F395782

General Info

Members Datasets Scaffolds Average Seq Length
301 180 602 291

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100227548|Ga0070699_1002275482
Length 326
Sequence VARLYAATGDAFARLDEAGDAWTVELSLPGSGAQCLAVDPADLDTVFVGLRAGGVRRSVDGGRSWIDCKLPEPAVFSLAFSAADGAVYAGTEPSRLFRSDDRGESWRELEALLELPSRPNWSFPPRPWTSHVRWIAPSPHDPGLLLVGIELGGLMRSGDGGQSWQDHRPGAQPDVHSLAWHPXXXGRAYEAGGGGAAFSTDAGETWQRADEGRDRHYTWSVTVDADDPDCWYVSASTGPFAAHGRGDPQARIYRRRDGERWQPLAGGLPEPLPAMPYALVADDGRLFAGLADGQLWESCDRGESWTPLRLRGRALDALVALALTTH

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18.27
Rhizosphere 80.73
Stem 0
Stem Tuber 0
Unclassified 13.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100227548 3300005518 Bacteria 1663
2 Ga0070670_100036834 3300005331 Bacteria 4209
3 Ga0070682_100011994 3300005337 Bacteria 4958
4 Ga0070682_100016628 3300005337 Bacteria 4281
5 Ga0068868_100089205 3300005338 Bacteria 2482
6 Ga0070660_100030112 3300005339 Bacteria 4070
7 Ga0070689_100251009 3300005340 Bacteria 1460
8 Ga0070687_100061645 3300005343 Bacteria 1983
9 Ga0070669_100273292 3300005353 Unclassified 1352
10 Ga0070659_100021311 3300005366 Bacteria 4934
11 Ga0070709_10036192 3300005434 Unclassified 3005
12 Ga0070709_10147940 3300005434 Bacteria 1620
13 Ga0070714_100206071 3300005435 Bacteria 1801
14 Ga0070710_10033425 3300005437 Bacteria 2793
15 Ga0070711_100110636 3300005439 Bacteria 2016
16 Ga0070705_100119063 3300005440 Bacteria 1701
17 Ga0070708_100109527 3300005445 Bacteria 2537
18 Ga0070708_100179127 3300005445 Bacteria 1980
19 Ga0070663_100089611 3300005455 Bacteria 2277
20 Ga0070662_100274359 3300005457 Bacteria 1362
21 Ga0070681_10214848 3300005458 Bacteria 1839
22 Ga0070706_100212657 3300005467 Bacteria 1805
23 Ga0070706_100218570 3300005467 Bacteria 1779
24 Ga0070707_100000511 3300005468 Bacteria 38643
25 Ga0070707_100010774 3300005468 Bacteria 8515
26 Ga0070707_100187795 3300005468 Bacteria 2015
27 Ga0070699_100258600 3300005518 Unclassified 1557
28 Ga0070693_100040501 3300005547 Bacteria 2615
29 Ga0070665_100296446 3300005548 Bacteria 1620
30 Ga0068855_100012233 3300005563 Bacteria 10370
31 Ga0068856_100023510 3300005614 Bacteria 5992
32 Ga0068856_100085701 3300005614 Bacteria 3129
33 Ga0081455_10003080 3300005937 Bacteria 19429
34 Ga0081538_10000187 3300005981 Bacteria 67952
35 Ga0081539_10000030 3300005985 Bacteria 317236
36 Ga0075432_10066833 3300006058 Bacteria 1287
37 Ga0070716_100078562 3300006173 Bacteria 1962
38 Ga0070712_100009855 3300006175 Bacteria 6023
39 Ga0097621_100192299 3300006237 Bacteria 1768
40 Ga0075428_100118576 3300006844 Bacteria 2882
41 Ga0075428_100160619 3300006844 Unclassified 2439
42 Ga0075430_100098409 3300006846 Unclassified 2444
43 Ga0075431_100041597 3300006847 Bacteria 4738
44 Ga0075431_100164932 3300006847 Bacteria 2277
45 Ga0075433_10052249 3300006852 Bacteria 3560
46 Ga0075434_100116372 3300006871 Bacteria 2686
47 Ga0075434_100164748 3300006871 Bacteria 2236
48 Ga0075429_100026812 3300006880 Bacteria 5003
49 Ga0068865_100043826 3300006881 Bacteria 3060
50 Ga0075436_100032327 3300006914 Bacteria 3606
51 Ga0075436_100049106 3300006914 Bacteria 2911
52 Ga0075435_100076636 3300007076 Unclassified 2741
53 Ga0105240_10131699 3300009093 Bacteria 2999
54 Ga0111539_10051106 3300009094 Bacteria 4924
55 Ga0111539_10059369 3300009094 Bacteria 4536
56 Ga0105245_10001182 3300009098 Bacteria 23670
57 Ga0105245_10120176 3300009098 Bacteria 2453
58 Ga0105247_10069284 3300009101 Bacteria 2201
59 Ga0114129_10127400 3300009147 Bacteria 3499
60 Ga0114129_10258089 3300009147 Unclassified 2337
61 Ga0114129_10282002 3300009147 Bacteria 2219
62 Ga0114129_10287071 3300009147 Unclassified 2197
63 Ga0114129_10311188 3300009147 Bacteria 2096
64 Ga0105243_10123571 3300009148 Bacteria 2186
65 Ga0105241_10177765 3300009174 Bacteria 1763
66 Ga0105242_10475791 3300009176 Unclassified 1183
67 Ga0105237_10056159 3300009545 Bacteria 3942
68 Ga0105237_10426769 3300009545 Unclassified 1331
69 Ga0105238_10051211 3300009551 Bacteria 4153
70 Ga0105239_10018697 3300010375 Bacteria 7654
71 Ga0105246_10000223 3300011119 Bacteria 28878
72 Ga0157342_1006030 3300012507 Unclassified 1133
73 Ga0163162_10283497 3300013306 Bacteria 1788
74 Ga0157372_10013063 3300013307 Bacteria 8859
75 Ga0157375_10021543 3300013308 Bacteria 5913
76 Ga0163163_10023326 3300014325 Bacteria 5871
77 Ga0157377_10016350 3300014745 Bacteria 3815
78 Ga0157376_10069840 3300014969 Bacteria 2979
79 Ga0213874_10024428 3300021377 Bacteria 1695
80 Ga0207653_10001296 3300025885 Bacteria 8132
81 Ga0207692_10055285 3300025898 Bacteria 2031
82 Ga0207710_10011803 3300025900 Bacteria 3674
83 Ga0207688_10052605 3300025901 Bacteria 2282
84 Ga0207654_10054468 3300025911 Bacteria 2312
85 Ga0207654_10060787 3300025911 Bacteria 2208
86 Ga0207695_10121590 3300025913 Bacteria 2578
87 Ga0207671_10062380 3300025914 Bacteria 2768
88 Ga0207693_10014837 3300025915 Bacteria 6258
89 Ga0207693_10015735 3300025915 Bacteria 6062
90 Ga0207663_10087583 3300025916 Bacteria 2057
91 Ga0207657_10012367 3300025919 Bacteria 8430
92 Ga0207652_10104386 3300025921 Unclassified 2507
93 Ga0207646_10005691 3300025922 Bacteria 13071
94 Ga0207646_10013817 3300025922 Bacteria 7699
95 Ga0207646_10159092 3300025922 Bacteria 2038
96 Ga0207694_10016706 3300025924 Bacteria 5547
97 Ga0207650_10057376 3300025925 Bacteria 2896
98 Ga0207687_10000248 3300025927 Bacteria 36726
99 Ga0207687_10037558 3300025927 Bacteria 3305
100 Ga0207700_10000006 3300025928 Bacteria 348187
101 Ga0207690_10022560 3300025932 Bacteria 3918
102 Ga0207706_10120599 3300025933 Bacteria 2306
103 Ga0207686_10147563 3300025934 Bacteria 1633
104 Ga0207686_10295573 3300025934 Bacteria 1201
105 Ga0207709_10124666 3300025935 Bacteria 1745
106 Ga0207670_10121408 3300025936 Bacteria 1900
107 Ga0207665_10009840 3300025939 Bacteria 6276
108 Ga0207689_10014393 3300025942 Bacteria 6729
109 Ga0207661_10030656 3300025944 Bacteria 4145
110 Ga0207667_10388665 3300025949 Unclassified 1421
111 Ga0207712_10111557 3300025961 Bacteria 2052
112 Ga0207640_10043853 3300025981 Bacteria 2862
113 Ga0207640_10186904 3300025981 Bacteria 1558
114 Ga0207677_10017767 3300026023 Bacteria 4251
115 Ga0207678_10012703 3300026067 Bacteria 7396
116 Ga0207708_10015016 3300026075 Bacteria 5804
117 Ga0207702_10007338 3300026078 Bacteria 9418
118 Ga0207675_100010431 3300026118 Bacteria 8702
119 Ga0207683_10001427 3300026121 Bacteria 21614
120 Ga0207698_10131904 3300026142 Bacteria 2137
121 Ga0268266_10076781 3300028379 Bacteria 2904
122 Ga0265338_10003936 3300028800 Bacteria 20457
123 Ga0265327_10002785 3300031251 Bacteria 17665
124 Ga0307409_100321567 3300031995 Unclassified 1448
125 Ga0373958_0001893 3300034819 Bacteria 2874
126 Ga0373949_0006445 3300035090 Bacteria 2580
127 Ga0373936_0103167 3300035113 Bacteria 1205
128 Ga0373939_0026330 3300035114 Bacteria 1638
129 Ga0373942_0004985 3300035207 Bacteria 3077
130 Ga0373942_0013222 3300035207 Unclassified 1982
131 Ga0373962_0000552 3300035242 Bacteria 8423
132 Ga0373931_0008793 3300035691 Bacteria 4804
133 Ga0373935_0168736 3300035692 Bacteria 1496
134 Ga0373925_0145081 3300037068 Bacteria 1860
135 Ga0395899_0001410 3300037312 Bacteria 20607
136 Ga0395899_0002522 3300037312 Bacteria 14832
137 Ga0395899_0039561 3300037312 Bacteria 3529
138 Ga0395899_0079921 3300037312 Bacteria 2381
139 Ga0395900_0001311 3300037418 Bacteria 30204
140 Ga0395900_0001574 3300037418 Bacteria 27021
141 Ga0395900_0006362 3300037418 Bacteria 12311
142 Ga0395900_0022641 3300037418 Bacteria 6431
143 Ga0395900_0155301 3300037418 Bacteria 2337
144 Ga0395898_0000635 3300037466 Bacteria 64060
145 Ga0395898_0019934 3300037466 Bacteria 6819
146 Ga0395898_0021878 3300037466 Bacteria 6478
147 Ga0395898_0081276 3300037466 Bacteria 3125
148 Ga0395898_0084724 3300037466 Bacteria 3055
149 Ga0395905_0003526 3300037471 Bacteria 16686
150 Ga0395905_0013119 3300037471 Bacteria 7954
151 Ga0395905_0056963 3300037471 Bacteria 3655
152 Ga0436364_0861790 3300037853 Bacteria 1865
153 Ga0395901_0002544 3300038443 Bacteria 18471
154 Ga0395901_0060330 3300038443 Bacteria 3947
155 Ga0395901_0063534 3300038443 Bacteria 3842
156 Ga0395901_0101346 3300038443 Bacteria 3021
157 Ga0395901_0223501 3300038443 Bacteria 1967
158 Ga0436360_0692628 3300039438 Bacteria 3010
159 Ga0436363_0551035 3300039450 Bacteria 3131
160 Ga0436362_0920220 3300039453 Bacteria 3571
161 Ga0439453_0003326 3300041408 Unclassified 2306
162 Ga0439451_017150 3300042009 Unclassified 1459
163 Ga0466965_0067933 3300044683 Bacteria 1789
164 Ga0466961_0008533 3300044693 Bacteria 6527
165 Ga0466959_0001615 3300045049 Bacteria 13896
166 Ga0466958_0035252 3300045836 Bacteria 2989
167 Ga0495629_0088702 3300046459 Unclassified 2157
168 Ga0495629_0229078 3300046459 Bacteria 1281
169 Ga0495580_0193168 3300046472 Bacteria 1404
170 Ga0495582_0020123 3300046473 Bacteria 3652
171 Ga0495582_0027210 3300046473 Bacteria 3133
172 Ga0495582_0083866 3300046473 Bacteria 1771
173 Ga0495582_0174996 3300046473 Unclassified 1222
174 Ga0495582_0186401 3300046473 Bacteria 1183
175 Ga0495639_0008006 3300046475 Bacteria 4540
176 Ga0495639_0069977 3300046475 Bacteria 1619
177 Ga0495662_0023825 3300046476 Bacteria 2956
178 Ga0495662_0096660 3300046476 Bacteria 1443
179 Ga0495662_0129871 3300046476 Unclassified 1238
180 Ga0495662_0130878 3300046476 Unclassified 1233
181 Ga0495664_0019890 3300046477 Bacteria 3866
182 Ga0495664_0119396 3300046477 Unclassified 1594
183 Ga0495594_0139268 3300046499 Bacteria 1376
184 Ga0495618_0011834 3300046514 Bacteria 5295
185 Ga0495630_0132589 3300046517 Bacteria 1892
186 Ga0495630_0185130 3300046517 Unclassified 1588
187 Ga0495666_0099607 3300046526 Unclassified 1369
188 Ga0495652_0051023 3300046529 Bacteria 3535
189 Ga0495652_0076013 3300046529 Bacteria 2787
190 Ga0495665_0033875 3300046531 Bacteria 2731
191 Ga0495640_0099661 3300046533 Unclassified 1908
192 Ga0495640_0168230 3300046533 Unclassified 1401
193 Ga0495586_0047273 3300046535 Bacteria 2323
194 Ga0495586_0182124 3300046535 Bacteria 1188
195 Ga0495645_0075424 3300046543 Unclassified 2427
196 Ga0495634_0083502 3300046642 Unclassified 2084
197 Ga0495634_0139594 3300046642 Bacteria 1539
198 Ga0495634_0154015 3300046642 Bacteria 1452
199 Ga0495635_0031358 3300046663 Bacteria 3690
200 Ga0495635_0045745 3300046663 Bacteria 3019
201 Ga0495635_0090174 3300046663 Bacteria 2097
202 Ga0495635_0240515 3300046663 Unclassified 1221
203 Ga0495635_0240914 3300046663 Bacteria 1220
204 Ga0495658_0004324 3300046683 Bacteria 6996
205 Ga0495658_0089721 3300046683 Bacteria 1818
206 Ga0495613_0296214 3300046689 Bacteria 1120
207 Ga0495624_0014933 3300046690 Bacteria 5259
208 Ga0495600_0074130 3300046809 Bacteria 2222
209 Ga0495581_0028144 3300047315 Bacteria 3258
210 Ga0495581_0045258 3300047315 Unclassified 2544
211 Ga0495674_0042031 3300047319 Bacteria 4080
212 Ga0495674_0067634 3300047319 Bacteria 3094
213 Ga0495674_0093192 3300047319 Unclassified 2570
214 Ga0495674_0122885 3300047319 Unclassified 2192
215 Ga0495676_0010264 3300047321 Bacteria 8499
216 Ga0495676_0017629 3300047321 Bacteria 6309
217 Ga0495676_0032984 3300047321 Bacteria 4365
218 Ga0495680_0036181 3300047322 Unclassified 3967
219 Ga0495680_0289902 3300047322 Unclassified 1151
220 Ga0495684_0130073 3300047471 Bacteria 1891
221 Ga0495684_0267288 3300047471 Unclassified 1238
222 Ga0495684_0267981 3300047471 Unclassified 1236
223 Ga0495684_0299940 3300047471 Bacteria 1154
224 Ga0495593_0021679 3300047673 Bacteria 3585
225 Ga0495602_0207580 3300048088 Bacteria 1490
226 Ga0495614_0125411 3300048089 Bacteria 1134
227 Ga0496100_0002896 3300048903 Bacteria 8805
228 Ga0496100_0135684 3300048903 Bacteria 1738
229 Ga0496100_0145344 3300048903 Unclassified 1685
230 Ga0496100_0324492 3300048903 Bacteria 1157
231 Ga0496101_0001011 3300048904 Bacteria 16565
232 Ga0496101_0014937 3300048904 Bacteria 5225
233 Ga0496101_0025756 3300048904 Bacteria 4083
234 Ga0496101_0097331 3300048904 Bacteria 2197
235 Ga0496101_0269697 3300048904 Bacteria 1328
236 Ga0496101_0292608 3300048904 Bacteria 1274
237 Ga0496101_0401329 3300048904 Bacteria 1079
238 Ga0496102_0002403 3300048905 Bacteria 15981
239 Ga0496102_0041656 3300048905 Bacteria 4160
240 Ga0496102_0224080 3300048905 Bacteria 1773
241 Ga0496102_0230889 3300048905 Bacteria 1744
242 Ga0496103_0001481 3300048906 Bacteria 15689
243 Ga0496103_0008985 3300048906 Bacteria 5924
244 Ga0496103_0009739 3300048906 Bacteria 5689
245 Ga0496103_0054888 3300048906 Bacteria 2470
246 Ga0496104_0000504 3300048907 Bacteria 33646
247 Ga0496104_0023764 3300048907 Bacteria 5636
248 Ga0496104_0027296 3300048907 Bacteria 5283
249 Ga0496104_0059256 3300048907 Bacteria 3624
250 Ga0496104_0417480 3300048907 Bacteria 1254
251 Ga0496105_0000970 3300048908 Bacteria 19728
252 Ga0496105_0038065 3300048908 Bacteria 3962
253 Ga0496105_0111767 3300048908 Bacteria 2254
254 Ga0496106_0014800 3300048909 Bacteria 5768
255 Ga0496106_0057459 3300048909 Bacteria 2942
256 Ga0496106_0156458 3300048909 Bacteria 1800
257 Ga0496106_0351204 3300048909 Bacteria 1184
258 Ga0496107_0000480 3300048910 Bacteria 21972
259 Ga0496107_0007918 3300048910 Bacteria 7331
260 Ga0496107_0075705 3300048910 Bacteria 2450
261 Ga0496108_0011717 3300048911 Bacteria 7132
262 Ga0496109_0025887 3300048912 Bacteria 5230
263 Ga0496109_0139166 3300048912 Bacteria 2269
264 Ga0496110_0010007 3300048913 Bacteria 7694
265 Ga0496110_0054354 3300048913 Bacteria 3522
266 Ga0496110_0082605 3300048913 Bacteria 2865
267 Ga0496110_0085605 3300048913 Bacteria 2813
268 Ga0496111_0006097 3300048914 Bacteria 7797
269 Ga0496111_0013686 3300048914 Bacteria 5525
270 Ga0496111_0106397 3300048914 Bacteria 2065
271 Ga0496111_0146852 3300048914 Bacteria 1748
272 Ga0496112_0025247 3300048915 Bacteria 5704
273 Ga0496113_0007000 3300048916 Bacteria 7212
274 Ga0496113_0161278 3300048916 Bacteria 1773
275 Ga0496113_0175200 3300048916 Bacteria 1699
276 Ga0496114_0001815 3300048917 Bacteria 16191
277 Ga0496114_0012663 3300048917 Bacteria 6756
278 Ga0496114_0052565 3300048917 Bacteria 3394
279 Ga0496115_0000867 3300048918 Bacteria 22015
280 Ga0496115_0012108 3300048918 Bacteria 6485
281 Ga0496115_0108135 3300048918 Bacteria 2283
282 Ga0501067_0013105 3300049583 Bacteria 4589
283 nmdc:mga05p37_254845_c1 3300050507 Bacteria 2103
284 nmdc:mga05p37_25867_c1 3300050507 Bacteria 7136
285 nmdc:mga09592_685_c1 3300050508 Bacteria 25881
286 nmdc:mga06r32_97145_c1 3300050510 Bacteria 2886
287 nmdc:mga08y16_146328_c1 3300050511 Bacteria 2456
288 nmdc:mga08y16_509675_c1 3300050511 Bacteria 1221
289 nmdc:mga0n895_470_c1 3300050512 Bacteria 27107
290 nmdc:mga0rr50_15261_c1 3300050513 Bacteria 5067
291 nmdc:mga0rr50_55313_c1 3300050513 Unclassified 2960
292 nmdc:mga08x19_3661_c1 3300050514 Bacteria 9150
293 nmdc:mga08x19_63960_c1 3300050514 Bacteria 2388
294 nmdc:mga0a205_76580_c1 3300050515 Bacteria 3233
295 Ga0495601_0006868 3300053077 Bacteria 6667
296 Ga0495601_0103798 3300053077 Bacteria 1837
297 Ga0495601_0300551 3300053077 Bacteria 1045
298 Ga0495612_0011002 3300053078 Bacteria 3653
299 Ga0495595_0069584 3300053084 Unclassified 1662
300 Ga0495619_0057379 3300053085 Bacteria 2584
301 Ga0495619_0120543 3300053085 Unclassified 1798
302 Ga0070699_100227548
303 Ga0070670_100036834
304 Ga0070682_100011994
305 Ga0070682_100016628
306 Ga0068868_100089205
307 Ga0070660_100030112
308 Ga0070689_100251009
309 Ga0070687_100061645
310 Ga0070669_100273292
311 Ga0070659_100021311
312 Ga0070709_10036192
313 Ga0070709_10147940
314 Ga0070714_100206071
315 Ga0070710_10033425
316 Ga0070711_100110636
317 Ga0070705_100119063
318 Ga0070708_100109527
319 Ga0070708_100179127
320 Ga0070663_100089611
321 Ga0070662_100274359
322 Ga0070681_10214848
323 Ga0070706_100212657
324 Ga0070706_100218570
325 Ga0070707_100000511
326 Ga0070707_100010774
327 Ga0070707_100187795
328 Ga0070699_100258600
329 Ga0070693_100040501
330 Ga0070665_100296446
331 Ga0068855_100012233
332 Ga0068856_100023510
333 Ga0068856_100085701
334 Ga0081455_10003080
335 Ga0081538_10000187
336 Ga0081539_10000030
337 Ga0075432_10066833
338 Ga0070716_100078562
339 Ga0070712_100009855
340 Ga0097621_100192299
341 Ga0075428_100118576
342 Ga0075428_100160619
343 Ga0075430_100098409
344 Ga0075431_100041597
345 Ga0075431_100164932
346 Ga0075433_10052249
347 Ga0075434_100116372
348 Ga0075434_100164748
349 Ga0075429_100026812
350 Ga0068865_100043826
351 Ga0075436_100032327
352 Ga0075436_100049106
353 Ga0075435_100076636
354 Ga0105240_10131699
355 Ga0111539_10051106
356 Ga0111539_10059369
357 Ga0105245_10001182
358 Ga0105245_10120176
359 Ga0105247_10069284
360 Ga0114129_10127400
361 Ga0114129_10258089
362 Ga0114129_10282002
363 Ga0114129_10287071
364 Ga0114129_10311188
365 Ga0105243_10123571
366 Ga0105241_10177765
367 Ga0105242_10475791
368 Ga0105237_10056159
369 Ga0105237_10426769
370 Ga0105238_10051211
371 Ga0105239_10018697
372 Ga0105246_10000223
373 Ga0157342_1006030
374 Ga0163162_10283497
375 Ga0157372_10013063
376 Ga0157375_10021543
377 Ga0163163_10023326
378 Ga0157377_10016350
379 Ga0157376_10069840
380 Ga0213874_10024428
381 Ga0207653_10001296
382 Ga0207692_10055285
383 Ga0207710_10011803
384 Ga0207688_10052605
385 Ga0207654_10054468
386 Ga0207654_10060787
387 Ga0207695_10121590
388 Ga0207671_10062380
389 Ga0207693_10014837
390 Ga0207693_10015735
391 Ga0207663_10087583
392 Ga0207657_10012367
393 Ga0207652_10104386
394 Ga0207646_10005691
395 Ga0207646_10013817
396 Ga0207646_10159092
397 Ga0207694_10016706
398 Ga0207650_10057376
399 Ga0207687_10000248
400 Ga0207687_10037558
401 Ga0207700_10000006
402 Ga0207690_10022560
403 Ga0207706_10120599
404 Ga0207686_10147563
405 Ga0207686_10295573
406 Ga0207709_10124666
407 Ga0207670_10121408
408 Ga0207665_10009840
409 Ga0207689_10014393
410 Ga0207661_10030656
411 Ga0207667_10388665
412 Ga0207712_10111557
413 Ga0207640_10043853
414 Ga0207640_10186904
415 Ga0207677_10017767
416 Ga0207678_10012703
417 Ga0207708_10015016
418 Ga0207702_10007338
419 Ga0207675_100010431
420 Ga0207683_10001427
421 Ga0207698_10131904
422 Ga0268266_10076781
423 Ga0265338_10003936
424 Ga0265327_10002785
425 Ga0307409_100321567
426 Ga0373958_0001893
427 Ga0373949_0006445
428 Ga0373936_0103167
429 Ga0373939_0026330
430 Ga0373942_0004985
431 Ga0373942_0013222
432 Ga0373962_0000552
433 Ga0373931_0008793
434 Ga0373935_0168736
435 Ga0373925_0145081
436 Ga0395899_0001410
437 Ga0395899_0002522
438 Ga0395899_0039561
439 Ga0395899_0079921
440 Ga0395900_0001311
441 Ga0395900_0001574
442 Ga0395900_0006362
443 Ga0395900_0022641
444 Ga0395900_0155301
445 Ga0395898_0000635
446 Ga0395898_0019934
447 Ga0395898_0021878
448 Ga0395898_0081276
449 Ga0395898_0084724
450 Ga0395905_0003526
451 Ga0395905_0013119
452 Ga0395905_0056963
453 Ga0436364_0861790
454 Ga0395901_0002544
455 Ga0395901_0060330
456 Ga0395901_0063534
457 Ga0395901_0101346
458 Ga0395901_0223501
459 Ga0436360_0692628
460 Ga0436363_0551035
461 Ga0436362_0920220
462 Ga0439453_0003326
463 Ga0439451_017150
464 Ga0466965_0067933
465 Ga0466961_0008533
466 Ga0466959_0001615
467 Ga0466958_0035252
468 Ga0495629_0088702
469 Ga0495629_0229078
470 Ga0495580_0193168
471 Ga0495582_0020123
472 Ga0495582_0027210
473 Ga0495582_0083866
474 Ga0495582_0174996
475 Ga0495582_0186401
476 Ga0495639_0008006
477 Ga0495639_0069977
478 Ga0495662_0023825
479 Ga0495662_0096660
480 Ga0495662_0129871
481 Ga0495662_0130878
482 Ga0495664_0019890
483 Ga0495664_0119396
484 Ga0495594_0139268
485 Ga0495618_0011834
486 Ga0495630_0132589
487 Ga0495630_0185130
488 Ga0495666_0099607
489 Ga0495652_0051023
490 Ga0495652_0076013
491 Ga0495665_0033875
492 Ga0495640_0099661
493 Ga0495640_0168230
494 Ga0495586_0047273
495 Ga0495586_0182124
496 Ga0495645_0075424
497 Ga0495634_0083502
498 Ga0495634_0139594
499 Ga0495634_0154015
500 Ga0495635_0031358
501 Ga0495635_0045745
502 Ga0495635_0090174
503 Ga0495635_0240515
504 Ga0495635_0240914
505 Ga0495658_0004324
506 Ga0495658_0089721
507 Ga0495613_0296214
508 Ga0495624_0014933
509 Ga0495600_0074130
510 Ga0495581_0028144
511 Ga0495581_0045258
512 Ga0495674_0042031
513 Ga0495674_0067634
514 Ga0495674_0093192
515 Ga0495674_0122885
516 Ga0495676_0010264
517 Ga0495676_0017629
518 Ga0495676_0032984
519 Ga0495680_0036181
520 Ga0495680_0289902
521 Ga0495684_0130073
522 Ga0495684_0267288
523 Ga0495684_0267981
524 Ga0495684_0299940
525 Ga0495593_0021679
526 Ga0495602_0207580
527 Ga0495614_0125411
528 Ga0496100_0002896
529 Ga0496100_0135684
530 Ga0496100_0145344
531 Ga0496100_0324492
532 Ga0496101_0001011
533 Ga0496101_0014937
534 Ga0496101_0025756
535 Ga0496101_0097331
536 Ga0496101_0269697
537 Ga0496101_0292608
538 Ga0496101_0401329
539 Ga0496102_0002403
540 Ga0496102_0041656
541 Ga0496102_0224080
542 Ga0496102_0230889
543 Ga0496103_0001481
544 Ga0496103_0008985
545 Ga0496103_0009739
546 Ga0496103_0054888
547 Ga0496104_0000504
548 Ga0496104_0023764
549 Ga0496104_0027296
550 Ga0496104_0059256
551 Ga0496104_0417480
552 Ga0496105_0000970
553 Ga0496105_0038065
554 Ga0496105_0111767
555 Ga0496106_0014800
556 Ga0496106_0057459
557 Ga0496106_0156458
558 Ga0496106_0351204
559 Ga0496107_0000480
560 Ga0496107_0007918
561 Ga0496107_0075705
562 Ga0496108_0011717
563 Ga0496109_0025887
564 Ga0496109_0139166
565 Ga0496110_0010007
566 Ga0496110_0054354
567 Ga0496110_0082605
568 Ga0496110_0085605
569 Ga0496111_0006097
570 Ga0496111_0013686
571 Ga0496111_0106397
572 Ga0496111_0146852
573 Ga0496112_0025247
574 Ga0496113_0007000
575 Ga0496113_0161278
576 Ga0496113_0175200
577 Ga0496114_0001815
578 Ga0496114_0012663
579 Ga0496114_0052565
580 Ga0496115_0000867
581 Ga0496115_0012108
582 Ga0496115_0108135
583 Ga0501067_0013105
584 nmdc:mga05p37_254845_c1
585 nmdc:mga05p37_25867_c1
586 nmdc:mga09592_685_c1
587 nmdc:mga06r32_97145_c1
588 nmdc:mga08y16_146328_c1
589 nmdc:mga08y16_509675_c1
590 nmdc:mga0n895_470_c1
591 nmdc:mga0rr50_15261_c1
592 nmdc:mga0rr50_55313_c1
593 nmdc:mga08x19_3661_c1
594 nmdc:mga08x19_63960_c1
595 nmdc:mga0a205_76580_c1
596 Ga0495601_0006868
597 Ga0495601_0103798
598 Ga0495601_0300551
599 Ga0495612_0011002
600 Ga0495595_0069584
601 Ga0495619_0057379
602 Ga0495619_0120543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kf4-assembly1.cif.gz_A barnase high pressure structure 0.8336 118 143
1ban-assembly2.cif.gz_B the contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants 0.7922 118 143
2rbi-assembly2.cif.gz_B structure of binase mutant his 101 asn 0.7835 118 143
1bse-assembly3.cif.gz_C crystal structural analysis of mutations in the hydrophobic cores of barnase 0.7793 118 143
2m3x-assembly1.cif.gz_A solution structure of ph1500: a homohexameric protein centered on a 12-bladed beta-propeller 0.717 237 267
ID Description Score Start End Superfamily
af_A0A0R0E6S3_1_117_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7627 2 83 2.130.10.10
2m3xC02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7106 237 267 2.40.10.360
af_Q86TI4_245_352_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.6899 208 278 2.40.128.630
af_A0A0P0VQD8_25_138_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6772 181 280 2.130.10.10
af_A0A1D6G4Q6_8_123_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.669 3 83 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2E8PH40-F1-model_v4 deleted 0.9545 1 71
AF-A0A091C421-F1-model_v4 Uncharacterized protein 0.9469 1 57
AF-A0A091C421-F1-model_v4 Uncharacterized protein 0.9165 1 57
AF-A0A2E8PH40-F1-model_v4 deleted 0.9043 1 71
AF-A0A538BSK5-F1-model_v4 Exo-alpha-sialidase 0.9021 2 280 GO:0000272
GO:0010411
GO:0016798

Map