_64071_c1 | nmdc:mga0a205_64071_c1_341_1156 | 270 |
| 301 | 3300050515 | nmdc:mga0a205_6595_c1 | nmdc:mga0a205_6595_c1_7636_8454 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m8h-assembly4.cif.gz_D | structure of memo1 c244s metal binding site mutant at 1.75a | 0.8886 | 5 | 270 |
| 3bcz-assembly1.cif.gz_A | crystal structure of memo | 0.8795 | 5 | 270 |
| 7m8h-assembly4.cif.gz_D | structure of memo1 c244s metal binding site mutant at 1.75a | 0.8731 | 5 | 270 |
| 3bcz-assembly1.cif.gz_A | crystal structure of memo | 0.8641 | 5 | 270 |
| 3vsh-assembly1.cif.gz_C | crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase | 0.7349 | 41 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57846_3_287_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9516 | 4 | 270 | 3.40.830.10 |
| af_Q57846_3_287_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9379 | 4 | 270 | 3.40.830.10 |
| af_Q54NZ1_1_286_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.902 | 4 | 268 | 3.40.830.10 |
| af_C0H4B1_3_295_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8915 | 4 | 270 | 3.40.830.10 |
| af_Q9VG04_2_293_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8912 | 4 | 270 | 3.40.830.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9VDK3-F1-model_v4 | AmmeMemoRadiSam system protein B | 0.9997 | 180 | 270 |
|
| AF-A0A2V9N004-F1-model_v4 | AmmeMemoRadiSam system protein B | 0.9989 | 173 | 270 |
|
| AF-A0A3D4P0X3-F1-model_v4 | AmmeMemoRadiSam system protein B | 0.9982 | 179 | 270 |
|
| AF-A0A2V9TXF5-F1-model_v4 | AmmeMemoRadiSam system protein B | 0.997 | 1 | 144 |
|
| AF-A0A6N9TR13-F1-model_v4 | AmmeMemoRadiSam system protein B | 0.9968 | 181 | 270 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar