F395780

General Info

Members Datasets Scaffolds Average Seq Length
301 167 602 295

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100004012|Ga0070699_1000040122
Length 318
Sequence MNRVSARPIVGVIAVVVLLMAVAAELQAARERWFASARIDDDALYIESGLAMKRLTVSLNTLAADVYWIRAIQYYGSTKRRLASQVSGPEPSATIADTSDYRNLYQLLDLTTSLDPRFDIAYRFGAVFLAEGYPNGPGRPDLAIRFLEKGLRERPDKWQYMQDIGFVRYWYERDYQGAAQWFRKASEVAGAPIWLKPLAATTLAQGGDRRSSRVMWLTILQSADVDWLKQQAERRLTQLHALDDIDELQRIIDTYSQRTGTPPLDWMTLVRARVLRGVPADPTGVPYELTTDGRVQLSQSSTLFPLPSEPAQLPPSSR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 2.66
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 17.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100004012 3300005518 Bacteria 13013
2 Ga0065712_10069168 3300005290 Bacteria 7835
3 Ga0070683_100000203 3300005329 Bacteria 40069
4 Ga0070690_100062509 3300005330 Bacteria 2401
5 Ga0070670_100075325 3300005331 Bacteria 2899
6 Ga0070660_100225466 3300005339 Unclassified 1524
7 Ga0070661_100117541 3300005344 Bacteria 1989
8 Ga0070661_100243626 3300005344 Bacteria 1385
9 Ga0070692_10094394 3300005345 Unclassified 1631
10 Ga0070668_100014806 3300005347 Bacteria 5828
11 Ga0070669_100014168 3300005353 Bacteria 5674
12 Ga0070669_100167372 3300005353 Unclassified 1712
13 Ga0070675_100040946 3300005354 Bacteria 3784
14 Ga0070675_100062330 3300005354 Unclassified 3081
15 Ga0070675_100164302 3300005354 Bacteria 1911
16 Ga0070671_100016917 3300005355 Bacteria 5898
17 Ga0070673_100066725 3300005364 Bacteria 2875
18 Ga0070688_100135916 3300005365 Bacteria 1664
19 Ga0070659_100025114 3300005366 Bacteria 4574
20 Ga0070659_100108159 3300005366 Bacteria 2243
21 Ga0070714_100031193 3300005435 Bacteria 4445
22 Ga0070700_100045209 3300005441 Unclassified 2716
23 Ga0070700_100058425 3300005441 Unclassified 2423
24 Ga0070694_100007762 3300005444 Bacteria 6545
25 Ga0070663_100016428 3300005455 Bacteria 4808
26 Ga0070663_100198865 3300005455 Bacteria 1563
27 Ga0070662_100145337 3300005457 Bacteria 1842
28 Ga0070681_10217756 3300005458 Bacteria 1825
29 Ga0070707_100194040 3300005468 Bacteria 1980
30 Ga0070698_100025487 3300005471 Bacteria 6164
31 Ga0070699_100010698 3300005518 Bacteria 7940
32 Ga0070684_100001332 3300005535 Bacteria 17667
33 Ga0070697_100025783 3300005536 Bacteria 4689
34 Ga0070672_100047294 3300005543 Bacteria 3338
35 Ga0070696_100012078 3300005546 Bacteria 5787
36 Ga0070693_100064658 3300005547 Bacteria 2136
37 Ga0070665_100007118 3300005548 Bacteria 11371
38 Ga0070665_100578333 3300005548 Unclassified 1136
39 Ga0070664_100001490 3300005564 Bacteria 18643
40 Ga0070664_100050581 3300005564 Bacteria 3517
41 Ga0068857_100007430 3300005577 Bacteria 9432
42 Ga0068857_100053832 3300005577 Unclassified 3570
43 Ga0068864_100242234 3300005618 Unclassified 1671
44 Ga0068864_100263386 3300005618 Bacteria 1604
45 Ga0068863_100034501 3300005841 Bacteria 4819
46 Ga0068858_100152028 3300005842 Bacteria 2177
47 Ga0068858_100481296 3300005842 Unclassified 1198
48 Ga0068862_100018210 3300005844 Bacteria 5847
49 Ga0075364_10043893 3300006051 Unclassified 2907
50 Ga0075367_10049206 3300006178 Bacteria 2484
51 Ga0075366_10001835 3300006195 Bacteria 10710
52 Ga0097621_100021344 3300006237 Bacteria 5007
53 Ga0097621_100253026 3300006237 Bacteria 1543
54 Ga0068871_100002760 3300006358 Bacteria 11991
55 Ga0068871_100029999 3300006358 Bacteria 4278
56 Ga0068871_100184389 3300006358 Bacteria 1795
57 Ga0075428_100008514 3300006844 Bacteria 11380
58 Ga0075428_100014461 3300006844 Bacteria 8766
59 Ga0075428_100162354 3300006844 Unclassified 2425
60 Ga0075428_100382930 3300006844 Unclassified 1508
61 Ga0075430_100009170 3300006846 Bacteria 8362
62 Ga0075430_100019049 3300006846 Bacteria 5839
63 Ga0075431_100020798 3300006847 Bacteria 6706
64 Ga0075431_100046264 3300006847 Bacteria 4486
65 Ga0075431_100072107 3300006847 Bacteria 3564
66 Ga0075431_100378902 3300006847 Bacteria 1419
67 Ga0075433_10020473 3300006852 Bacteria 5532
68 Ga0075433_10054085 3300006852 Bacteria 3502
69 Ga0075433_10062824 3300006852 Bacteria 3253
70 Ga0075434_100001728 3300006871 Bacteria 18751
71 Ga0075434_100013037 3300006871 Bacteria 7893
72 Ga0075434_100024126 3300006871 Bacteria 5942
73 Ga0075434_100031318 3300006871 Bacteria 5243
74 Ga0075434_100095000 3300006871 Bacteria 2987
75 Ga0075434_100340689 3300006871 Unclassified 1520
76 Ga0075429_100529239 3300006880 Bacteria 1033
77 Ga0075436_100019451 3300006914 Bacteria 4653
78 Ga0075436_100023521 3300006914 Bacteria 4232
79 Ga0075436_100049193 3300006914 Bacteria 2909
80 Ga0075435_100005605 3300007076 Bacteria 8791
81 Ga0111539_10189308 3300009094 Unclassified 2401
82 Ga0105247_10098933 3300009101 Unclassified 1862
83 Ga0114129_10000282 3300009147 Bacteria 58440
84 Ga0114129_10040776 3300009147 Bacteria 6544
85 Ga0105242_10039955 3300009176 Bacteria 3779
86 Ga0105242_10255311 3300009176 Bacteria 1581
87 Ga0105242_10537257 3300009176 Unclassified 1118
88 Ga0105248_10051434 3300009177 Bacteria 4623
89 Ga0105248_10136673 3300009177 Unclassified 2765
90 Ga0105237_10010554 3300009545 Bacteria 9816
91 Ga0105249_10000685 3300009553 Bacteria 30822
92 Ga0105249_10040837 3300009553 Bacteria 4215
93 Ga0105249_10387848 3300009553 Bacteria 1424
94 Ga0105246_10151671 3300011119 Unclassified 1755
95 Ga0157370_10191069 3300013104 Bacteria 1901
96 Ga0157374_10173665 3300013296 Unclassified 2103
97 Ga0157378_10035119 3300013297 Bacteria 4433
98 Ga0157378_10199372 3300013297 Bacteria 1892
99 Ga0157378_10618722 3300013297 Bacteria 1096
100 Ga0163162_10046198 3300013306 Bacteria 4364
101 Ga0157375_10168435 3300013308 Bacteria 2337
102 Ga0157375_10382213 3300013308 Bacteria 1575
103 Ga0163163_10000013 3300014325 Bacteria 242522
104 Ga0163163_10022335 3300014325 Bacteria 5988
105 Ga0157380_10038180 3300014326 Bacteria 3727
106 Ga0157377_10077668 3300014745 Bacteria 1933
107 Ga0157379_10494312 3300014968 Bacteria 1133
108 Ga0157376_10377678 3300014969 Bacteria 1364
109 Ga0207645_10016728 3300025907 Bacteria 4849
110 Ga0207707_10317910 3300025912 Bacteria 1345
111 Ga0207681_10015414 3300025923 Unclassified 4765
112 Ga0207681_10021629 3300025923 Unclassified 4092
113 Ga0207681_10118794 3300025923 Bacteria 1936
114 Ga0207650_10005892 3300025925 Bacteria 8365
115 Ga0207659_10147882 3300025926 Bacteria 1831
116 Ga0207659_10186457 3300025926 Unclassified 1648
117 Ga0207706_10028346 3300025933 Bacteria 5002
118 Ga0207704_10021511 3300025938 Bacteria 3437
119 Ga0207704_10347500 3300025938 Unclassified 1154
120 Ga0207691_10054563 3300025940 Bacteria 3645
121 Ga0207711_10045530 3300025941 Bacteria 3749
122 Ga0207661_10010362 3300025944 Bacteria 6708
123 Ga0207679_10008902 3300025945 Bacteria 6407
124 Ga0207679_10551195 3300025945 Bacteria 1034
125 Ga0207712_10029901 3300025961 Unclassified 3659
126 Ga0207712_10106324 3300025961 Bacteria 2096
127 Ga0207668_10203234 3300025972 Bacteria 1579
128 Ga0207658_10117765 3300025986 Unclassified 2112
129 Ga0207678_10024138 3300026067 Bacteria 5312
130 Ga0207708_10048460 3300026075 Bacteria 3234
131 Ga0207641_10046137 3300026088 Bacteria 3672
132 Ga0207648_10018689 3300026089 Bacteria 6268
133 Ga0207674_10010498 3300026116 Bacteria 10482
134 Ga0207674_10060249 3300026116 Bacteria 3839
135 Ga0207675_100131871 3300026118 Bacteria 2370
136 Ga0207675_100232734 3300026118 Bacteria 1778
137 Ga0207428_10013205 3300027907 Bacteria 7229
138 Ga0207428_10056933 3300027907 Bacteria 3105
139 Ga0268266_10062589 3300028379 Bacteria 3212
140 Ga0268265_10103001 3300028380 Bacteria 2310
141 Ga0307408_100073600 3300031548 Bacteria 2533
142 Ga0307408_100211261 3300031548 Unclassified 1577
143 Ga0307413_10293598 3300031824 Unclassified 1229
144 Ga0307410_10065246 3300031852 Bacteria 2504
145 Ga0307410_10147747 3300031852 Unclassified 1746
146 Ga0307410_10177999 3300031852 Unclassified 1608
147 Ga0307406_10107131 3300031901 Unclassified 1916
148 Ga0307406_10303871 3300031901 Unclassified 1227
149 Ga0307407_10013973 3300031903 Bacteria 3916
150 Ga0307409_100032117 3300031995 Bacteria 3801
151 Ga0307416_100008835 3300032002 Bacteria 6537
152 Ga0307416_100034254 3300032002 Bacteria 3862
153 Ga0307411_10064732 3300032005 Bacteria 2449
154 Ga0307415_100073533 3300032126 Bacteria 2412
155 Ga0307415_100090570 3300032126 Bacteria 2213
156 Ga0373934_0005175 3300035086 Bacteria 4828
157 Ga0373956_0011128 3300035119 Bacteria 3705
158 Ga0373955_0002515 3300035172 Bacteria 8011
159 Ga0373933_0070234 3300035724 Bacteria 2130
160 Ga0373937_0000790 3300036401 Bacteria 27115
161 Ga0439433_0009584 3300041999 Bacteria 2113
162 Ga0439445_0015349 3300042004 Unclassified 1875
163 Ga0439449_0106669 3300042007 Bacteria 1037
164 Ga0450923_017058 3300042125 Unclassified 1375
165 Ga0439435_0002973 3300042436 Unclassified 3453
166 Ga0451576_0017663 3300045051 Bacteria 7840
167 Ga0451576_0194578 3300045051 Bacteria 2118
168 Ga0495629_0164464 3300046459 Unclassified 1541
169 Ga0495664_0209299 3300046477 Bacteria 1181
170 Ga0495621_0004712 3300046539 Bacteria 3863
171 Ga0496102_0064550 3300048905 Bacteria 3353
172 Ga0496104_0005476 3300048907 Bacteria 11118
173 Ga0496108_0004110 3300048911 Bacteria 11690
174 Ga0496109_0002990 3300048912 Bacteria 14124
175 Ga0496110_0002419 3300048913 Bacteria 13970
176 Ga0496110_0496469 3300048913 Bacteria 1111
177 Ga0496112_0007435 3300048915 Bacteria 9724
178 Ga0496114_0107984 3300048917 Unclassified 2382
179 Ga0501031_0011550 3300049568 Bacteria 5759
180 Ga0501031_0055357 3300049568 Bacteria 2585
181 Ga0501031_0128387 3300049568 Bacteria 1656
182 Ga0501032_0012653 3300049569 Bacteria 6018
183 Ga0501032_0060524 3300049569 Unclassified 2539
184 Ga0501032_0063101 3300049569 Bacteria 2480
185 Ga0501033_0007640 3300049570 Bacteria 8404
186 Ga0501033_0020914 3300049570 Bacteria 4939
187 Ga0501033_0029592 3300049570 Bacteria 4115
188 Ga0501034_0061433 3300049571 Bacteria 3772
189 Ga0501034_0073218 3300049571 Bacteria 3434
190 Ga0501036_0001163 3300049572 Bacteria 20000
191 Ga0501036_0002877 3300049572 Bacteria 13649
192 Ga0501036_0085842 3300049572 Bacteria 2660
193 Ga0501037_0011434 3300049573 Bacteria 6532
194 Ga0501037_0013034 3300049573 Bacteria 6130
195 Ga0501037_0036302 3300049573 Bacteria 3632
196 Ga0501038_0005030 3300049574 Bacteria 12279
197 Ga0501039_0060805 3300049575 Unclassified 2925
198 Ga0501039_0159851 3300049575 Unclassified 1770
199 Ga0501039_0256381 3300049575 Bacteria 1375
200 Ga0501039_0291403 3300049575 Bacteria 1283
201 Ga0501039_0319681 3300049575 Bacteria 1220
202 Ga0501040_0025584 3300049576 Unclassified 3969
203 Ga0501041_0041447 3300049577 Unclassified 2797
204 Ga0501041_0055396 3300049577 Bacteria 2420
205 Ga0501041_0198080 3300049577 Bacteria 1259
206 Ga0501042_0021125 3300049578 Bacteria 4533
207 Ga0501042_0116496 3300049578 Bacteria 1924
208 Ga0501043_0013078 3300049579 Bacteria 6486
209 Ga0501043_0030783 3300049579 Bacteria 4220
210 Ga0501043_0035284 3300049579 Bacteria 3933
211 Ga0501046_0005664 3300049580 Bacteria 11148
212 Ga0501046_0010043 3300049580 Bacteria 8153
213 Ga0501047_0038354 3300049581 Bacteria 4636
214 Ga0501047_0060420 3300049581 Bacteria 3657
215 Ga0501047_0106874 3300049581 Bacteria 2679
216 Ga0501047_0315805 3300049581 Bacteria 1403
217 Ga0501048_0007476 3300049582 Bacteria 8279
218 Ga0501048_0008345 3300049582 Bacteria 7832
219 Ga0501067_0006028 3300049583 Bacteria 6720
220 Ga0501067_0071058 3300049583 Bacteria 1927
221 Ga0501068_0113720 3300049584 Bacteria 1684
222 Ga0501069_0005010 3300049585 Bacteria 6871
223 Ga0501069_0011132 3300049585 Bacteria 4773
224 Ga0501070_0005750 3300049586 Bacteria 10572
225 Ga0501070_0032398 3300049586 Bacteria 4373
226 Ga0501071_0006535 3300049587 Bacteria 7570
227 Ga0501071_0026555 3300049587 Bacteria 4066
228 Ga0501071_0068814 3300049587 Bacteria 2577
229 Ga0501072_0014922 3300049588 Bacteria 5954
230 Ga0501072_0032947 3300049588 Bacteria 4058
231 Ga0501072_0149827 3300049588 Unclassified 1860
232 Ga0501073_0001491 3300049589 Bacteria 17336
233 Ga0501073_0008017 3300049589 Bacteria 7841
234 Ga0501073_0033354 3300049589 Bacteria 3666
235 Ga0501073_0070228 3300049589 Unclassified 2440
236 Ga0501073_0100085 3300049589 Bacteria 2013
237 Ga0501074_0005240 3300049590 Bacteria 9325
238 Ga0501074_0005660 3300049590 Bacteria 9004
239 Ga0501075_0007929 3300049591 Bacteria 7377
240 Ga0501075_0061590 3300049591 Bacteria 2828
241 Ga0501075_0323652 3300049591 Bacteria 1175
242 Ga0501075_0466991 3300049591 Unclassified 963
243 Ga0501076_0003966 3300049592 Bacteria 10452
244 Ga0501076_0021746 3300049592 Bacteria 4925
245 Ga0501076_0084205 3300049592 Bacteria 2554
246 Ga0501076_0163714 3300049592 Bacteria 1813
247 Ga0501076_0267320 3300049592 Bacteria 1400
248 Ga0501077_0058012 3300049593 Bacteria 2458
249 Ga0501077_0294335 3300049593 Bacteria 1034
250 Ga0501079_0010933 3300049741 Bacteria 6914
251 Ga0501079_0014163 3300049741 Bacteria 6078
252 Ga0501080_0001074 3300049742 Bacteria 22504
253 Ga0501080_0069397 3300049742 Bacteria 3277
254 Ga0501080_0189772 3300049742 Unclassified 1889
255 Ga0501080_0362797 3300049742 Unclassified 1307
256 Ga0501081_0326524 3300049743 Unclassified 1128
257 Ga0501083_0015206 3300049744 Bacteria 5388
258 Ga0501035_0041554 3300049822 Bacteria 4151
259 Ga0501035_0058428 3300049822 Bacteria 3436
260 Ga0501035_0064105 3300049822 Bacteria 3266
261 Ga0501044_0141480 3300049823 Bacteria 2394
262 Ga0501045_0001669 3300049824 Bacteria 14921
263 Ga0501045_0009709 3300049824 Bacteria 6732
264 Ga0501045_0015450 3300049824 Bacteria 5417
265 Ga0501045_0225380 3300049824 Bacteria 1395
266 Ga0501045_0248195 3300049824 Bacteria 1325
267 nmdc:mga0k408_9306_c1 3300050493 Bacteria 5294
268 nmdc:mga05p37_145837_c1 3300050507 Bacteria 2899
269 nmdc:mga05p37_484184_c1 3300050507 Bacteria 1424
270 nmdc:mga05p37_5540_c1 3300050507 Bacteria 14833
271 nmdc:mga09592_52899_c1 3300050508 Bacteria 3427
272 nmdc:mga06r32_397967_c1 3300050510 Bacteria 1359
273 nmdc:mga06r32_48771_c1 3300050510 Bacteria 4049
274 nmdc:mga06r32_62821_c1 3300050510 Bacteria 3578
275 nmdc:mga06r32_77990_c1 3300050510 Bacteria 3219
276 nmdc:mga08y16_102698_c1 3300050511 Unclassified 2977
277 nmdc:mga08y16_165469_c1 3300050511 Unclassified 2298
278 nmdc:mga0n895_182565_c1 3300050512 Bacteria 2130
279 nmdc:mga0n895_289393_c1 3300050512 Unclassified 1661
280 nmdc:mga0n895_31802_c1 3300050512 Bacteria 5057
281 nmdc:mga0n895_338952_c1 3300050512 Unclassified 1523
282 nmdc:mga0n895_47702_c1 3300050512 Bacteria 4189
283 nmdc:mga0rr50_15322_c1 3300050513 Bacteria 5057
284 nmdc:mga0rr50_41070_c1 3300050513 Bacteria 3368
285 nmdc:mga08x19_103101_c1 3300050514 Bacteria 1895
286 nmdc:mga08x19_536686_c1 3300050514 Bacteria 827
287 nmdc:mga0a205_31047_c1 3300050515 Bacteria 5117
288 nmdc:mga0a205_80104_c1 3300050515 Bacteria 3156
289 nmdc:mga0a205_93508_c1 3300050515 Bacteria 2905
290 Ga0501084_0105475 3300054114 Bacteria 2367
291 Ga0501084_0151490 3300054114 Bacteria 1955
292 Ga0501084_0152150 3300054114 Bacteria 1950
293 Ga0590071_000219 3300059421 Bacteria 16863
294 Ga0590075_004592 3300059424 Bacteria 3270
295 Ga0590075_005061 3300059424 Bacteria 3116
296 Ga0590077_001011 3300059426 Bacteria 7088
297 Ga0501082_0003101 3300060353 Bacteria 14482
298 Ga0501082_0018185 3300060353 Bacteria 6051
299 Ga0501082_0067022 3300060353 Bacteria 3091
300 Ga0501082_0551531 3300060353 Unclassified 1008
301 Ga0530510_0004325 3300061734 Bacteria 9830
302 Ga0070699_100004012
303 Ga0065712_10069168
304 Ga0070683_100000203
305 Ga0070690_100062509
306 Ga0070670_100075325
307 Ga0070660_100225466
308 Ga0070661_100117541
309 Ga0070661_100243626
310 Ga0070692_10094394
311 Ga0070668_100014806
312 Ga0070669_100014168
313 Ga0070669_100167372
314 Ga0070675_100040946
315 Ga0070675_100062330
316 Ga0070675_100164302
317 Ga0070671_100016917
318 Ga0070673_100066725
319 Ga0070688_100135916
320 Ga0070659_100025114
321 Ga0070659_100108159
322 Ga0070714_100031193
323 Ga0070700_100045209
324 Ga0070700_100058425
325 Ga0070694_100007762
326 Ga0070663_100016428
327 Ga0070663_100198865
328 Ga0070662_100145337
329 Ga0070681_10217756
330 Ga0070707_100194040
331 Ga0070698_100025487
332 Ga0070699_100010698
333 Ga0070684_100001332
334 Ga0070697_100025783
335 Ga0070672_100047294
336 Ga0070696_100012078
337 Ga0070693_100064658
338 Ga0070665_100007118
339 Ga0070665_100578333
340 Ga0070664_100001490
341 Ga0070664_100050581
342 Ga0068857_100007430
343 Ga0068857_100053832
344 Ga0068864_100242234
345 Ga0068864_100263386
346 Ga0068863_100034501
347 Ga0068858_100152028
348 Ga0068858_100481296
349 Ga0068862_100018210
350 Ga0075364_10043893
351 Ga0075367_10049206
352 Ga0075366_10001835
353 Ga0097621_100021344
354 Ga0097621_100253026
355 Ga0068871_100002760
356 Ga0068871_100029999
357 Ga0068871_100184389
358 Ga0075428_100008514
359 Ga0075428_100014461
360 Ga0075428_100162354
361 Ga0075428_100382930
362 Ga0075430_100009170
363 Ga0075430_100019049
364 Ga0075431_100020798
365 Ga0075431_100046264
366 Ga0075431_100072107
367 Ga0075431_100378902
368 Ga0075433_10020473
369 Ga0075433_10054085
370 Ga0075433_10062824
371 Ga0075434_100001728
372 Ga0075434_100013037
373 Ga0075434_100024126
374 Ga0075434_100031318
375 Ga0075434_100095000
376 Ga0075434_100340689
377 Ga0075429_100529239
378 Ga0075436_100019451
379 Ga0075436_100023521
380 Ga0075436_100049193
381 Ga0075435_100005605
382 Ga0111539_10189308
383 Ga0105247_10098933
384 Ga0114129_10000282
385 Ga0114129_10040776
386 Ga0105242_10039955
387 Ga0105242_10255311
388 Ga0105242_10537257
389 Ga0105248_10051434
390 Ga0105248_10136673
391 Ga0105237_10010554
392 Ga0105249_10000685
393 Ga0105249_10040837
394 Ga0105249_10387848
395 Ga0105246_10151671
396 Ga0157370_10191069
397 Ga0157374_10173665
398 Ga0157378_10035119
399 Ga0157378_10199372
400 Ga0157378_10618722
401 Ga0163162_10046198
402 Ga0157375_10168435
403 Ga0157375_10382213
404 Ga0163163_10000013
405 Ga0163163_10022335
406 Ga0157380_10038180
407 Ga0157377_10077668
408 Ga0157379_10494312
409 Ga0157376_10377678
410 Ga0207645_10016728
411 Ga0207707_10317910
412 Ga0207681_10015414
413 Ga0207681_10021629
414 Ga0207681_10118794
415 Ga0207650_10005892
416 Ga0207659_10147882
417 Ga0207659_10186457
418 Ga0207706_10028346
419 Ga0207704_10021511
420 Ga0207704_10347500
421 Ga0207691_10054563
422 Ga0207711_10045530
423 Ga0207661_10010362
424 Ga0207679_10008902
425 Ga0207679_10551195
426 Ga0207712_10029901
427 Ga0207712_10106324
428 Ga0207668_10203234
429 Ga0207658_10117765
430 Ga0207678_10024138
431 Ga0207708_10048460
432 Ga0207641_10046137
433 Ga0207648_10018689
434 Ga0207674_10010498
435 Ga0207674_10060249
436 Ga0207675_100131871
437 Ga0207675_100232734
438 Ga0207428_10013205
439 Ga0207428_10056933
440 Ga0268266_10062589
441 Ga0268265_10103001
442 Ga0307408_100073600
443 Ga0307408_100211261
444 Ga0307413_10293598
445 Ga0307410_10065246
446 Ga0307410_10147747
447 Ga0307410_10177999
448 Ga0307406_10107131
449 Ga0307406_10303871
450 Ga0307407_10013973
451 Ga0307409_100032117
452 Ga0307416_100008835
453 Ga0307416_100034254
454 Ga0307411_10064732
455 Ga0307415_100073533
456 Ga0307415_100090570
457 Ga0373934_0005175
458 Ga0373956_0011128
459 Ga0373955_0002515
460 Ga0373933_0070234
461 Ga0373937_0000790
462 Ga0439433_0009584
463 Ga0439445_0015349
464 Ga0439449_0106669
465 Ga0450923_017058
466 Ga0439435_0002973
467 Ga0451576_0017663
468 Ga0451576_0194578
469 Ga0495629_0164464
470 Ga0495664_0209299
471 Ga0495621_0004712
472 Ga0496102_0064550
473 Ga0496104_0005476
474 Ga0496108_0004110
475 Ga0496109_0002990
476 Ga0496110_0002419
477 Ga0496110_0496469
478 Ga0496112_0007435
479 Ga0496114_0107984
480 Ga0501031_0011550
481 Ga0501031_0055357
482 Ga0501031_0128387
483 Ga0501032_0012653
484 Ga0501032_0060524
485 Ga0501032_0063101
486 Ga0501033_0007640
487 Ga0501033_0020914
488 Ga0501033_0029592
489 Ga0501034_0061433
490 Ga0501034_0073218
491 Ga0501036_0001163
492 Ga0501036_0002877
493 Ga0501036_0085842
494 Ga0501037_0011434
495 Ga0501037_0013034
496 Ga0501037_0036302
497 Ga0501038_0005030
498 Ga0501039_0060805
499 Ga0501039_0159851
500 Ga0501039_0256381
501 Ga0501039_0291403
502 Ga0501039_0319681
503 Ga0501040_0025584
504 Ga0501041_0041447
505 Ga0501041_0055396
506 Ga0501041_0198080
507 Ga0501042_0021125
508 Ga0501042_0116496
509 Ga0501043_0013078
510 Ga0501043_0030783
511 Ga0501043_0035284
512 Ga0501046_0005664
513 Ga0501046_0010043
514 Ga0501047_0038354
515 Ga0501047_0060420
516 Ga0501047_0106874
517 Ga0501047_0315805
518 Ga0501048_0007476
519 Ga0501048_0008345
520 Ga0501067_0006028
521 Ga0501067_0071058
522 Ga0501068_0113720
523 Ga0501069_0005010
524 Ga0501069_0011132
525 Ga0501070_0005750
526 Ga0501070_0032398
527 Ga0501071_0006535
528 Ga0501071_0026555
529 Ga0501071_0068814
530 Ga0501072_0014922
531 Ga0501072_0032947
532 Ga0501072_0149827
533 Ga0501073_0001491
534 Ga0501073_0008017
535 Ga0501073_0033354
536 Ga0501073_0070228
537 Ga0501073_0100085
538 Ga0501074_0005240
539 Ga0501074_0005660
540 Ga0501075_0007929
541 Ga0501075_0061590
542 Ga0501075_0323652
543 Ga0501075_0466991
544 Ga0501076_0003966
545 Ga0501076_0021746
546 Ga0501076_0084205
547 Ga0501076_0163714
548 Ga0501076_0267320
549 Ga0501077_0058012
550 Ga0501077_0294335
551 Ga0501079_0010933
552 Ga0501079_0014163
553 Ga0501080_0001074
554 Ga0501080_0069397
555 Ga0501080_0189772
556 Ga0501080_0362797
557 Ga0501081_0326524
558 Ga0501083_0015206
559 Ga0501035_0041554
560 Ga0501035_0058428
561 Ga0501035_0064105
562 Ga0501044_0141480
563 Ga0501045_0001669
564 Ga0501045_0009709
565 Ga0501045_0015450
566 Ga0501045_0225380
567 Ga0501045_0248195
568 nmdc:mga0k408_9306_c1
569 nmdc:mga05p37_145837_c1
570 nmdc:mga05p37_484184_c1
571 nmdc:mga05p37_5540_c1
572 nmdc:mga09592_52899_c1
573 nmdc:mga06r32_397967_c1
574 nmdc:mga06r32_48771_c1
575 nmdc:mga06r32_62821_c1
576 nmdc:mga06r32_77990_c1
577 nmdc:mga08y16_102698_c1
578 nmdc:mga08y16_165469_c1
579 nmdc:mga0n895_182565_c1
580 nmdc:mga0n895_289393_c1
581 nmdc:mga0n895_31802_c1
582 nmdc:mga0n895_338952_c1
583 nmdc:mga0n895_47702_c1
584 nmdc:mga0rr50_15322_c1
585 nmdc:mga0rr50_41070_c1
586 nmdc:mga08x19_103101_c1
587 nmdc:mga08x19_536686_c1
588 nmdc:mga0a205_31047_c1
589 nmdc:mga0a205_80104_c1
590 nmdc:mga0a205_93508_c1
591 Ga0501084_0105475
592 Ga0501084_0151490
593 Ga0501084_0152150
594 Ga0590071_000219
595 Ga0590075_004592
596 Ga0590075_005061
597 Ga0590077_001011
598 Ga0501082_0003101
599 Ga0501082_0018185
600 Ga0501082_0067022
601 Ga0501082_0551531
602 Ga0530510_0004325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.8203 127 188
1na3-assembly2.cif.gz_B design of stable alpha-helical arrays from an idealized tpr motif 0.8151 127 188
3kd7-assembly5.cif.gz_E designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.788 127 201
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.7762 127 201
5fzr-assembly1.cif.gz_B designed tpr protein m4n delta c (cf i) 0.7745 123 201
ID Description Score Start End Superfamily
5fzqA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8356 106 201 1.25.40.10
af_Q6ZXV5_518_619_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8224 102 198 1.25.40.10
1na3A00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8203 127 188 1.25.40.10
1na3B00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8151 127 188 1.25.40.10
af_C6KSL8_125_217_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.812 127 190 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7V9BJE9-F1-model_v4 Tetratricopeptide repeat protein 0.8872 10 297
AF-A0A7V9BJE9-F1-model_v4 Tetratricopeptide repeat protein 0.8723 10 297
AF-A0A7Y4WDN5-F1-model_v4 Tetratricopeptide repeat protein 0.8683 6 292
AF-A0A1F2S200-F1-model_v4 Tetratricopeptide repeat protein 0.8564 7 297
AF-A0A6L7P6T4-F1-model_v4 deleted 0.8556 46 294

Map