F395629

General Info

Members Datasets Scaffolds Average Seq Length
300 224 600 294

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2599185239|2599740986
Length 319
Sequence GMCNKYDNSKLTYKKNRIMTLPNLDMDALRTLIAADRLGSLNRAADRIGRSQSAVSQQMRKLETQIGQPLFRRQGRGLVPTEAGELMLSYARRILELNDEAVGAIRGAAIDGAVRFGLPGDFAEAWLPVALGRFKRTHPGVRVDIVVDGNGALLDRLDGGELDIVLAMGRGHRADAEHLVTLPMAWIGPQGIDVRPRAGAPLDLALYKPPCLFRKAGTDALDKAGIPWRLAYTTGSLQSLWAGVAGGLGITSRTMAGVPPALRQLGERDGLPPLPSVDVCLHAGGGDAPSALVSLKRVVIDTLIANLADVHPHSGRRAG

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
201 2519103095 Burkholderia sp. KJ006 Isolate Nodule
202 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
203 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
204 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
205 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
206 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
207 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
208 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
209 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
210 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
211 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
212 2818991452 Burkholderia cepacia 561 Isolate Unclassified
213 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
214 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
215 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
216 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
217 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
218 2928170801 Burkholderia sp. 572 Isolate Unclassified
219 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
220 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
221 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
222 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
223 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
224 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 1.33
Rhizoplane 7
Rhizosphere 75.67
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10006996 3300003187 Bacteria 5583
2 JGI25165J46597_1004620 3300003214 Unclassified 2890
3 rootH1_10184050 3300003323 Bacteria 3778
4 Ga0055532_1000298 3300003758 Bacteria 30615
5 Ga0055526_1000583 3300003771 Bacteria 28676
6 Ga0055537_1000062 3300003773 Bacteria 77862
7 Ga0055534_1000019 3300003784 Bacteria 137920
8 Ga0055528_1000048 3300003790 Bacteria 95179
9 Ga0070658_10019362 3300005327 Bacteria 5451
10 Ga0070690_100024403 3300005330 Bacteria 3717
11 Ga0070670_100092611 3300005331 Bacteria 2599
12 Ga0068869_100359909 3300005334 Bacteria 1188
13 Ga0070680_100317602 3300005336 Bacteria 1322
14 Ga0070660_100016875 3300005339 Bacteria 5311
15 Ga0070660_100067206 3300005339 Bacteria 2792
16 Ga0070660_100072667 3300005339 Unclassified 2688
17 Ga0070661_100078026 3300005344 Bacteria 2443
18 Ga0070692_10005548 3300005345 Bacteria 5395
19 Ga0070669_100260707 3300005353 Unclassified 1383
20 Ga0070669_100366250 3300005353 Bacteria 1173
21 Ga0070671_100018619 3300005355 Bacteria 5641
22 Ga0070671_100234340 3300005355 Bacteria 1558
23 Ga0070673_100017787 3300005364 Bacteria 5064
24 Ga0070673_100102009 3300005364 Unclassified 2365
25 Ga0070688_100350208 3300005365 Unclassified 1081
26 Ga0070659_100004385 3300005366 Bacteria 10078
27 Ga0070659_100018632 3300005366 Bacteria 5240
28 Ga0070667_100106223 3300005367 Bacteria 2430
29 Ga0070709_10231827 3300005434 Bacteria 1321
30 Ga0070714_100000107 3300005435 Bacteria 69754
31 Ga0070714_100025862 3300005435 Bacteria 4848
32 Ga0070714_100083648 3300005435 Bacteria 2783
33 Ga0070714_100371270 3300005435 Unclassified 1347
34 Ga0070713_100007697 3300005436 Bacteria 7582
35 Ga0070713_100016116 3300005436 Bacteria 5613
36 Ga0070710_10012487 3300005437 Bacteria 4219
37 Ga0070711_100011175 3300005439 Bacteria 5568
38 Ga0070663_100126453 3300005455 Bacteria 1937
39 Ga0070678_100075080 3300005456 Unclassified 2542
40 Ga0070678_100195882 3300005456 Bacteria 1664
41 Ga0070681_10109752 3300005458 Bacteria 2699
42 Ga0068867_100005129 3300005459 Bacteria 9256
43 Ga0068867_100032128 3300005459 Bacteria 3794
44 Ga0070706_100233336 3300005467 Bacteria 1718
45 Ga0070679_100110912 3300005530 Bacteria 2730
46 Ga0068853_100027854 3300005539 Bacteria 4750
47 Ga0068853_100316858 3300005539 Bacteria 1445
48 Ga0070672_100010731 3300005543 Bacteria 6365
49 Ga0070672_100042725 3300005543 Bacteria 3491
50 Ga0070696_100003055 3300005546 Bacteria 11123
51 Ga0070665_100287921 3300005548 Bacteria 1645
52 Ga0070665_100289209 3300005548 Bacteria 1641
53 Ga0070704_100219614 3300005549 Bacteria 1544
54 Ga0068855_100157034 3300005563 Bacteria 2584
55 Ga0068857_100035246 3300005577 Bacteria 4431
56 Ga0068864_100029731 3300005618 Bacteria 4630
57 Ga0068858_100482636 3300005842 Unclassified 1196
58 Ga0068858_100500106 3300005842 Bacteria 1174
59 Ga0068860_100050250 3300005843 Bacteria 3970
60 Ga0081455_10013731 3300005937 Bacteria 7972
61 Ga0070717_10010576 3300006028 Bacteria 6970
62 Ga0070717_10226739 3300006028 Bacteria 1644
63 Ga0075364_10137381 3300006051 Bacteria 1643
64 Ga0070715_10014267 3300006163 Bacteria 2939
65 Ga0070715_10041671 3300006163 Bacteria 1925
66 Ga0070716_100007354 3300006173 Bacteria 5415
67 Ga0075369_10048785 3300006186 Bacteria 1828
68 Ga0097621_100026846 3300006237 Bacteria 4522
69 Ga0097621_100142724 3300006237 Bacteria 2047
70 Ga0068871_100071927 3300006358 Bacteria 2846
71 Ga0068871_100214686 3300006358 Bacteria 1665
72 Ga0068871_100326429 3300006358 Unclassified 1353
73 Ga0068871_100339138 3300006358 Bacteria 1327
74 Ga0068871_100412946 3300006358 Bacteria 1204
75 Ga0068865_100002074 3300006881 Bacteria 11837
76 Ga0068865_100013819 3300006881 Bacteria 5118
77 Ga0068865_100031027 3300006881 Bacteria 3560
78 Ga0099794_10000123 3300007265 Bacteria 28238
79 Ga0111539_10090329 3300009094 Bacteria 3599
80 Ga0105245_10011188 3300009098 Bacteria 7810
81 Ga0105241_10057137 3300009174 Bacteria 2993
82 Ga0105242_10004879 3300009176 Bacteria 10383
83 Ga0105242_10034751 3300009176 Bacteria 4041
84 Ga0105242_10060642 3300009176 Bacteria 3109
85 Ga0105248_10011135 3300009177 Bacteria 9924
86 Ga0105248_10153795 3300009177 Bacteria 2595
87 Ga0105248_10490084 3300009177 Bacteria 1386
88 Ga0105237_10093301 3300009545 Bacteria 2999
89 Ga0105237_10329884 3300009545 Bacteria 1530
90 Ga0105249_10171258 3300009553 Bacteria 2106
91 Ga0105239_10236374 3300010375 Bacteria 2051
92 Ga0157373_10023327 3300013100 Bacteria 4487
93 Ga0157373_10071542 3300013100 Bacteria 2449
94 Ga0157373_10166353 3300013100 Bacteria 1552
95 Ga0157370_10031080 3300013104 Bacteria 5227
96 Ga0157378_10012596 3300013297 Bacteria 7402
97 Ga0163162_10054837 3300013306 Bacteria 4010
98 Ga0163162_10122791 3300013306 Bacteria 2702
99 Ga0163162_10160026 3300013306 Bacteria 2373
100 Ga0163162_10457474 3300013306 Bacteria 1408
101 Ga0163162_10708382 3300013306 Bacteria 1128
102 Ga0157372_10015781 3300013307 Bacteria 8103
103 Ga0157372_10095451 3300013307 Bacteria 3388
104 Ga0157375_10010778 3300013308 Bacteria 8053
105 Ga0157375_10022669 3300013308 Bacteria 5782
106 Ga0157375_10032126 3300013308 Bacteria 4975
107 Ga0157375_10463848 3300013308 Bacteria 1432
108 Ga0163163_10164754 3300014325 Bacteria 2262
109 Ga0157379_10203003 3300014968 Bacteria 1793
110 Ga0157379_10488602 3300014968 Bacteria 1140
111 Ga0157376_10002957 3300014969 Bacteria 11661
112 Ga0157376_10371858 3300014969 Unclassified 1374
113 Ga0182006_1015948 3300015261 Bacteria 3211
114 Ga0163161_10085628 3300017792 Bacteria 2325
115 Ga0213872_10011958 3300021361 Bacteria 4096
116 Ga0213876_10002079 3300021384 Bacteria 11851
117 Ga0209566_100136 3300025225 Bacteria 90096
118 Ga0209674_102153 3300025226 Bacteria 4436
119 Ga0209147_100064 3300025229 Bacteria 234181
120 Ga0209233_1000627 3300025261 Bacteria 17690
121 Ga0209565_1000017 3300025263 Bacteria 462438
122 Ga0209673_1000007 3300025273 Bacteria 634477
123 Ga0209675_1000009 3300025291 Bacteria 562872
124 Ga0209025_1000881 3300025294 Bacteria 46981
125 Ga0209564_1000036 3300025295 Bacteria 423455
126 Ga0209758_1014503 3300025297 Bacteria 4182
127 Ga0209256_1000091 3300025299 Bacteria 210945
128 Ga0207692_10000264 3300025898 Bacteria 17986
129 Ga0207692_10151484 3300025898 Bacteria 1328
130 Ga0207647_10010778 3300025904 Bacteria 6435
131 Ga0207685_10117134 3300025905 Bacteria 1164
132 Ga0207699_10139188 3300025906 Unclassified 1593
133 Ga0207699_10317088 3300025906 Bacteria 1092
134 Ga0207705_10003922 3300025909 Bacteria 11310
135 Ga0207707_10137834 3300025912 Bacteria 2133
136 Ga0207695_10328079 3300025913 Bacteria 1419
137 Ga0207671_10096083 3300025914 Bacteria 2238
138 Ga0207693_10001910 3300025915 Bacteria 18229
139 Ga0207660_10335919 3300025917 Bacteria 1209
140 Ga0207657_10030007 3300025919 Bacteria 4940
141 Ga0207657_10083608 3300025919 Bacteria 2678
142 Ga0207657_10251035 3300025919 Bacteria 1410
143 Ga0207649_10038853 3300025920 Bacteria 2884
144 Ga0207652_10427415 3300025921 Bacteria 1194
145 Ga0207681_10326050 3300025923 Bacteria 1223
146 Ga0207650_10149499 3300025925 Bacteria 1842
147 Ga0207650_10287685 3300025925 Bacteria 1339
148 Ga0207700_10008721 3300025928 Bacteria 6296
149 Ga0207700_10103588 3300025928 Bacteria 2275
150 Ga0207664_10000036 3300025929 Bacteria 173396
151 Ga0207664_10030157 3300025929 Bacteria 4140
152 Ga0207664_10049288 3300025929 Bacteria 3315
153 Ga0207690_10150633 3300025932 Bacteria 1724
154 Ga0207686_10077904 3300025934 Bacteria 2154
155 Ga0207686_10112309 3300025934 Bacteria 1840
156 Ga0207704_10031116 3300025938 Bacteria 3001
157 Ga0207704_10037217 3300025938 Bacteria 2809
158 Ga0207665_10001660 3300025939 Bacteria 14973
159 Ga0207691_10032053 3300025940 Bacteria 4902
160 Ga0207691_10079385 3300025940 Bacteria 2953
161 Ga0207711_10090625 3300025941 Bacteria 2688
162 Ga0207651_10077653 3300025960 Bacteria 2378
163 Ga0207651_10312168 3300025960 Bacteria 1311
164 Ga0207712_10070742 3300025961 Bacteria 2507
165 Ga0207658_10165242 3300025986 Bacteria 1817
166 Ga0207703_10407423 3300026035 Unclassified 1263
167 Ga0207639_10104725 3300026041 Bacteria 2294
168 Ga0207702_10327437 3300026078 Bacteria 1460
169 Ga0207641_10275592 3300026088 Bacteria 1580
170 Ga0207648_10006569 3300026089 Bacteria 11549
171 Ga0207676_10022769 3300026095 Bacteria 4612
172 Ga0207676_10225566 3300026095 Bacteria 1672
173 Ga0207674_10047031 3300026116 Bacteria 4426
174 Ga0207683_10040234 3300026121 Unclassified 4078
175 Ga0209588_1000790 3300027671 Bacteria 8039
176 Ga0268266_10293786 3300028379 Bacteria 1514
177 Ga0268264_10646968 3300028381 Bacteria 1046
178 Ga0265339_10030582 3300031249 Bacteria 3048
179 Ga0265339_10046158 3300031249 Bacteria 2396
180 Ga0265331_10035278 3300031250 Bacteria 2462
181 Ga0265314_10026244 3300031711 Bacteria 4379
182 Ga0265342_10051462 3300031712 Bacteria 2457
183 Ga0307410_10269478 3300031852 Bacteria 1331
184 Ga0307409_100013670 3300031995 Bacteria 5239
185 Ga0373930_0003756 3300034816 Bacteria 2435
186 Ga0373944_0058291 3300035089 Unclassified 1233
187 Ga0373932_0033395 3300035112 Bacteria 1445
188 Ga0373941_0102376 3300035115 Bacteria 999
189 Ga0373946_0064773 3300035171 Bacteria 1564
190 Ga0373931_0091567 3300035691 Bacteria 1695
191 Ga0373927_0006928 3300035695 Bacteria 7697
192 Ga0373927_0044276 3300035695 Bacteria 2880
193 Ga0373927_0092122 3300035695 Bacteria 1969
194 Ga0395898_0002604 3300037466 Bacteria 21051
195 Ga0436364_0166674 3300037853 Unclassified 1588
196 Ga0395901_0002665 3300038443 Bacteria 18009
197 Ga0436361_0264102 3300039447 Bacteria 3737
198 Ga0436361_0363178 3300039447 Bacteria 2344
199 Ga0436361_0452773 3300039447 Bacteria 7456
200 Ga0436361_0721709 3300039447 Bacteria 3239
201 Ga0436361_0725532 3300039447 Bacteria 4377
202 Ga0436362_0489429 3300039453 Unclassified 2868
203 Ga0495638_0074136 3300046460 Bacteria 2076
204 Ga0495651_0297659 3300046462 Bacteria 1083
205 Ga0495580_0070644 3300046472 Bacteria 2439
206 Ga0495580_0103051 3300046472 Bacteria 1984
207 Ga0495605_0090664 3300046474 Unclassified 1417
208 Ga0495607_0011509 3300046501 Bacteria 5886
209 Ga0495616_0009608 3300046513 Bacteria 5644
210 Ga0495632_0150665 3300046519 Unclassified 1075
211 Ga0495643_0114929 3300046522 Unclassified 1365
212 Ga0495609_0000277 3300046538 Bacteria 47502
213 Ga0495668_0012710 3300046616 Bacteria 4986
214 Ga0495625_0001058 3300046660 Bacteria 35974
215 Ga0495659_0006787 3300046664 Bacteria 3617
216 Ga0495661_0091624 3300046665 Unclassified 1728
217 Ga0495658_0060548 3300046683 Bacteria 2172
218 Ga0495658_0176396 3300046683 Unclassified 1324
219 Ga0495669_0018218 3300046684 Bacteria 3017
220 Ga0495613_0100700 3300046689 Bacteria 2087
221 Ga0495670_0018394 3300046691 Bacteria 3440
222 Ga0495649_0010128 3300046694 Bacteria 5570
223 Ga0495660_0029028 3300046810 Bacteria 3123
224 Ga0495581_0018938 3300047315 Bacteria 3996
225 Ga0495677_0010278 3300047445 Bacteria 3439
226 Ga0495679_002996 3300047446 Bacteria 8315
227 Ga0495685_030410 3300047447 Unclassified 1856
228 Ga0495681_0032742 3300047470 Bacteria 2613
229 Ga0495602_0102096 3300048088 Bacteria 2351
230 Ga0496101_0010084 3300048904 Bacteria 6227
231 Ga0496102_0034409 3300048905 Bacteria 4556
232 Ga0496103_0051063 3300048906 Bacteria 2559
233 Ga0496104_0000057 3300048907 Bacteria 119211
234 Ga0496104_0026984 3300048907 Bacteria 5309
235 Ga0496104_0191751 3300048907 Bacteria 1955
236 Ga0496105_0000037 3300048908 Bacteria 119355
237 Ga0496105_0116020 3300048908 Bacteria 2209
238 Ga0496106_0207554 3300048909 Bacteria 1560
239 Ga0496107_0213523 3300048910 Bacteria 1435
240 Ga0496108_0165636 3300048911 Bacteria 1911
241 Ga0496109_0072867 3300048912 Bacteria 3156
242 Ga0496109_0289561 3300048912 Bacteria 1544
243 Ga0496112_0013324 3300048915 Bacteria 7589
244 Ga0496112_0036183 3300048915 Bacteria 4814
245 Ga0496112_0062327 3300048915 Bacteria 3678
246 Ga0496114_0141592 3300048917 Bacteria 2083
247 Ga0496114_0212107 3300048917 Bacteria 1698
248 Ga0496115_0015009 3300048918 Bacteria 5871
249 Ga0496115_0204895 3300048918 Bacteria 1629
250 Ga0496121_0240976 3300048924 Unclassified 1260
251 Ga0496121_0269845 3300048924 Bacteria 1170
252 Ga0496126_0003779 3300048929 Bacteria 18791
253 Ga0496126_0020867 3300048929 Bacteria 6414
254 Ga0495678_025270 3300049459 Bacteria 2554
255 Ga0501032_0137628 3300049569 Bacteria 1609
256 Ga0501034_0059602 3300049571 Bacteria 3834
257 Ga0501036_0236461 3300049572 Bacteria 1532
258 Ga0501039_0250367 3300049575 Bacteria 1393
259 Ga0501047_0087160 3300049581 Bacteria 2999
260 Ga0501070_0099716 3300049586 Bacteria 2403
261 Ga0501070_0122448 3300049586 Bacteria 2150
262 Ga0501083_0096589 3300049744 Bacteria 1950
263 Ga0501044_0001496 3300049823 Bacteria 27380
264 Ga0501044_0062699 3300049823 Bacteria 3799
265 nmdc:mga03n38_1582_c1 3300050490 Bacteria 6624
266 nmdc:mga00v17_135505_c1 3300050491 Bacteria 1576
267 nmdc:mga0yw44_168882_c1 3300050492 Bacteria 1436
268 nmdc:mga0k408_21692_c1 3300050493 Bacteria 3610
269 nmdc:mga06z11_97074_c1 3300050494 Bacteria 1610
270 nmdc:mga08y16_111177_c1 3300050511 Bacteria 2852
271 nmdc:mga0sz30_56712_c1 3300050516 Bacteria 1669
272 Ga0500643_037798 3300053087 Bacteria 1435
273 Ga0500651_0174339 3300053093 Unclassified 1280
274 Ga0500616_0000028 3300053153 Bacteria 435722
275 Ga0500622_0000854 3300053156 Bacteria 25992
276 2599740986 2599185239 Bacteria 8686614
277 2519461581 2519103095 Bacteria 6629912
278 2585164656 2582581283 Bacteria 6030556
279 2585264998 2582581306 Bacteria 6450535
280 2585293348 2582581311 Bacteria 6763856
281 2585385943 2582581865 Bacteria 6644329
282 2585994919 2585427633 Bacteria 6413184
283 2585999458 2585427634 Bacteria 6455027
284 2644498452 2643221689 Bacteria 6042950
285 2817258463 2816332253 Bacteria 6764532
286 2817281123 2816332256 Bacteria 6891714
287 2817453157 2816332286 Bacteria 6853759
288 2819635331 2818991452 Bacteria 8442785
289 2854898700 2854896431 Bacteria 5869725
290 2874625176 2874620515 Bacteria 8290088
291 2899806797 2899803654 Bacteria 5577784
292 2904668730 2904666416 Bacteria 8226587
293 2919171627 2919171160 Bacteria 6499771
294 2928171002 2928170801 Bacteria 8785406
295 8018849119 8018845410 Bacteria 8933938
296 8020809256 8020807995 Bacteria 6801506
297 8021123136 8021120328 Bacteria 8782274
298 8040167564 8040167225 Bacteria 6542727
299 8040177621 8040173305 Bacteria 6827067
300 8056685852 8056681323 Bacteria 8472857
301 JGI25151J46595_10006996
302 JGI25165J46597_1004620
303 rootH1_10184050
304 Ga0055532_1000298
305 Ga0055526_1000583
306 Ga0055537_1000062
307 Ga0055534_1000019
308 Ga0055528_1000048
309 Ga0070658_10019362
310 Ga0070690_100024403
311 Ga0070670_100092611
312 Ga0068869_100359909
313 Ga0070680_100317602
314 Ga0070660_100016875
315 Ga0070660_100067206
316 Ga0070660_100072667
317 Ga0070661_100078026
318 Ga0070692_10005548
319 Ga0070669_100260707
320 Ga0070669_100366250
321 Ga0070671_100018619
322 Ga0070671_100234340
323 Ga0070673_100017787
324 Ga0070673_100102009
325 Ga0070688_100350208
326 Ga0070659_100004385
327 Ga0070659_100018632
328 Ga0070667_100106223
329 Ga0070709_10231827
330 Ga0070714_100000107
331 Ga0070714_100025862
332 Ga0070714_100083648
333 Ga0070714_100371270
334 Ga0070713_100007697
335 Ga0070713_100016116
336 Ga0070710_10012487
337 Ga0070711_100011175
338 Ga0070663_100126453
339 Ga0070678_100075080
340 Ga0070678_100195882
341 Ga0070681_10109752
342 Ga0068867_100005129
343 Ga0068867_100032128
344 Ga0070706_100233336
345 Ga0070679_100110912
346 Ga0068853_100027854
347 Ga0068853_100316858
348 Ga0070672_100010731
349 Ga0070672_100042725
350 Ga0070696_100003055
351 Ga0070665_100287921
352 Ga0070665_100289209
353 Ga0070704_100219614
354 Ga0068855_100157034
355 Ga0068857_100035246
356 Ga0068864_100029731
357 Ga0068858_100482636
358 Ga0068858_100500106
359 Ga0068860_100050250
360 Ga0081455_10013731
361 Ga0070717_10010576
362 Ga0070717_10226739
363 Ga0075364_10137381
364 Ga0070715_10014267
365 Ga0070715_10041671
366 Ga0070716_100007354
367 Ga0075369_10048785
368 Ga0097621_100026846
369 Ga0097621_100142724
370 Ga0068871_100071927
371 Ga0068871_100214686
372 Ga0068871_100326429
373 Ga0068871_100339138
374 Ga0068871_100412946
375 Ga0068865_100002074
376 Ga0068865_100013819
377 Ga0068865_100031027
378 Ga0099794_10000123
379 Ga0111539_10090329
380 Ga0105245_10011188
381 Ga0105241_10057137
382 Ga0105242_10004879
383 Ga0105242_10034751
384 Ga0105242_10060642
385 Ga0105248_10011135
386 Ga0105248_10153795
387 Ga0105248_10490084
388 Ga0105237_10093301
389 Ga0105237_10329884
390 Ga0105249_10171258
391 Ga0105239_10236374
392 Ga0157373_10023327
393 Ga0157373_10071542
394 Ga0157373_10166353
395 Ga0157370_10031080
396 Ga0157378_10012596
397 Ga0163162_10054837
398 Ga0163162_10122791
399 Ga0163162_10160026
400 Ga0163162_10457474
401 Ga0163162_10708382
402 Ga0157372_10015781
403 Ga0157372_10095451
404 Ga0157375_10010778
405 Ga0157375_10022669
406 Ga0157375_10032126
407 Ga0157375_10463848
408 Ga0163163_10164754
409 Ga0157379_10203003
410 Ga0157379_10488602
411 Ga0157376_10002957
412 Ga0157376_10371858
413 Ga0182006_1015948
414 Ga0163161_10085628
415 Ga0213872_10011958
416 Ga0213876_10002079
417 Ga0209566_100136
418 Ga0209674_102153
419 Ga0209147_100064
420 Ga0209233_1000627
421 Ga0209565_1000017
422 Ga0209673_1000007
423 Ga0209675_1000009
424 Ga0209025_1000881
425 Ga0209564_1000036
426 Ga0209758_1014503
427 Ga0209256_1000091
428 Ga0207692_10000264
429 Ga0207692_10151484
430 Ga0207647_10010778
431 Ga0207685_10117134
432 Ga0207699_10139188
433 Ga0207699_10317088
434 Ga0207705_10003922
435 Ga0207707_10137834
436 Ga0207695_10328079
437 Ga0207671_10096083
438 Ga0207693_10001910
439 Ga0207660_10335919
440 Ga0207657_10030007
441 Ga0207657_10083608
442 Ga0207657_10251035
443 Ga0207649_10038853
444 Ga0207652_10427415
445 Ga0207681_10326050
446 Ga0207650_10149499
447 Ga0207650_10287685
448 Ga0207700_10008721
449 Ga0207700_10103588
450 Ga0207664_10000036
451 Ga0207664_10030157
452 Ga0207664_10049288
453 Ga0207690_10150633
454 Ga0207686_10077904
455 Ga0207686_10112309
456 Ga0207704_10031116
457 Ga0207704_10037217
458 Ga0207665_10001660
459 Ga0207691_10032053
460 Ga0207691_10079385
461 Ga0207711_10090625
462 Ga0207651_10077653
463 Ga0207651_10312168
464 Ga0207712_10070742
465 Ga0207658_10165242
466 Ga0207703_10407423
467 Ga0207639_10104725
468 Ga0207702_10327437
469 Ga0207641_10275592
470 Ga0207648_10006569
471 Ga0207676_10022769
472 Ga0207676_10225566
473 Ga0207674_10047031
474 Ga0207683_10040234
475 Ga0209588_1000790
476 Ga0268266_10293786
477 Ga0268264_10646968
478 Ga0265339_10030582
479 Ga0265339_10046158
480 Ga0265331_10035278
481 Ga0265314_10026244
482 Ga0265342_10051462
483 Ga0307410_10269478
484 Ga0307409_100013670
485 Ga0373930_0003756
486 Ga0373944_0058291
487 Ga0373932_0033395
488 Ga0373941_0102376
489 Ga0373946_0064773
490 Ga0373931_0091567
491 Ga0373927_0006928
492 Ga0373927_0044276
493 Ga0373927_0092122
494 Ga0395898_0002604
495 Ga0436364_0166674
496 Ga0395901_0002665
497 Ga0436361_0264102
498 Ga0436361_0363178
499 Ga0436361_0452773
500 Ga0436361_0721709
501 Ga0436361_0725532
502 Ga0436362_0489429
503 Ga0495638_0074136
504 Ga0495651_0297659
505 Ga0495580_0070644
506 Ga0495580_0103051
507 Ga0495605_0090664
508 Ga0495607_0011509
509 Ga0495616_0009608
510 Ga0495632_0150665
511 Ga0495643_0114929
512 Ga0495609_0000277
513 Ga0495668_0012710
514 Ga0495625_0001058
515 Ga0495659_0006787
516 Ga0495661_0091624
517 Ga0495658_0060548
518 Ga0495658_0176396
519 Ga0495669_0018218
520 Ga0495613_0100700
521 Ga0495670_0018394
522 Ga0495649_0010128
523 Ga0495660_0029028
524 Ga0495581_0018938
525 Ga0495677_0010278
526 Ga0495679_002996
527 Ga0495685_030410
528 Ga0495681_0032742
529 Ga0495602_0102096
530 Ga0496101_0010084
531 Ga0496102_0034409
532 Ga0496103_0051063
533 Ga0496104_0000057
534 Ga0496104_0026984
535 Ga0496104_0191751
536 Ga0496105_0000037
537 Ga0496105_0116020
538 Ga0496106_0207554
539 Ga0496107_0213523
540 Ga0496108_0165636
541 Ga0496109_0072867
542 Ga0496109_0289561
543 Ga0496112_0013324
544 Ga0496112_0036183
545 Ga0496112_0062327
546 Ga0496114_0141592
547 Ga0496114_0212107
548 Ga0496115_0015009
549 Ga0496115_0204895
550 Ga0496121_0240976
551 Ga0496121_0269845
552 Ga0496126_0003779
553 Ga0496126_0020867
554 Ga0495678_025270
555 Ga0501032_0137628
556 Ga0501034_0059602
557 Ga0501036_0236461
558 Ga0501039_0250367
559 Ga0501047_0087160
560 Ga0501070_0099716
561 Ga0501070_0122448
562 Ga0501083_0096589
563 Ga0501044_0001496
564 Ga0501044_0062699
565 nmdc:mga03n38_1582_c1
566 nmdc:mga00v17_135505_c1
567 nmdc:mga0yw44_168882_c1
568 nmdc:mga0k408_21692_c1
569 nmdc:mga06z11_97074_c1
570 nmdc:mga08y16_111177_c1
571 nmdc:mga0sz30_56712_c1
572 Ga0500643_037798
573 Ga0500651_0174339
574 Ga0500616_0000028
575 Ga0500622_0000854
576 2599740986
577 2519461581
578 2585164656
579 2585264998
580 2585293348
581 2585385943
582 2585994919
583 2585999458
584 2644498452
585 2817258463
586 2817281123
587 2817453157
588 2819635331
589 2854898700
590 2874625176
591 2899806797
592 2904668730
593 2919171627
594 2928171002
595 8018849119
596 8020809256
597 8021123136
598 8040167564
599 8040177621
600 8056685852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

26

85

0.98

PF03466

LysR_substrate

LysR substrate binding domain

107

295

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.93 6 90
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9292 6 90
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9274 6 90
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9269 6 90
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9214 6 90
ID Description Score Start End Superfamily
af_P36771_5_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9749 5 86 1.10.10.10
af_P67660_2_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 6 88 1.10.10.10
af_P77309_1_86_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9455 6 83 1.10.10.10
af_P33634_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9451 6 87 1.10.10.10
af_Q2FVT4_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9437 6 89 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9264 4 87 GO:0003700
GO:0006351
GO:0043565
AF-A0A455U1X6-F1-model_v4 LysR substrate-binding domain-containing protein 0.9243 160 287 GO:0003700
GO:0016020
AF-A0A370AMN6-F1-model_v4 LysR family transcriptional regulator 0.9232 91 285 GO:0003700
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9057 4 87 GO:0003700
GO:0006351
GO:0043565
AF-A0A455U1X6-F1-model_v4 LysR substrate-binding domain-containing protein 0.8912 160 287 GO:0003700
GO:0016020

Map