F395963

General Info

Members Datasets Scaffolds Average Seq Length
301 173 301 272

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10186558|Ga0207689_101865582
Length 328
Sequence MASPVRHPAVAGRFYPRDRDDLRAEVEFYLSPPQKTVPALGCVVPHAGYMYSGHVAGAVYARLDVPQRSILMCPNHTGMGHPLSIMSVGAWDTPLGRVSIDAELAAELKRRFTPLGEDSEAHRAEHGAEVQLPFLQVRNPQCSFVPIALGTSQFELLQGLGEAIADAVWALGERVLLIASSDMNHYENDTITRVKDQKAIERILVMDARGLFDVVMDEDISMCGFGPTVAMLTAARRLGAVSTDLVRYATSGDVSGDRDFALDLLLIKIRDGVALIDAEKAVRGSGGEEQPGGERCLTGIAVAHHTDVPNVLAFVDFHWRVSRLKTEW

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.64
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6047714 2162886012 Bacteria 2922
2 rootH1_10404163 3300003323 Bacteria 1183
3 Ga0065712_10003628 3300005290 Bacteria 5983
4 Ga0070676_10003362 3300005328 Bacteria 8325
5 Ga0070683_100010980 3300005329 Bacteria 7803
6 Ga0070666_10030297 3300005335 Bacteria 3563
7 Ga0070680_100212172 3300005336 Bacteria 1633
8 Ga0068868_100006717 3300005338 Bacteria 8165
9 Ga0070660_100018690 3300005339 Bacteria 5068
10 Ga0070661_100008680 3300005344 Bacteria 7032
11 Ga0070668_100052769 3300005347 Bacteria 3135
12 Ga0070669_100058514 3300005353 Bacteria 2828
13 Ga0070671_100377879 3300005355 Unclassified 1211
14 Ga0070659_100016405 3300005366 Bacteria 5561
15 Ga0070659_100030662 3300005366 Bacteria 4162
16 Ga0070667_100004110 3300005367 Bacteria 12322
17 Ga0070709_10011780 3300005434 Bacteria 4882
18 Ga0070709_10047505 3300005434 Unclassified 2674
19 Ga0070714_100419065 3300005435 Bacteria 1268
20 Ga0070714_100530623 3300005435 Bacteria 1125
21 Ga0070713_100022625 3300005436 Bacteria 4860
22 Ga0070713_100041732 3300005436 Unclassified 3740
23 Ga0070713_100139799 3300005436 Bacteria 2144
24 Ga0070713_100194280 3300005436 Bacteria 1830
25 Ga0070713_100288137 3300005436 Bacteria 1508
26 Ga0070713_100325481 3300005436 Unclassified 1420
27 Ga0070710_10072151 3300005437 Unclassified 1993
28 Ga0070710_10097368 3300005437 Bacteria 1746
29 Ga0070710_10201163 3300005437 Unclassified 1258
30 Ga0070711_100029520 3300005439 Unclassified 3619
31 Ga0070711_100134274 3300005439 Unclassified 1847
32 Ga0070694_100060353 3300005444 Bacteria 2586
33 Ga0070708_100000298 3300005445 Bacteria 37307
34 Ga0070708_100017425 3300005445 Bacteria 5991
35 Ga0070708_100031102 3300005445 Bacteria 4618
36 Ga0070663_100027656 3300005455 Bacteria 3853
37 Ga0070678_100021305 3300005456 Bacteria 4272
38 Ga0070662_100018503 3300005457 Bacteria 4713
39 Ga0070662_100307489 3300005457 Bacteria 1290
40 Ga0070681_10680370 3300005458 Bacteria 944
41 Ga0068867_100211616 3300005459 Bacteria 1557
42 Ga0070706_100000529 3300005467 Bacteria 44433
43 Ga0070706_100042911 3300005467 Bacteria 4178
44 Ga0070707_100006081 3300005468 Bacteria 11261
45 Ga0070707_100041846 3300005468 Bacteria 4385
46 Ga0070707_100294300 3300005468 Unclassified 1577
47 Ga0070698_100000171 3300005471 Bacteria 60242
48 Ga0070698_100075335 3300005471 Unclassified 3378
49 Ga0070699_100020718 3300005518 Bacteria 5671
50 Ga0070699_100096264 3300005518 Bacteria 2592
51 Ga0070679_100307562 3300005530 Bacteria 1535
52 Ga0070679_100518165 3300005530 Unclassified 1136
53 Ga0070684_100033500 3300005535 Bacteria 4386
54 Ga0070684_100211335 3300005535 Bacteria 1768
55 Ga0070697_100000054 3300005536 Bacteria 88022
56 Ga0070697_100047363 3300005536 Unclassified 3485
57 Ga0070697_100234813 3300005536 Bacteria 1565
58 Ga0068853_100175016 3300005539 Bacteria 1943
59 Ga0070696_100235641 3300005546 Bacteria 1378
60 Ga0070665_100033884 3300005548 Bacteria 5137
61 Ga0070664_100153272 3300005564 Bacteria 2035
62 Ga0070664_100421518 3300005564 Bacteria 1222
63 Ga0068854_100084687 3300005578 Unclassified 2346
64 Ga0068854_100310568 3300005578 Bacteria 1278
65 Ga0068856_100107046 3300005614 Bacteria 2791
66 Ga0068852_100008382 3300005616 Bacteria 7617
67 Ga0068852_100309332 3300005616 Bacteria 1532
68 Ga0068859_100034026 3300005617 Bacteria 5116
69 Ga0068864_100280587 3300005618 Bacteria 1555
70 Ga0068866_10036677 3300005718 Bacteria 2403
71 Ga0068851_10009864 3300005834 Bacteria 4447
72 Ga0068851_10025635 3300005834 Bacteria 2894
73 Ga0068863_100019773 3300005841 Bacteria 6440
74 Ga0068863_100397424 3300005841 Bacteria 1348
75 Ga0068858_100015899 3300005842 Bacteria 7071
76 Ga0068858_100091029 3300005842 Bacteria 2839
77 Ga0068860_100009175 3300005843 Bacteria 9833
78 Ga0068860_100490568 3300005843 Bacteria 1225
79 Ga0068862_100019123 3300005844 Bacteria 5712
80 Ga0070717_10003073 3300006028 Bacteria 11898
81 Ga0070717_10017657 3300006028 Bacteria 5555
82 Ga0070717_10378579 3300006028 Unclassified 1269
83 Ga0070717_10409508 3300006028 Unclassified 1219
84 Ga0070717_10548013 3300006028 Bacteria 1047
85 Ga0070715_10001215 3300006163 Bacteria 7408
86 Ga0070716_100033022 3300006173 Bacteria 2828
87 Ga0070716_100085684 3300006173 Unclassified 1893
88 Ga0070716_100193350 3300006173 Bacteria 1346
89 Ga0070712_100000624 3300006175 Bacteria 20825
90 Ga0070712_100012811 3300006175 Bacteria 5338
91 Ga0097621_100035806 3300006237 Bacteria 3968
92 Ga0097621_100051250 3300006237 Bacteria 3358
93 Ga0097621_100075255 3300006237 Bacteria 2798
94 Ga0097621_100602856 3300006237 Unclassified 1004
95 Ga0068871_100011680 3300006358 Bacteria 6449
96 Ga0068871_100075971 3300006358 Bacteria 2774
97 Ga0068871_100148504 3300006358 Bacteria 1998
98 Ga0075428_100005245 3300006844 Bacteria 14413
99 Ga0075431_100072087 3300006847 Bacteria 3564
100 Ga0075431_100119465 3300006847 Unclassified 2720
101 Ga0075433_10003272 3300006852 Bacteria 12508
102 Ga0075433_10005559 3300006852 Bacteria 9898
103 Ga0075433_10088716 3300006852 Bacteria 2733
104 Ga0075434_100009603 3300006871 Bacteria 9033
105 Ga0075434_100017175 3300006871 Bacteria 6967
106 Ga0075434_100023195 3300006871 Bacteria 6046
107 Ga0075434_100464204 3300006871 Bacteria 1287
108 Ga0068865_100329613 3300006881 Bacteria 1230
109 Ga0075436_100000367 3300006914 Bacteria 28887
110 Ga0075436_100011060 3300006914 Bacteria 6191
111 Ga0075436_100036830 3300006914 Bacteria 3378
112 Ga0075436_100056138 3300006914 Bacteria 2720
113 Ga0097620_100034027 3300006931 Bacteria 5116
114 Ga0075435_100000357 3300007076 Bacteria 27987
115 Ga0105240_10029062 3300009093 Bacteria 7208
116 Ga0105240_10059590 3300009093 Bacteria 4763
117 Ga0105240_10221687 3300009093 Unclassified 2203
118 Ga0105240_10243350 3300009093 Bacteria 2084
119 Ga0105247_10048726 3300009101 Bacteria 2603
120 Ga0105247_10093619 3300009101 Unclassified 1910
121 Ga0114129_10050033 3300009147 Bacteria 5871
122 Ga0114129_10109519 3300009147 Bacteria 3813
123 Ga0114129_10307384 3300009147 Bacteria 2111
124 Ga0105243_10108711 3300009148 Bacteria 2315
125 Ga0105241_10018088 3300009174 Bacteria 5182
126 Ga0105241_10256345 3300009174 Bacteria 1485
127 Ga0105242_10186054 3300009176 Bacteria 1835
128 Ga0105242_10196835 3300009176 Bacteria 1787
129 Ga0105248_10079686 3300009177 Bacteria 3681
130 Ga0105237_10191698 3300009545 Unclassified 2044
131 Ga0105237_10194142 3300009545 Bacteria 2030
132 Ga0105238_10390864 3300009551 Bacteria 1383
133 Ga0105249_10016918 3300009553 Bacteria 6471
134 Ga0105239_10655607 3300010375 Bacteria 1199
135 Ga0105246_10044143 3300011119 Unclassified 3028
136 Ga0157373_10001224 3300013100 Bacteria 19643
137 Ga0157369_10118745 3300013105 Bacteria 2807
138 Ga0157374_10018109 3300013296 Bacteria 6212
139 Ga0157374_10280447 3300013296 Bacteria 1645
140 Ga0157378_10094409 3300013297 Bacteria 2724
141 Ga0163162_10021711 3300013306 Bacteria 6323
142 Ga0163162_10247942 3300013306 Bacteria 1913
143 Ga0157372_10002375 3300013307 Bacteria 20375
144 Ga0157372_10018387 3300013307 Bacteria 7512
145 Ga0157372_10129751 3300013307 Bacteria 2899
146 Ga0157375_10179111 3300013308 Bacteria 2270
147 Ga0163163_10022035 3300014325 Bacteria 6024
148 Ga0163163_10223083 3300014325 Unclassified 1934
149 Ga0182008_10015893 3300014497 Bacteria 3918
150 Ga0157379_10005147 3300014968 Bacteria 11224
151 Ga0157379_10292980 3300014968 Bacteria 1482
152 Ga0182007_10002727 3300015262 Bacteria 8638
153 Ga0182005_1009564 3300015265 Bacteria 2816
154 Ga0207692_10041808 3300025898 Unclassified 2272
155 Ga0207642_10170856 3300025899 Bacteria 1176
156 Ga0207710_10029441 3300025900 Bacteria 2390
157 Ga0207680_10110814 3300025903 Unclassified 1780
158 Ga0207685_10005386 3300025905 Bacteria 3373
159 Ga0207685_10124191 3300025905 Bacteria 1137
160 Ga0207699_10009737 3300025906 Bacteria 4797
161 Ga0207699_10020463 3300025906 Unclassified 3547
162 Ga0207699_10047165 3300025906 Bacteria 2525
163 Ga0207645_10003674 3300025907 Bacteria 11569
164 Ga0207684_10000702 3300025910 Bacteria 39479
165 Ga0207684_10041127 3300025910 Unclassified 3921
166 Ga0207654_10002903 3300025911 Bacteria 8686
167 Ga0207654_10003653 3300025911 Bacteria 7757
168 Ga0207654_10010827 3300025911 Bacteria 4643
169 Ga0207707_10012920 3300025912 Bacteria 7268
170 Ga0207707_10170787 3300025912 Bacteria 1900
171 Ga0207707_10347282 3300025912 Bacteria 1279
172 Ga0207695_10033324 3300025913 Bacteria 5620
173 Ga0207695_10043117 3300025913 Bacteria 4811
174 Ga0207695_10129302 3300025913 Bacteria 2484
175 Ga0207671_10022859 3300025914 Bacteria 4721
176 Ga0207693_10000173 3300025915 Bacteria 58862
177 Ga0207693_10014694 3300025915 Bacteria 6290
178 Ga0207693_10121195 3300025915 Bacteria 2054
179 Ga0207693_10250125 3300025915 Bacteria 1391
180 Ga0207663_10100890 3300025916 Bacteria 1938
181 Ga0207663_10126973 3300025916 Unclassified 1756
182 Ga0207663_10131899 3300025916 Bacteria 1728
183 Ga0207660_10028785 3300025917 Bacteria 3804
184 Ga0207657_10000215 3300025919 Bacteria 60239
185 Ga0207649_10031565 3300025920 Bacteria 3150
186 Ga0207649_10286543 3300025920 Bacteria 1199
187 Ga0207646_10005506 3300025922 Bacteria 13307
188 Ga0207646_10030672 3300025922 Bacteria 4871
189 Ga0207646_10131197 3300025922 Unclassified 2255
190 Ga0207687_10001479 3300025927 Bacteria 16100
191 Ga0207687_10037245 3300025927 Bacteria 3317
192 Ga0207700_10020713 3300025928 Bacteria 4474
193 Ga0207700_10085447 3300025928 Bacteria 2476
194 Ga0207700_10154454 3300025928 Bacteria 1900
195 Ga0207700_10316752 3300025928 Bacteria 1351
196 Ga0207664_10026515 3300025929 Unclassified 4382
197 Ga0207664_10092031 3300025929 Bacteria 2488
198 Ga0207664_10134988 3300025929 Bacteria 2081
199 Ga0207644_10329053 3300025931 Unclassified 1237
200 Ga0207690_10151365 3300025932 Bacteria 1720
201 Ga0207706_10004908 3300025933 Bacteria 12508
202 Ga0207706_10019278 3300025933 Bacteria 6135
203 Ga0207686_10129792 3300025934 Bacteria 1727
204 Ga0207709_10111224 3300025935 Bacteria 1832
205 Ga0207665_10080245 3300025939 Unclassified 2244
206 Ga0207665_10122235 3300025939 Bacteria 1840
207 Ga0207665_10179016 3300025939 Unclassified 1535
208 Ga0207665_10553608 3300025939 Unclassified 894
209 Ga0207711_10025317 3300025941 Bacteria 4979
210 Ga0207711_10230301 3300025941 Bacteria 1697
211 Ga0207689_10186558 3300025942 Unclassified 1711
212 Ga0207689_10523349 3300025942 Bacteria 995
213 Ga0207679_10014735 3300025945 Bacteria 5149
214 Ga0207679_10592333 3300025945 Bacteria 998
215 Ga0207712_10486567 3300025961 Bacteria 1053
216 Ga0207668_10041205 3300025972 Bacteria 3120
217 Ga0207640_10016000 3300025981 Bacteria 4354
218 Ga0207677_10072688 3300026023 Bacteria 2432
219 Ga0207703_10573221 3300026035 Bacteria 1066
220 Ga0207678_10000874 3300026067 Bacteria 27662
221 Ga0207702_10002369 3300026078 Bacteria 17997
222 Ga0207702_10214569 3300026078 Bacteria 1791
223 Ga0207648_10017065 3300026089 Bacteria 6618
224 Ga0207674_10448564 3300026116 Bacteria 1247
225 Ga0207683_10020514 3300026121 Bacteria 5653
226 Ga0207698_10043325 3300026142 Bacteria 3370
227 Ga0268266_10025409 3300028379 Bacteria 5039
228 Ga0268264_10093079 3300028381 Bacteria 2603
229 Ga0265338_10260179 3300028800 Bacteria 1276
230 Ga0265340_10005319 3300031247 Bacteria 7148
231 Ga0307412_10143735 3300031911 Bacteria 1751
232 Ga0307411_10111748 3300032005 Bacteria 1957
233 Ga0373948_0014649 3300034817 Bacteria 1431
234 Ga0373942_0004055 3300035207 Bacteria 3418
235 Ga0373931_0035901 3300035691 Bacteria 2580
236 Ga0373935_0037868 3300035692 Unclassified 3019
237 Ga0373927_0028986 3300035695 Bacteria 3609
238 Ga0373937_0092387 3300036401 Bacteria 2805
239 Ga0373937_0292798 3300036401 Bacteria 1538
240 Ga0373925_0126705 3300037068 Unclassified 1987
241 Ga0373925_0533008 3300037068 Unclassified 965
242 Ga0395901_0310634 3300038443 Bacteria 1633
243 Ga0436363_0441117 3300039450 Unclassified 2885
244 Ga0436363_1484408 3300039450 Unclassified 1150
245 Ga0451577_0001074 3300042876 Bacteria 39277
246 Ga0453683_0032700 3300044673 Bacteria 3281
247 Ga0453683_0076391 3300044673 Bacteria 2097
248 Ga0453684_0000801 3300044712 Bacteria 107237
249 Ga0466967_0097195 3300045976 Unclassified 2688
250 Ga0466967_0574965 3300045976 Bacteria 1110
251 Ga0495580_0001362 3300046472 Bacteria 21499
252 Ga0495580_0033708 3300046472 Bacteria 3688
253 Ga0495580_0061680 3300046472 Bacteria 2632
254 Ga0495642_0094107 3300046528 Bacteria 1270
255 Ga0495665_0026925 3300046531 Bacteria 3087
256 Ga0495623_0135377 3300046679 Unclassified 1471
257 Ga0495669_0032944 3300046684 Unclassified 2280
258 Ga0495604_0252112 3300047317 Bacteria 1203
259 Ga0495675_0061795 3300047444 Bacteria 2373
260 Ga0495675_0259393 3300047444 Unclassified 1042
261 Ga0495602_0190539 3300048088 Bacteria 1573
262 Ga0496100_0058292 3300048903 Bacteria 2534
263 Ga0496101_0118009 3300048904 Unclassified 2004
264 Ga0496102_0005869 3300048905 Bacteria 10453
265 Ga0496102_0098832 3300048905 Bacteria 2708
266 Ga0496102_0532494 3300048905 Bacteria 1097
267 Ga0496103_0004547 3300048906 Bacteria 8397
268 Ga0496103_0034632 3300048906 Bacteria 3089
269 Ga0496103_0160272 3300048906 Bacteria 1443
270 Ga0496104_0004711 3300048907 Bacteria 11872
271 Ga0496104_0081651 3300048907 Bacteria 3083
272 Ga0496105_0098705 3300048908 Bacteria 2411
273 Ga0496105_0154703 3300048908 Bacteria 1884
274 Ga0496107_0034138 3300048910 Bacteria 3642
275 Ga0496107_0436852 3300048910 Bacteria 973
276 Ga0496109_0426144 3300048912 Bacteria 1253
277 Ga0496110_0081757 3300048913 Unclassified 2880
278 Ga0496110_0321764 3300048913 Bacteria 1409
279 Ga0496112_0057191 3300048915 Bacteria 3839
280 Ga0496112_0090185 3300048915 Bacteria 3034
281 Ga0496112_0174516 3300048915 Bacteria 2114
282 Ga0496113_0013536 3300048916 Bacteria 5532
283 Ga0496113_0135841 3300048916 Bacteria 1932
284 Ga0496114_0027200 3300048917 Bacteria 4683
285 nmdc:mga05p37_255732_c1 3300050507 Unclassified 2099
286 nmdc:mga05p37_294369_c1 3300050507 Bacteria 1931
287 nmdc:mga05p37_75992_c1 3300050507 Bacteria 4135
288 nmdc:mga06r32_69958_c1 3300050510 Bacteria 3393
289 nmdc:mga0n895_1794_c1 3300050512 Bacteria 16309
290 nmdc:mga0n895_2289_c1 3300050512 Bacteria 14867
291 nmdc:mga0n895_438317_c1 3300050512 Bacteria 1320
292 nmdc:mga0n895_7350_c1 3300050512 Bacteria 9448
293 nmdc:mga0rr50_39288_c1 3300050513 Bacteria 3431
294 nmdc:mga0rr50_709_c1 3300050513 Bacteria 17907
295 nmdc:mga08x19_6686_c1 3300050514 Bacteria 6842
296 nmdc:mga08x19_69499_c1 3300050514 Bacteria 2294
297 nmdc:mga08x19_943_c1 3300050514 Bacteria 18303
298 nmdc:mga0a205_2764_c1 3300050515 Bacteria 15499
299 nmdc:mga0a205_64071_c1 3300050515 Bacteria 3550
300 nmdc:mga0a205_6595_c1 3300050515 Bacteria 10499
301 nmdc:mga0a205_95055_c1 3300050515 Bacteria 1953

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10250125 Ga0207693_102501252 266
2 3300005435 Ga0070714_100530623 Ga0070714_1005306232 267
3 3300005436 Ga0070713_100288137 Ga0070713_1002881371 267
4 3300005437 Ga0070710_10201163 Ga0070710_102011631 267
5 3300005445 Ga0070708_100017425 Ga0070708_1000174253 267
6 3300006028 Ga0070717_10548013 Ga0070717_105480132 267
7 3300006175 Ga0070712_100000624 Ga0070712_10000062419 267
8 3300006237 Ga0097621_100035806 Ga0097621_1000358063 267
9 3300006358 Ga0068871_100075971 Ga0068871_1000759712 267
10 3300006844 Ga0075428_100005245 Ga0075428_1000052452 267
11 3300006847 Ga0075431_100072087 Ga0075431_1000720873 267
12 3300013100 Ga0157373_10001224 Ga0157373_1000122411 267
13 3300025911 Ga0207654_10003653 Ga0207654_100036533 267
14 3300025915 Ga0207693_10014694 Ga0207693_100146943 267
15 3300025928 Ga0207700_10316752 Ga0207700_103167521 267
16 3300026078 Ga0207702_10002369 Ga0207702_100023695 267
17 3300035207 Ga0373942_0004055 Ga0373942_0004055_308_1111 267
18 3300036401 Ga0373937_0092387 Ga0373937_0092387_1111_1914 267
19 3300036401 Ga0373937_0292798 Ga0373937_0292798_662_1465 267
20 3300037068 Ga0373925_0126705 Ga0373925_0126705_159_962 267
21 3300039450 Ga0436363_0441117 Ga0436363_0441117_1692_2495 267
22 3300039450 Ga0436363_1484408 Ga0436363_1484408_323_1126 267
23 3300045976 Ga0466967_0574965 Ga0466967_0574965_152_955 267
24 3300046472 Ga0495580_0033708 Ga0495580_0033708_401_1204 267
25 3300046472 Ga0495580_0061680 Ga0495580_0061680_1520_2323 267
26 3300046679 Ga0495623_0135377 Ga0495623_0135377_638_1441 267
27 3300047444 Ga0495675_0061795 Ga0495675_0061795_609_1412 267
28 3300050510 nmdc:mga06r32_69958_c1 nmdc:mga06r32_69958_c1_1609_2412 267
29 3300050515 nmdc:mga0a205_95055_c1 nmdc:mga0a205_95055_c1_851_1654 267
30 3300006852 Ga0075433_10005559 Ga0075433_1000555910 268
31 3300006871 Ga0075434_100023195 Ga0075434_1000231952 268
32 3300009147 Ga0114129_10050033 Ga0114129_100500336 268
33 3300050507 nmdc:mga05p37_255732_c1 nmdc:mga05p37_255732_c1_1064_1870 268
34 3300050512 nmdc:mga0n895_2289_c1 nmdc:mga0n895_2289_c1_810_1616 268
35 3300050515 nmdc:mga0a205_2764_c1 nmdc:mga0a205_2764_c1_14079_14885 268
36 3300005436 Ga0070713_100041732 Ga0070713_1000417324 269
37 3300005445 Ga0070708_100031102 Ga0070708_1000311023 269
38 3300005468 Ga0070707_100294300 Ga0070707_1002943002 269
39 3300006028 Ga0070717_10017657 Ga0070717_100176576 269
40 3300006847 Ga0075431_100119465 Ga0075431_1001194653 269
41 3300009093 Ga0105240_10221687 Ga0105240_102216873 269
42 3300009093 Ga0105240_10243350 Ga0105240_102433502 269
43 3300009147 Ga0114129_10109519 Ga0114129_101095193 269
44 3300009545 Ga0105237_10194142 Ga0105237_101941422 269
45 3300013307 Ga0157372_10002375 Ga0157372_1000237516 269
46 3300013307 Ga0157372_10018387 Ga0157372_100183873 269
47 3300025906 Ga0207699_10020463 Ga0207699_100204634 269
48 3300025913 Ga0207695_10033324 Ga0207695_100333243 269
49 3300025922 Ga0207646_10131197 Ga0207646_101311972 269
50 3300025929 Ga0207664_10092031 Ga0207664_100920313 269
51 3300025929 Ga0207664_10134988 Ga0207664_101349883 269
52 3300025939 Ga0207665_10080245 Ga0207665_100802452 269
53 3300028800 Ga0265338_10260179 Ga0265338_102601791 269
54 3300035692 Ga0373935_0037868 Ga0373935_0037868_434_1243 269
55 3300035695 Ga0373927_0028986 Ga0373927_0028986_448_1257 269
56 3300037068 Ga0373925_0533008 Ga0373925_0533008_137_946 269
57 3300038443 Ga0395901_0310634 Ga0395901_0310634_668_1477 269
58 3300046472 Ga0495580_0001362 Ga0495580_0001362_20477_21286 269
59 3300046531 Ga0495665_0026925 Ga0495665_0026925_240_1049 269
60 3300048088 Ga0495602_0190539 Ga0495602_0190539_707_1516 269
61 3300050507 nmdc:mga05p37_75992_c1 nmdc:mga05p37_75992_c1_2377_3192 269
62 2162886012 MBSR1b_contig_6047714 MBSR1b_0040.00000480 270
63 3300003323 rootH1_10404163 rootH1_104041632 270
64 3300005290 Ga0065712_10003628 Ga0065712_100036285 270
65 3300005328 Ga0070676_10003362 Ga0070676_100033625 270
66 3300005329 Ga0070683_100010980 Ga0070683_1000109803 270
67 3300005335 Ga0070666_10030297 Ga0070666_100302973 270
68 3300005336 Ga0070680_100212172 Ga0070680_1002121721 270
69 3300005338 Ga0068868_100006717 Ga0068868_1000067172 270
70 3300005339 Ga0070660_100018690 Ga0070660_1000186903 270
71 3300005344 Ga0070661_100008680 Ga0070661_1000086806 270
72 3300005347 Ga0070668_100052769 Ga0070668_1000527691 270
73 3300005353 Ga0070669_100058514 Ga0070669_1000585141 270
74 3300005355 Ga0070671_100377879 Ga0070671_1003778792 270
75 3300005366 Ga0070659_100016405 Ga0070659_1000164054 270
76 3300005366 Ga0070659_100030662 Ga0070659_1000306623 270
77 3300005367 Ga0070667_100004110 Ga0070667_1000041102 270
78 3300005434 Ga0070709_10011780 Ga0070709_100117802 270
79 3300005434 Ga0070709_10047505 Ga0070709_100475053 270
80 3300005435 Ga0070714_100419065 Ga0070714_1004190652 270
81 3300005436 Ga0070713_100022625 Ga0070713_1000226254 270
82 3300005436 Ga0070713_100139799 Ga0070713_1001397992 270
83 3300005436 Ga0070713_100194280 Ga0070713_1001942802 270
84 3300005436 Ga0070713_100325481 Ga0070713_1003254811 270
85 3300005437 Ga0070710_10072151 Ga0070710_100721511 270
86 3300005437 Ga0070710_10097368 Ga0070710_100973682 270
87 3300005439 Ga0070711_100029520 Ga0070711_1000295201 270
88 3300005439 Ga0070711_100134274 Ga0070711_1001342741 270
89 3300005444 Ga0070694_100060353 Ga0070694_1000603532 270
90 3300005445 Ga0070708_100000298 Ga0070708_10000029816 270
91 3300005455 Ga0070663_100027656 Ga0070663_1000276562 270
92 3300005456 Ga0070678_100021305 Ga0070678_1000213054 270
93 3300005457 Ga0070662_100018503 Ga0070662_1000185031 270
94 3300005457 Ga0070662_100307489 Ga0070662_1003074892 270
95 3300005458 Ga0070681_10680370 Ga0070681_106803701 270
96 3300005459 Ga0068867_100211616 Ga0068867_1002116162 270
97 3300005467 Ga0070706_100000529 Ga0070706_10000052931 270
98 3300005467 Ga0070706_100042911 Ga0070706_1000429114 270
99 3300005468 Ga0070707_100006081 Ga0070707_1000060812 270
100 3300005468 Ga0070707_100041846 Ga0070707_1000418463 270
101 3300005471 Ga0070698_100000171 Ga0070698_10000017117 270
102 3300005471 Ga0070698_100075335 Ga0070698_1000753353 270
103 3300005518 Ga0070699_100020718 Ga0070699_1000207183 270
104 3300005518 Ga0070699_100096264 Ga0070699_1000962642 270
105 3300005530 Ga0070679_100307562 Ga0070679_1003075622 270
106 3300005530 Ga0070679_100518165 Ga0070679_1005181652 270
107 3300005535 Ga0070684_100033500 Ga0070684_1000335004 270
108 3300005535 Ga0070684_100211335 Ga0070684_1002113351 270
109 3300005536 Ga0070697_100000054 Ga0070697_10000005420 270
110 3300005536 Ga0070697_100047363 Ga0070697_1000473633 270
111 3300005536 Ga0070697_100234813 Ga0070697_1002348132 270
112 3300005539 Ga0068853_100175016 Ga0068853_1001750162 270
113 3300005546 Ga0070696_100235641 Ga0070696_1002356411 270
114 3300005548 Ga0070665_100033884 Ga0070665_1000338843 270
115 3300005564 Ga0070664_100153272 Ga0070664_1001532723 270
116 3300005564 Ga0070664_100421518 Ga0070664_1004215182 270
117 3300005578 Ga0068854_100084687 Ga0068854_1000846872 270
118 3300005578 Ga0068854_100310568 Ga0068854_1003105682 270
119 3300005614 Ga0068856_100107046 Ga0068856_1001070462 270
120 3300005616 Ga0068852_100008382 Ga0068852_1000083823 270
121 3300005616 Ga0068852_100309332 Ga0068852_1003093322 270
122 3300005617 Ga0068859_100034026 Ga0068859_1000340264 270
123 3300005618 Ga0068864_100280587 Ga0068864_1002805872 270
124 3300005718 Ga0068866_10036677 Ga0068866_100366771 270
125 3300005834 Ga0068851_10009864 Ga0068851_100098644 270
126 3300005834 Ga0068851_10025635 Ga0068851_100256352 270
127 3300005841 Ga0068863_100019773 Ga0068863_1000197737 270
128 3300005841 Ga0068863_100397424 Ga0068863_1003974242 270
129 3300005842 Ga0068858_100015899 Ga0068858_1000158996 270
130 3300005842 Ga0068858_100091029 Ga0068858_1000910292 270
131 3300005843 Ga0068860_100009175 Ga0068860_1000091755 270
132 3300005843 Ga0068860_100490568 Ga0068860_1004905682 270
133 3300005844 Ga0068862_100019123 Ga0068862_1000191234 270
134 3300006028 Ga0070717_10003073 Ga0070717_100030736 270
135 3300006028 Ga0070717_10378579 Ga0070717_103785791 270
136 3300006028 Ga0070717_10409508 Ga0070717_104095082 270
137 3300006163 Ga0070715_10001215 Ga0070715_100012155 270
138 3300006173 Ga0070716_100033022 Ga0070716_1000330222 270
139 3300006173 Ga0070716_100085684 Ga0070716_1000856842 270
140 3300006173 Ga0070716_100193350 Ga0070716_1001933502 270
141 3300006175 Ga0070712_100012811 Ga0070712_1000128111 270
142 3300006237 Ga0097621_100051250 Ga0097621_1000512503 270
143 3300006237 Ga0097621_100075255 Ga0097621_1000752552 270
144 3300006237 Ga0097621_100602856 Ga0097621_1006028561 270
145 3300006358 Ga0068871_100011680 Ga0068871_1000116803 270
146 3300006358 Ga0068871_100148504 Ga0068871_1001485042 270
147 3300006852 Ga0075433_10003272 Ga0075433_1000327210 270
148 3300006852 Ga0075433_10088716 Ga0075433_100887162 270
149 3300006871 Ga0075434_100009603 Ga0075434_1000096036 270
150 3300006871 Ga0075434_100017175 Ga0075434_1000171756 270
151 3300006871 Ga0075434_100464204 Ga0075434_1004642042 270
152 3300006881 Ga0068865_100329613 Ga0068865_1003296132 270
153 3300006914 Ga0075436_100000367 Ga0075436_10000036723 270
154 3300006914 Ga0075436_100011060 Ga0075436_1000110601 270
155 3300006914 Ga0075436_100036830 Ga0075436_1000368302 270
156 3300006914 Ga0075436_100056138 Ga0075436_1000561382 270
157 3300006931 Ga0097620_100034027 Ga0097620_1000340274 270
158 3300007076 Ga0075435_100000357 Ga0075435_10000035713 270
159 3300009093 Ga0105240_10029062 Ga0105240_100290624 270
160 3300009093 Ga0105240_10059590 Ga0105240_100595903 270
161 3300009101 Ga0105247_10048726 Ga0105247_100487262 270
162 3300009101 Ga0105247_10093619 Ga0105247_100936191 270
163 3300009147 Ga0114129_10307384 Ga0114129_103073842 270
164 3300009148 Ga0105243_10108711 Ga0105243_101087111 270
165 3300009174 Ga0105241_10018088 Ga0105241_100180885 270
166 3300009174 Ga0105241_10256345 Ga0105241_102563453 270
167 3300009176 Ga0105242_10186054 Ga0105242_101860542 270
168 3300009176 Ga0105242_10196835 Ga0105242_101968352 270
169 3300009177 Ga0105248_10079686 Ga0105248_100796862 270
170 3300009545 Ga0105237_10191698 Ga0105237_101916981 270
171 3300009551 Ga0105238_10390864 Ga0105238_103908642 270
172 3300009553 Ga0105249_10016918 Ga0105249_100169182 270
173 3300010375 Ga0105239_10655607 Ga0105239_106556072 270
174 3300011119 Ga0105246_10044143 Ga0105246_100441431 270
175 3300013105 Ga0157369_10118745 Ga0157369_101187451 270
176 3300013296 Ga0157374_10018109 Ga0157374_100181096 270
177 3300013296 Ga0157374_10280447 Ga0157374_102804473 270
178 3300013297 Ga0157378_10094409 Ga0157378_100944092 270
179 3300013306 Ga0163162_10021711 Ga0163162_100217112 270
180 3300013306 Ga0163162_10247942 Ga0163162_102479422 270
181 3300013307 Ga0157372_10129751 Ga0157372_101297512 270
182 3300013308 Ga0157375_10179111 Ga0157375_101791113 270
183 3300014325 Ga0163163_10022035 Ga0163163_100220354 270
184 3300014325 Ga0163163_10223083 Ga0163163_102230832 270
185 3300014497 Ga0182008_10015893 Ga0182008_100158933 270
186 3300014968 Ga0157379_10005147 Ga0157379_100051474 270
187 3300014968 Ga0157379_10292980 Ga0157379_102929801 270
188 3300015262 Ga0182007_10002727 Ga0182007_100027272 270
189 3300015265 Ga0182005_1009564 Ga0182005_10095643 270
190 3300025898 Ga0207692_10041808 Ga0207692_100418082 270
191 3300025899 Ga0207642_10170856 Ga0207642_101708562 270
192 3300025900 Ga0207710_10029441 Ga0207710_100294412 270
193 3300025903 Ga0207680_10110814 Ga0207680_101108142 270
194 3300025905 Ga0207685_10005386 Ga0207685_100053862 270
195 3300025905 Ga0207685_10124191 Ga0207685_101241911 270
196 3300025906 Ga0207699_10009737 Ga0207699_100097372 270
197 3300025906 Ga0207699_10047165 Ga0207699_100471651 270
198 3300025907 Ga0207645_10003674 Ga0207645_1000367411 270
199 3300025910 Ga0207684_10000702 Ga0207684_1000070228 270
200 3300025910 Ga0207684_10041127 Ga0207684_100411273 270
201 3300025911 Ga0207654_10002903 Ga0207654_100029038 270
202 3300025911 Ga0207654_10010827 Ga0207654_100108272 270
203 3300025912 Ga0207707_10012920 Ga0207707_100129202 270
204 3300025912 Ga0207707_10170787 Ga0207707_101707872 270
205 3300025912 Ga0207707_10347282 Ga0207707_103472821 270
206 3300025913 Ga0207695_10043117 Ga0207695_100431172 270
207 3300025913 Ga0207695_10129302 Ga0207695_101293022 270
208 3300025914 Ga0207671_10022859 Ga0207671_100228594 270
209 3300025915 Ga0207693_10000173 Ga0207693_1000017334 270
210 3300025915 Ga0207693_10121195 Ga0207693_101211952 270
211 3300025916 Ga0207663_10100890 Ga0207663_101008902 270
212 3300025916 Ga0207663_10126973 Ga0207663_101269731 270
213 3300025916 Ga0207663_10131899 Ga0207663_101318992 270
214 3300025917 Ga0207660_10028785 Ga0207660_100287854 270
215 3300025919 Ga0207657_10000215 Ga0207657_1000021548 270
216 3300025920 Ga0207649_10031565 Ga0207649_100315653 270
217 3300025920 Ga0207649_10286543 Ga0207649_102865432 270
218 3300025922 Ga0207646_10005506 Ga0207646_1000550615 270
219 3300025922 Ga0207646_10030672 Ga0207646_100306723 270
220 3300025927 Ga0207687_10001479 Ga0207687_100014792 270
221 3300025927 Ga0207687_10037245 Ga0207687_100372453 270
222 3300025928 Ga0207700_10020713 Ga0207700_100207134 270
223 3300025928 Ga0207700_10085447 Ga0207700_100854472 270
224 3300025928 Ga0207700_10154454 Ga0207700_101544542 270
225 3300025929 Ga0207664_10026515 Ga0207664_100265153 270
226 3300025931 Ga0207644_10329053 Ga0207644_103290532 270
227 3300025932 Ga0207690_10151365 Ga0207690_101513651 270
228 3300025933 Ga0207706_10004908 Ga0207706_1000490811 270
229 3300025933 Ga0207706_10019278 Ga0207706_100192786 270
230 3300025934 Ga0207686_10129792 Ga0207686_101297922 270
231 3300025935 Ga0207709_10111224 Ga0207709_101112241 270
232 3300025939 Ga0207665_10122235 Ga0207665_101222352 270
233 3300025939 Ga0207665_10179016 Ga0207665_101790162 270
234 3300025939 Ga0207665_10553608 Ga0207665_105536081 270
235 3300025941 Ga0207711_10025317 Ga0207711_100253174 270
236 3300025941 Ga0207711_10230301 Ga0207711_102303012 270
237 3300025942 Ga0207689_10186558 Ga0207689_101865582 270
238 3300025942 Ga0207689_10523349 Ga0207689_105233491 270
239 3300025945 Ga0207679_10014735 Ga0207679_100147352 270
240 3300025945 Ga0207679_10592333 Ga0207679_105923331 270
241 3300025961 Ga0207712_10486567 Ga0207712_104865671 270
242 3300025972 Ga0207668_10041205 Ga0207668_100412053 270
243 3300025981 Ga0207640_10016000 Ga0207640_100160004 270
244 3300026023 Ga0207677_10072688 Ga0207677_100726882 270
245 3300026035 Ga0207703_10573221 Ga0207703_105732211 270
246 3300026067 Ga0207678_10000874 Ga0207678_1000087419 270
247 3300026078 Ga0207702_10214569 Ga0207702_102145692 270
248 3300026089 Ga0207648_10017065 Ga0207648_100170656 270
249 3300026116 Ga0207674_10448564 Ga0207674_104485641 270
250 3300026121 Ga0207683_10020514 Ga0207683_100205142 270
251 3300026142 Ga0207698_10043325 Ga0207698_100433252 270
252 3300028379 Ga0268266_10025409 Ga0268266_100254093 270
253 3300028381 Ga0268264_10093079 Ga0268264_100930792 270
254 3300031247 Ga0265340_10005319 Ga0265340_100053194 270
255 3300031911 Ga0307412_10143735 Ga0307412_101437352 270
256 3300032005 Ga0307411_10111748 Ga0307411_101117482 270
257 3300034817 Ga0373948_0014649 Ga0373948_0014649_413_1225 270
258 3300035691 Ga0373931_0035901 Ga0373931_0035901_75_887 270
259 3300042876 Ga0451577_0001074 Ga0451577_0001074_21715_22527 270
260 3300044673 Ga0453683_0032700 Ga0453683_0032700_2341_3153 270
261 3300044673 Ga0453683_0076391 Ga0453683_0076391_553_1365 270
262 3300044712 Ga0453684_0000801 Ga0453684_0000801_42022_42834 270
263 3300045976 Ga0466967_0097195 Ga0466967_0097195_247_1059 270
264 3300046528 Ga0495642_0094107 Ga0495642_0094107_88_900 270
265 3300046684 Ga0495669_0032944 Ga0495669_0032944_551_1363 270
266 3300047317 Ga0495604_0252112 Ga0495604_0252112_26_841 270
267 3300047444 Ga0495675_0259393 Ga0495675_0259393_154_969 270
268 3300048903 Ga0496100_0058292 Ga0496100_0058292_1202_2059 270
269 3300048904 Ga0496101_0118009 Ga0496101_0118009_66_887 270
270 3300048905 Ga0496102_0005869 Ga0496102_0005869_6374_7210 270
271 3300048905 Ga0496102_0098832 Ga0496102_0098832_1413_2225 270
272 3300048905 Ga0496102_0532494 Ga0496102_0532494_244_1056 270
273 3300048906 Ga0496103_0004547 Ga0496103_0004547_3823_4659 270
274 3300048906 Ga0496103_0034632 Ga0496103_0034632_1973_2785 270
275 3300048906 Ga0496103_0160272 Ga0496103_0160272_485_1342 270
276 3300048907 Ga0496104_0004711 Ga0496104_0004711_9068_9904 270
277 3300048907 Ga0496104_0081651 Ga0496104_0081651_1918_2775 270
278 3300048908 Ga0496105_0098705 Ga0496105_0098705_805_1641 270
279 3300048908 Ga0496105_0154703 Ga0496105_0154703_979_1791 270
280 3300048910 Ga0496107_0034138 Ga0496107_0034138_2086_2922 270
281 3300048910 Ga0496107_0436852 Ga0496107_0436852_86_898 270
282 3300048912 Ga0496109_0426144 Ga0496109_0426144_113_925 270
283 3300048913 Ga0496110_0081757 Ga0496110_0081757_1861_2718 270
284 3300048913 Ga0496110_0321764 Ga0496110_0321764_240_1052 270
285 3300048915 Ga0496112_0057191 Ga0496112_0057191_2415_3227 270
286 3300048915 Ga0496112_0090185 Ga0496112_0090185_1230_2087 270
287 3300048915 Ga0496112_0174516 Ga0496112_0174516_505_1362 270
288 3300048916 Ga0496113_0013536 Ga0496113_0013536_1902_2759 270
289 3300048916 Ga0496113_0135841 Ga0496113_0135841_714_1526 270
290 3300048917 Ga0496114_0027200 Ga0496114_0027200_2076_2888 270
291 3300050507 nmdc:mga05p37_294369_c1 nmdc:mga05p37_294369_c1_322_1140 270
292 3300050512 nmdc:mga0n895_1794_c1 nmdc:mga0n895_1794_c1_343_1161 270
293 3300050512 nmdc:mga0n895_438317_c1 nmdc:mga0n895_438317_c1_256_1068 270
294 3300050512 nmdc:mga0n895_7350_c1 nmdc:mga0n895_7350_c1_4859_5674 270
295 3300050513 nmdc:mga0rr50_39288_c1 nmdc:mga0rr50_39288_c1_1639_2484 270
296 3300050513 nmdc:mga0rr50_709_c1 nmdc:mga0rr50_709_c1_2401_3219 270
297 3300050514 nmdc:mga08x19_6686_c1 nmdc:mga08x19_6686_c1_1350_2162 270
298 3300050514 nmdc:mga08x19_69499_c1 nmdc:mga08x19_69499_c1_1368_2186 270
299 3300050514 nmdc:mga08x19_943_c1 nmdc:mga08x19_943_c1_14950_15762 270
300 3300050515 nmdc:mga0a205_64071_c1 nmdc:mga0a205_64071_c1_341_1156 270
301 3300050515 nmdc:mga0a205_6595_c1 nmdc:mga0a205_6595_c1_7636_8454 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01875

Memo

Memo-like protein

7

263

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8886 5 270
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8795 5 270
7m8h-assembly4.cif.gz_D structure of memo1 c244s metal binding site mutant at 1.75a 0.8731 5 270
3bcz-assembly1.cif.gz_A crystal structure of memo 0.8641 5 270
3vsh-assembly1.cif.gz_C crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase 0.7349 41 270
ID Description Score Start End Superfamily
af_Q57846_3_287_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9516 4 270 3.40.830.10
af_Q57846_3_287_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9379 4 270 3.40.830.10
af_Q54NZ1_1_286_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.902 4 268 3.40.830.10
af_C0H4B1_3_295_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8915 4 270 3.40.830.10
af_Q9VG04_2_293_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8912 4 270 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A3B9VDK3-F1-model_v4 AmmeMemoRadiSam system protein B 0.9997 180 270
AF-A0A2V9N004-F1-model_v4 AmmeMemoRadiSam system protein B 0.9989 173 270
AF-A0A3D4P0X3-F1-model_v4 AmmeMemoRadiSam system protein B 0.9982 179 270
AF-A0A2V9TXF5-F1-model_v4 AmmeMemoRadiSam system protein B 0.997 1 144
AF-A0A6N9TR13-F1-model_v4 AmmeMemoRadiSam system protein B 0.9968 181 270

Feature Viewer

pLDDT pTM Quality
96.33 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map