F395755

General Info

Members Datasets Scaffolds Average Seq Length
301 171 602 78

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10177042|Ga0070710_101770422
Length 92
Sequence VTGCAESVTSRIARVDPWLTRARDALAAETAVAPDQLELSDADAKTLLDLARIAAHASGDRTNAPLLCYLVGRAAGESDLSSLADAVRRSTS

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
65 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
130 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
131 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
134 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 19.27
Rhizosphere 75.75
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10177042 3300005437 Bacteria 1333
2 JGI24747J21853_1004625 3300001978 Bacteria 1243
3 Ga0070683_100570846 3300005329 Bacteria 1082
4 Ga0070682_100104033 3300005337 Bacteria 1880
5 Ga0070682_100130299 3300005337 Bacteria 1701
6 Ga0068868_100357087 3300005338 Bacteria 1253
7 Ga0068868_101538064 3300005338 Bacteria 624
8 Ga0070660_101001687 3300005339 Bacteria 706
9 Ga0070691_10138582 3300005341 Bacteria 1238
10 Ga0070671_100137577 3300005355 Bacteria 2060
11 Ga0070673_101683618 3300005364 Bacteria 600
12 Ga0070673_102215212 3300005364 Unclassified 522
13 Ga0070659_100117703 3300005366 Bacteria 2149
14 Ga0070709_10185064 3300005434 Bacteria 1465
15 Ga0070709_10319770 3300005434 Bacteria 1138
16 Ga0070713_100724661 3300005436 Bacteria 950
17 Ga0070710_10033631 3300005437 Bacteria 2785
18 Ga0070710_10200248 3300005437 Bacteria 1260
19 Ga0070701_11384369 3300005438 Bacteria 505
20 Ga0070711_100199106 3300005439 Bacteria 1544
21 Ga0070711_100285023 3300005439 Bacteria 1308
22 Ga0070711_100317403 3300005439 Bacteria 1244
23 Ga0070705_100777011 3300005440 Bacteria 760
24 Ga0070705_101018757 3300005440 Bacteria 673
25 Ga0070700_100600649 3300005441 Bacteria 862
26 Ga0070663_100013128 3300005455 Bacteria 5266
27 Ga0070678_100017524 3300005456 Bacteria 4615
28 Ga0070662_100081941 3300005457 Bacteria 2405
29 Ga0070681_10060137 3300005458 Bacteria 3777
30 Ga0070681_10569807 3300005458 Bacteria 1046
31 Ga0070707_100007352 3300005468 Bacteria 10231
32 Ga0070679_100151703 3300005530 Unclassified 2294
33 Ga0070679_100340449 3300005530 Bacteria 1448
34 Ga0070684_100027856 3300005535 Bacteria 4773
35 Ga0070684_100955358 3300005535 Bacteria 804
36 Ga0070684_101069864 3300005535 Unclassified 758
37 Ga0070672_101475241 3300005543 Bacteria 609
38 Ga0070686_100298149 3300005544 Bacteria 1195
39 Ga0070695_100424004 3300005545 Unclassified 1014
40 Ga0070695_100481407 3300005545 Bacteria 957
41 Ga0070696_100189661 3300005546 Bacteria 1529
42 Ga0070696_100817542 3300005546 Bacteria 768
43 Ga0070693_100046905 3300005547 Bacteria 2456
44 Ga0070693_101296485 3300005547 Bacteria 563
45 Ga0070704_101355792 3300005549 Unclassified 652
46 Ga0068855_100055136 3300005563 Bacteria 4669
47 Ga0070664_100213497 3300005564 Bacteria 1725
48 Ga0068857_100138687 3300005577 Bacteria 2197
49 Ga0068854_100551140 3300005578 Bacteria 978
50 Ga0068854_100691160 3300005578 Bacteria 880
51 Ga0068856_100170702 3300005614 Bacteria 2187
52 Ga0068856_101582220 3300005614 Bacteria 669
53 Ga0068852_101404041 3300005616 Unclassified 720
54 Ga0068861_100329023 3300005719 Bacteria 1333
55 Ga0068861_101347332 3300005719 Bacteria 695
56 Ga0068870_10360853 3300005840 Bacteria 935
57 Ga0068862_101925412 3300005844 Unclassified 601
58 Ga0081455_10006444 3300005937 Bacteria 12577
59 Ga0081455_10229324 3300005937 Bacteria 1372
60 Ga0081540_1003817 3300005983 Bacteria 11789
61 Ga0075368_10183584 3300006042 Bacteria 882
62 Ga0075432_10037416 3300006058 Bacteria 1689
63 Ga0070715_10017900 3300006163 Bacteria 2690
64 Ga0070715_10023814 3300006163 Bacteria 2403
65 Ga0070716_100164969 3300006173 Bacteria 1439
66 Ga0070712_101394192 3300006175 Bacteria 611
67 Ga0075367_10372454 3300006178 Bacteria 902
68 Ga0097621_100050535 3300006237 Bacteria 3381
69 Ga0097621_100642933 3300006237 Bacteria 973
70 Ga0068871_100008441 3300006358 Bacteria 7410
71 Ga0075428_100261679 3300006844 Bacteria 1862
72 Ga0075430_100182338 3300006846 Bacteria 1746
73 Ga0075431_100784719 3300006847 Bacteria 926
74 Ga0075431_102187502 3300006847 Bacteria 507
75 Ga0075433_10150198 3300006852 Bacteria 2072
76 Ga0075434_100558454 3300006871 Bacteria 1164
77 Ga0068865_101031231 3300006881 Bacteria 722
78 Ga0075436_100008245 3300006914 Bacteria 7128
79 Ga0075436_100852980 3300006914 Bacteria 680
80 Ga0075435_100013955 3300007076 Bacteria 5991
81 Ga0075435_100490790 3300007076 Unclassified 1061
82 Ga0075435_100542322 3300007076 Bacteria 1007
83 Ga0075435_101818647 3300007076 Bacteria 535
84 Ga0111539_11510163 3300009094 Bacteria 779
85 Ga0105245_10071357 3300009098 Bacteria 3154
86 Ga0105245_10413601 3300009098 Unclassified 1350
87 Ga0114129_10061207 3300009147 Bacteria 5261
88 Ga0105243_10049582 3300009148 Bacteria 3313
89 Ga0105241_10005865 3300009174 Bacteria 9071
90 Ga0105241_11077879 3300009174 Unclassified 755
91 Ga0105249_10463858 3300009553 Bacteria 1307
92 Ga0105239_10136934 3300010375 Bacteria 2726
93 Ga0157323_1007031 3300012495 Bacteria 802
94 Ga0157314_1048653 3300012500 Bacteria 535
95 Ga0157371_10885771 3300013102 Bacteria 676
96 Ga0157371_10969748 3300013102 Bacteria 647
97 Ga0157372_10005383 3300013307 Bacteria 13609
98 Ga0157372_13401259 3300013307 Unclassified 506
99 Ga0157375_10121548 3300013308 Bacteria 2721
100 Ga0157375_10497557 3300013308 Bacteria 1383
101 Ga0163163_10201682 3300014325 Bacteria 2038
102 Ga0157377_10265526 3300014745 Bacteria 1119
103 Ga0157379_10955786 3300014968 Bacteria 815
104 Ga0157376_11165880 3300014969 Bacteria 798
105 Ga0207692_10020508 3300025898 Bacteria 3007
106 Ga0207692_10065027 3300025898 Bacteria 1901
107 Ga0207688_10132166 3300025901 Bacteria 1463
108 Ga0207685_10032079 3300025905 Bacteria 1888
109 Ga0207685_10303592 3300025905 Bacteria 791
110 Ga0207699_10042709 3300025906 Bacteria 2629
111 Ga0207654_10105457 3300025911 Bacteria 1744
112 Ga0207654_10136332 3300025911 Bacteria 1560
113 Ga0207707_10375102 3300025912 Bacteria 1223
114 Ga0207707_10577597 3300025912 Bacteria 953
115 Ga0207693_10215025 3300025915 Bacteria 1510
116 Ga0207693_10215026 3300025915 Bacteria 1510
117 Ga0207663_10001302 3300025916 Bacteria 11566
118 Ga0207663_10004527 3300025916 Bacteria 6921
119 Ga0207663_10093369 3300025916 Bacteria 2002
120 Ga0207660_10486962 3300025917 Bacteria 1000
121 Ga0207660_10867828 3300025917 Unclassified 736
122 Ga0207652_11702502 3300025921 Bacteria 535
123 Ga0207646_10009177 3300025922 Bacteria 9807
124 Ga0207687_10031871 3300025927 Bacteria 3566
125 Ga0207664_10026928 3300025929 Bacteria 4352
126 Ga0207664_10055648 3300025929 Bacteria 3140
127 Ga0207644_10057997 3300025931 Bacteria 2797
128 Ga0207690_10085796 3300025932 Bacteria 2211
129 Ga0207706_10040191 3300025933 Bacteria 4145
130 Ga0207686_10184197 3300025934 Bacteria 1483
131 Ga0207709_10072142 3300025935 Bacteria 2195
132 Ga0207704_10149414 3300025938 Bacteria 1646
133 Ga0207665_10002321 3300025939 Bacteria 12842
134 Ga0207689_11109676 3300025942 Bacteria 667
135 Ga0207661_10022009 3300025944 Bacteria 4790
136 Ga0207661_10640117 3300025944 Bacteria 977
137 Ga0207661_11077977 3300025944 Bacteria 740
138 Ga0207667_10090738 3300025949 Bacteria 3157
139 Ga0207651_10932422 3300025960 Bacteria 774
140 Ga0207651_11942703 3300025960 Unclassified 529
141 Ga0207712_10472085 3300025961 Bacteria 1068
142 Ga0207677_11299516 3300026023 Bacteria 668
143 Ga0207677_11774355 3300026023 Bacteria 573
144 Ga0207678_10006120 3300026067 Bacteria 10700
145 Ga0207702_10055682 3300026078 Bacteria 3355
146 Ga0207702_11562057 3300026078 Bacteria 653
147 Ga0207641_10490393 3300026088 Bacteria 1192
148 Ga0207641_11187110 3300026088 Bacteria 763
149 Ga0207674_10051119 3300026116 Bacteria 4218
150 Ga0207675_100081201 3300026118 Bacteria 3040
151 Ga0207675_100123818 3300026118 Bacteria 2448
152 Ga0207683_10001893 3300026121 Bacteria 18520
153 Ga0207698_11308348 3300026142 Unclassified 739
154 Ga0207428_10021699 3300027907 Bacteria 5433
155 Ga0268266_10922453 3300028379 Unclassified 845
156 Ga0307408_101473560 3300031548 Unclassified 643
157 Ga0307416_100035686 3300032002 Bacteria 3802
158 Ga0373930_0035091 3300034816 Bacteria 1048
159 Ga0373959_0019615 3300034820 Unclassified 1283
160 Ga0373959_0136036 3300034820 Archaea 612
161 Ga0373938_0039006 3300034957 Bacteria 1049
162 Ga0373928_0058167 3300035084 Bacteria 929
163 Ga0373928_0115613 3300035084 Bacteria 714
164 Ga0373940_0074546 3300035088 Bacteria 994
165 Ga0373932_0040792 3300035112 Bacteria 1338
166 Ga0373939_0115936 3300035114 Bacteria 939
167 Ga0373960_0086615 3300035121 Bacteria 995
168 Ga0373961_0179619 3300035241 Bacteria 737
169 Ga0373962_0018092 3300035242 Bacteria 1831
170 Ga0373931_0012184 3300035691 Bacteria 4163
171 Ga0395899_0019235 3300037312 Bacteria 5191
172 Ga0395899_0032014 3300037312 Bacteria 3951
173 Ga0395899_0045455 3300037312 Bacteria 3272
174 Ga0395899_0055846 3300037312 Bacteria 2920
175 Ga0395900_0009689 3300037418 Bacteria 9869
176 Ga0395900_0011951 3300037418 Bacteria 8878
177 Ga0395900_0017159 3300037418 Bacteria 7388
178 Ga0395900_0045040 3300037418 Bacteria 4544
179 Ga0395900_0089281 3300037418 Bacteria 3168
180 Ga0395900_1214323 3300037418 Unclassified 669
181 Ga0395900_1419351 3300037418 Unclassified 607
182 Ga0395898_0005316 3300037466 Bacteria 13920
183 Ga0395898_0013235 3300037466 Bacteria 8500
184 Ga0395898_0014934 3300037466 Bacteria 7975
185 Ga0395898_0058521 3300037466 Bacteria 3751
186 Ga0395898_0193343 3300037466 Bacteria 1944
187 Ga0395905_0008408 3300037471 Bacteria 10176
188 Ga0395905_0023955 3300037471 Bacteria 5764
189 Ga0395905_0047449 3300037471 Bacteria 4025
190 Ga0395905_0097818 3300037471 Bacteria 2756
191 Ga0395905_0682079 3300037471 Bacteria 930
192 Ga0395905_0706732 3300037471 Bacteria 910
193 Ga0395901_0008767 3300038443 Bacteria 10231
194 Ga0395901_0023810 3300038443 Bacteria 6279
195 Ga0395901_0031990 3300038443 Bacteria 5427
196 Ga0395901_0062399 3300038443 Bacteria 3878
197 Ga0395901_0156676 3300038443 Bacteria 2392
198 Ga0395901_0199238 3300038443 Unclassified 2099
199 Ga0395901_0203363 3300038443 Bacteria 2075
200 Ga0395901_0276430 3300038443 Bacteria 1746
201 Ga0395901_1464242 3300038443 Bacteria 640
202 Ga0451793_1069637 3300041452 Bacteria 833
203 Ga0451800_1011527 3300041459 Bacteria 2295
204 Ga0451802_1013271 3300041460 Bacteria 979
205 Ga0451835_0759631 3300041492 Bacteria 970
206 Ga0451839_0636968 3300041496 Bacteria 1202
207 Ga0451847_0843937 3300041503 Bacteria 1105
208 Ga0451849_1079064 3300041505 Bacteria 762
209 Ga0451851_1015167 3300041507 Bacteria 847
210 Ga0451855_0381156 3300041511 Bacteria 588
211 Ga0451853_0279906 3300041512 Bacteria 1800
212 Ga0451853_0739805 3300041512 Bacteria 1719
213 Ga0451853_1863625 3300041512 Bacteria 650
214 Ga0451853_2242495 3300041512 Bacteria 1459
215 Ga0451853_3092297 3300041512 Bacteria 2030
216 Ga0451853_3473944 3300041512 Bacteria 568
217 Ga0439448_0003745 3300042005 Bacteria 4238
218 Ga0439455_0141731 3300042012 Bacteria 681
219 Ga0439458_0001389 3300042157 Bacteria 6115
220 Ga0439460_0095877 3300042461 Bacteria 948
221 Ga0466972_0431175 3300044658 Bacteria 619
222 Ga0466968_0470661 3300044735 Bacteria 623
223 Ga0466960_0135812 3300044901 Unclassified 1302
224 Ga0466960_0559081 3300044901 Bacteria 676
225 Ga0495676_0184448 3300047321 Bacteria 1460
226 Ga0495677_0216441 3300047445 Bacteria 746
227 Ga0496100_0067431 3300048903 Bacteria 2376
228 Ga0496100_0110194 3300048903 Bacteria 1911
229 Ga0496100_0719679 3300048903 Bacteria 780
230 Ga0496101_0043221 3300048904 Bacteria 3220
231 Ga0496101_0433464 3300048904 Bacteria 1036
232 Ga0496101_0495993 3300048904 Bacteria 964
233 Ga0496101_1193424 3300048904 Bacteria 596
234 Ga0496102_0252550 3300048905 Bacteria 1663
235 Ga0496102_0488531 3300048905 Bacteria 1153
236 Ga0496102_0704635 3300048905 Bacteria 932
237 Ga0496103_0096578 3300048906 Bacteria 1867
238 Ga0496103_0233485 3300048906 Bacteria 1183
239 Ga0496103_0982555 3300048906 Unclassified 526
240 Ga0496104_0027546 3300048907 Bacteria 5260
241 Ga0496104_0173844 3300048907 Bacteria 2064
242 Ga0496104_1302253 3300048907 Bacteria 630
243 Ga0496105_0033094 3300048908 Bacteria 4244
244 Ga0496105_0795153 3300048908 Unclassified 719
245 Ga0496106_0071960 3300048909 Bacteria 2643
246 Ga0496106_0133443 3300048909 Bacteria 1948
247 Ga0496106_1129561 3300048909 Bacteria 613
248 Ga0496107_0033935 3300048910 Bacteria 3653
249 Ga0496107_0111518 3300048910 Bacteria 2010
250 Ga0496108_0023646 3300048911 Bacteria 5057
251 Ga0496108_0094436 3300048911 Bacteria 2546
252 Ga0496108_0172856 3300048911 Bacteria 1870
253 Ga0496108_0422118 3300048911 Bacteria 1165
254 Ga0496108_1676197 3300048911 Bacteria 524
255 Ga0496109_0026674 3300048912 Bacteria 5154
256 Ga0496109_0221002 3300048912 Bacteria 1781
257 Ga0496109_0494645 3300048912 Bacteria 1154
258 Ga0496109_1041043 3300048912 Bacteria 756
259 Ga0496110_0018486 3300048913 Bacteria 5844
260 Ga0496110_0210497 3300048913 Bacteria 1767
261 Ga0496110_0332830 3300048913 Bacteria 1383
262 Ga0496111_0010572 3300048914 Bacteria 6200
263 Ga0496111_0076179 3300048914 Bacteria 2445
264 Ga0496111_0107235 3300048914 Bacteria 2056
265 Ga0496112_0007845 3300048915 Bacteria 9503
266 Ga0496112_0012843 3300048915 Bacteria 7709
267 Ga0496112_0220583 3300048915 Bacteria 1852
268 Ga0496112_0570930 3300048915 Bacteria 1064
269 Ga0496112_1161249 3300048915 Bacteria 689
270 Ga0496113_0013139 3300048916 Bacteria 5592
271 Ga0496113_0059819 3300048916 Bacteria 2871
272 Ga0496113_0243275 3300048916 Bacteria 1436
273 Ga0496113_0261773 3300048916 Bacteria 1382
274 Ga0496113_0522949 3300048916 Bacteria 952
275 Ga0496113_0774845 3300048916 Unclassified 763
276 Ga0496114_0144641 3300048917 Bacteria 2060
277 Ga0496114_0465343 3300048917 Bacteria 1119
278 Ga0496114_0514746 3300048917 Bacteria 1058
279 Ga0496114_0728498 3300048917 Bacteria 868
280 Ga0496115_0102147 3300048918 Bacteria 2351
281 Ga0496115_0124891 3300048918 Bacteria 2119
282 Ga0501067_0009077 3300049583 Bacteria 5506
283 Ga0501067_0463526 3300049583 Bacteria 708
284 nmdc:mga06z11_204341_c1 3300050494 Bacteria 1148
285 nmdc:mga05p37_1365468_c1 3300050507 Bacteria 717
286 nmdc:mga05p37_1793298_c1 3300050507 Bacteria 592
287 nmdc:mga09592_61458_c1 3300050508 Bacteria 3177
288 nmdc:mga0qj67_293542_c1 3300050509 Bacteria 1317
289 nmdc:mga06r32_269205_c1 3300050510 Bacteria 1691
290 nmdc:mga08y16_1909479_c1 3300050511 Bacteria 545
291 nmdc:mga08y16_213418_c1 3300050511 Bacteria 1999
292 nmdc:mga08y16_314184_c1 3300050511 Bacteria 1613
293 nmdc:mga0n895_634128_c1 3300050512 Unclassified 1069
294 nmdc:mga0rr50_1797015_c1 3300050513 Bacteria 516
295 nmdc:mga0rr50_224230_c1 3300050513 Bacteria 1553
296 nmdc:mga0rr50_323866_c1 3300050513 Bacteria 1292
297 nmdc:mga0rr50_490741_c1 3300050513 Unclassified 1044
298 nmdc:mga08x19_153479_c1 3300050514 Bacteria 1561
299 nmdc:mga08x19_766786_c1 3300050514 Bacteria 685
300 nmdc:mga0a205_419360_c1 3300050515 Unclassified 1201
301 nmdc:mga0a205_498669_c1 3300050515 Bacteria 1075
302 Ga0070710_10177042
303 JGI24747J21853_1004625
304 Ga0070683_100570846
305 Ga0070682_100104033
306 Ga0070682_100130299
307 Ga0068868_100357087
308 Ga0068868_101538064
309 Ga0070660_101001687
310 Ga0070691_10138582
311 Ga0070671_100137577
312 Ga0070673_101683618
313 Ga0070673_102215212
314 Ga0070659_100117703
315 Ga0070709_10185064
316 Ga0070709_10319770
317 Ga0070713_100724661
318 Ga0070710_10033631
319 Ga0070710_10200248
320 Ga0070701_11384369
321 Ga0070711_100199106
322 Ga0070711_100285023
323 Ga0070711_100317403
324 Ga0070705_100777011
325 Ga0070705_101018757
326 Ga0070700_100600649
327 Ga0070663_100013128
328 Ga0070678_100017524
329 Ga0070662_100081941
330 Ga0070681_10060137
331 Ga0070681_10569807
332 Ga0070707_100007352
333 Ga0070679_100151703
334 Ga0070679_100340449
335 Ga0070684_100027856
336 Ga0070684_100955358
337 Ga0070684_101069864
338 Ga0070672_101475241
339 Ga0070686_100298149
340 Ga0070695_100424004
341 Ga0070695_100481407
342 Ga0070696_100189661
343 Ga0070696_100817542
344 Ga0070693_100046905
345 Ga0070693_101296485
346 Ga0070704_101355792
347 Ga0068855_100055136
348 Ga0070664_100213497
349 Ga0068857_100138687
350 Ga0068854_100551140
351 Ga0068854_100691160
352 Ga0068856_100170702
353 Ga0068856_101582220
354 Ga0068852_101404041
355 Ga0068861_100329023
356 Ga0068861_101347332
357 Ga0068870_10360853
358 Ga0068862_101925412
359 Ga0081455_10006444
360 Ga0081455_10229324
361 Ga0081540_1003817
362 Ga0075368_10183584
363 Ga0075432_10037416
364 Ga0070715_10017900
365 Ga0070715_10023814
366 Ga0070716_100164969
367 Ga0070712_101394192
368 Ga0075367_10372454
369 Ga0097621_100050535
370 Ga0097621_100642933
371 Ga0068871_100008441
372 Ga0075428_100261679
373 Ga0075430_100182338
374 Ga0075431_100784719
375 Ga0075431_102187502
376 Ga0075433_10150198
377 Ga0075434_100558454
378 Ga0068865_101031231
379 Ga0075436_100008245
380 Ga0075436_100852980
381 Ga0075435_100013955
382 Ga0075435_100490790
383 Ga0075435_100542322
384 Ga0075435_101818647
385 Ga0111539_11510163
386 Ga0105245_10071357
387 Ga0105245_10413601
388 Ga0114129_10061207
389 Ga0105243_10049582
390 Ga0105241_10005865
391 Ga0105241_11077879
392 Ga0105249_10463858
393 Ga0105239_10136934
394 Ga0157323_1007031
395 Ga0157314_1048653
396 Ga0157371_10885771
397 Ga0157371_10969748
398 Ga0157372_10005383
399 Ga0157372_13401259
400 Ga0157375_10121548
401 Ga0157375_10497557
402 Ga0163163_10201682
403 Ga0157377_10265526
404 Ga0157379_10955786
405 Ga0157376_11165880
406 Ga0207692_10020508
407 Ga0207692_10065027
408 Ga0207688_10132166
409 Ga0207685_10032079
410 Ga0207685_10303592
411 Ga0207699_10042709
412 Ga0207654_10105457
413 Ga0207654_10136332
414 Ga0207707_10375102
415 Ga0207707_10577597
416 Ga0207693_10215025
417 Ga0207693_10215026
418 Ga0207663_10001302
419 Ga0207663_10004527
420 Ga0207663_10093369
421 Ga0207660_10486962
422 Ga0207660_10867828
423 Ga0207652_11702502
424 Ga0207646_10009177
425 Ga0207687_10031871
426 Ga0207664_10026928
427 Ga0207664_10055648
428 Ga0207644_10057997
429 Ga0207690_10085796
430 Ga0207706_10040191
431 Ga0207686_10184197
432 Ga0207709_10072142
433 Ga0207704_10149414
434 Ga0207665_10002321
435 Ga0207689_11109676
436 Ga0207661_10022009
437 Ga0207661_10640117
438 Ga0207661_11077977
439 Ga0207667_10090738
440 Ga0207651_10932422
441 Ga0207651_11942703
442 Ga0207712_10472085
443 Ga0207677_11299516
444 Ga0207677_11774355
445 Ga0207678_10006120
446 Ga0207702_10055682
447 Ga0207702_11562057
448 Ga0207641_10490393
449 Ga0207641_11187110
450 Ga0207674_10051119
451 Ga0207675_100081201
452 Ga0207675_100123818
453 Ga0207683_10001893
454 Ga0207698_11308348
455 Ga0207428_10021699
456 Ga0268266_10922453
457 Ga0307408_101473560
458 Ga0307416_100035686
459 Ga0373930_0035091
460 Ga0373959_0019615
461 Ga0373959_0136036
462 Ga0373938_0039006
463 Ga0373928_0058167
464 Ga0373928_0115613
465 Ga0373940_0074546
466 Ga0373932_0040792
467 Ga0373939_0115936
468 Ga0373960_0086615
469 Ga0373961_0179619
470 Ga0373962_0018092
471 Ga0373931_0012184
472 Ga0395899_0019235
473 Ga0395899_0032014
474 Ga0395899_0045455
475 Ga0395899_0055846
476 Ga0395900_0009689
477 Ga0395900_0011951
478 Ga0395900_0017159
479 Ga0395900_0045040
480 Ga0395900_0089281
481 Ga0395900_1214323
482 Ga0395900_1419351
483 Ga0395898_0005316
484 Ga0395898_0013235
485 Ga0395898_0014934
486 Ga0395898_0058521
487 Ga0395898_0193343
488 Ga0395905_0008408
489 Ga0395905_0023955
490 Ga0395905_0047449
491 Ga0395905_0097818
492 Ga0395905_0682079
493 Ga0395905_0706732
494 Ga0395901_0008767
495 Ga0395901_0023810
496 Ga0395901_0031990
497 Ga0395901_0062399
498 Ga0395901_0156676
499 Ga0395901_0199238
500 Ga0395901_0203363
501 Ga0395901_0276430
502 Ga0395901_1464242
503 Ga0451793_1069637
504 Ga0451800_1011527
505 Ga0451802_1013271
506 Ga0451835_0759631
507 Ga0451839_0636968
508 Ga0451847_0843937
509 Ga0451849_1079064
510 Ga0451851_1015167
511 Ga0451855_0381156
512 Ga0451853_0279906
513 Ga0451853_0739805
514 Ga0451853_1863625
515 Ga0451853_2242495
516 Ga0451853_3092297
517 Ga0451853_3473944
518 Ga0439448_0003745
519 Ga0439455_0141731
520 Ga0439458_0001389
521 Ga0439460_0095877
522 Ga0466972_0431175
523 Ga0466968_0470661
524 Ga0466960_0135812
525 Ga0466960_0559081
526 Ga0495676_0184448
527 Ga0495677_0216441
528 Ga0496100_0067431
529 Ga0496100_0110194
530 Ga0496100_0719679
531 Ga0496101_0043221
532 Ga0496101_0433464
533 Ga0496101_0495993
534 Ga0496101_1193424
535 Ga0496102_0252550
536 Ga0496102_0488531
537 Ga0496102_0704635
538 Ga0496103_0096578
539 Ga0496103_0233485
540 Ga0496103_0982555
541 Ga0496104_0027546
542 Ga0496104_0173844
543 Ga0496104_1302253
544 Ga0496105_0033094
545 Ga0496105_0795153
546 Ga0496106_0071960
547 Ga0496106_0133443
548 Ga0496106_1129561
549 Ga0496107_0033935
550 Ga0496107_0111518
551 Ga0496108_0023646
552 Ga0496108_0094436
553 Ga0496108_0172856
554 Ga0496108_0422118
555 Ga0496108_1676197
556 Ga0496109_0026674
557 Ga0496109_0221002
558 Ga0496109_0494645
559 Ga0496109_1041043
560 Ga0496110_0018486
561 Ga0496110_0210497
562 Ga0496110_0332830
563 Ga0496111_0010572
564 Ga0496111_0076179
565 Ga0496111_0107235
566 Ga0496112_0007845
567 Ga0496112_0012843
568 Ga0496112_0220583
569 Ga0496112_0570930
570 Ga0496112_1161249
571 Ga0496113_0013139
572 Ga0496113_0059819
573 Ga0496113_0243275
574 Ga0496113_0261773
575 Ga0496113_0522949
576 Ga0496113_0774845
577 Ga0496114_0144641
578 Ga0496114_0465343
579 Ga0496114_0514746
580 Ga0496114_0728498
581 Ga0496115_0102147
582 Ga0496115_0124891
583 Ga0501067_0009077
584 Ga0501067_0463526
585 nmdc:mga06z11_204341_c1
586 nmdc:mga05p37_1365468_c1
587 nmdc:mga05p37_1793298_c1
588 nmdc:mga09592_61458_c1
589 nmdc:mga0qj67_293542_c1
590 nmdc:mga06r32_269205_c1
591 nmdc:mga08y16_1909479_c1
592 nmdc:mga08y16_213418_c1
593 nmdc:mga08y16_314184_c1
594 nmdc:mga0n895_634128_c1
595 nmdc:mga0rr50_1797015_c1
596 nmdc:mga0rr50_224230_c1
597 nmdc:mga0rr50_323866_c1
598 nmdc:mga0rr50_490741_c1
599 nmdc:mga08x19_153479_c1
600 nmdc:mga08x19_766786_c1
601 nmdc:mga0a205_419360_c1
602 nmdc:mga0a205_498669_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20058

DUF6457

Domain of unknown function (DUF6457)

10

92

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gyn-assembly1.cif.gz_A zebrafish tipe1 strucutre in complex with pe 0.7312 24 64
7rd1-assembly1.cif.gz_R the capsid structure of the chadox1 viral vector/chimpanzee adenovirus y25 0.574 24 74
2gfh-assembly1.cif.gz_A crystal structure of a n-acetylneuraminic acid phosphatase (nanp) from mus musculus at 1.90 a resolution 0.5306 32 74
4w2q-assembly2.cif.gz_D anti-marburgvirus nucleoprotein single domain antibody c complexed with nucleoprotein c-terminal domain 0.5075 35 78
2ev4-assembly1.cif.gz_B structure of rv1264n, the regulatory domain of the mycobacterial adenylyl cylcase rv1264, with a salt precipitant 0.4551 9 75
ID Description Score Start End Superfamily
3t0yA01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.6757 30 74 1.10.1740.10
af_P9WGG7_72_176_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.6324 33 77 1.10.1740.10
3lcnA00 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Nuclear abundant poly(A) RNA-bind protein 2, N-terminal domain 0.6269 33 75 1.10.340.40
af_L0TCG5_5_78_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.6155 31 76 1.10.1740.10
af_Q1ECV8_1_186_1.20.1440.160 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Tumor necrosis factor alpha-induced protein 8-like 0.5558 1 55 1.20.1440.160
ID Description Score Start End GO Terms
AF-A0A7W0PAE9-F1-model_v4 DUF6457 domain-containing protein 0.9761 1 76
AF-A0A542ZAB0-F1-model_v4 DUF6457 domain-containing protein 0.9624 25 76
AF-A0A7W0PAE9-F1-model_v4 DUF6457 domain-containing protein 0.9399 1 76
AF-A0A0N0TS06-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein 0.9307 25 76
AF-A0A6J7CMS5-F1-model_v4 Unannotated protein 0.9044 2 77

Map