F395561

General Info

Members Datasets Scaffolds Average Seq Length
300 207 300 530

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000002|Ga0496104_0000002_433119_435224
Length 614
Sequence MSSSAAVTAATQAAGVNQLRAQVGTGARYRCGPRWGALGPWIHWPEPLMTESTSLYRRHRPGSFDEVVGQQHVVRTLRNAVEQDKVHHAYLFVGSRGTGKTSMAKILARSLNCERGGSTVTPCGECESCVTIAAGTSVDVIEMDAASNRSVDDVRDLRERVAYAPAGGHWKVYILDEAHMLTKEAWNAFLKTLEEPPPNTVFVLATTEAHKVMATIADRCQRFDFQRPSLEQISEVLTRVAAAESITVDEGATAMIARSASGSFRDALGTLDQLVAFGGDQVTLDSVLEVLGAADAELLFETVDAVAAEDPKAVLLTVEKMARSGRDPAQFARDLLGHLRHLLVTQTTGEVPDTFVVTATDAGRLEAQASSAAAAALVRTIDELASALTAVREGDEARMAVEIALLKAARPDLDPSTEGLLRRIERLEKALSEGGGARGLSQEQGGAAGEGVLDPPAPVPPARDTSQEXXTQDEVVPRGAEEAAATGPAAQNAFDLSEVTRIWPVVLDKLTETAPALAATFEGARPVSLDDDGVKIGFPADKTFNKRKAESPERREALASAFVAVAGQELRPTYVLLDEESAEAEPADEPAPGAADHSDLVARLKSEFNAEEVS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
102 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
103 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 11.67
Rhizosphere 84
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000526 3300001977 Bacteria 5738
2 JGI24034J26672_10000495 3300002239 Bacteria 5101
3 JGI25404J52841_10001038 3300003659 Bacteria 4611
4 Ga0070658_10051144 3300005327 Bacteria 3349
5 Ga0070683_100002626 3300005329 Bacteria 14369
6 Ga0070683_100004015 3300005329 Bacteria 12046
7 Ga0070683_100012670 3300005329 Bacteria 7332
8 Ga0070683_100029359 3300005329 Bacteria 4978
9 Ga0070677_10000013 3300005333 Bacteria 53677
10 Ga0070682_100000077 3300005337 Bacteria 89055
11 Ga0070682_100001328 3300005337 Bacteria 13995
12 Ga0068868_100000467 3300005338 Bacteria 26933
13 Ga0068868_100005792 3300005338 Bacteria 8707
14 Ga0070691_10000014 3300005341 Bacteria 50487
15 Ga0070691_10000822 3300005341 Bacteria 12463
16 Ga0070661_100000116 3300005344 Bacteria 66712
17 Ga0070675_100000008 3300005354 Bacteria 250004
18 Ga0070674_100000001 3300005356 Bacteria 277173
19 Ga0070674_100000103 3300005356 Bacteria 39432
20 Ga0070673_100004180 3300005364 Bacteria 9107
21 Ga0070659_100002304 3300005366 Bacteria 13596
22 Ga0070667_100001780 3300005367 Bacteria 19195
23 Ga0070667_100112444 3300005367 Bacteria 2362
24 Ga0070713_100000143 3300005436 Bacteria 47475
25 Ga0070711_100014403 3300005439 Bacteria 4984
26 Ga0070663_100000274 3300005455 Bacteria 25997
27 Ga0070662_100000015 3300005457 Bacteria 109379
28 Ga0070679_100000069 3300005530 Bacteria 76557
29 Ga0070679_100021167 3300005530 Bacteria 6345
30 Ga0068853_100001637 3300005539 Bacteria 16375
31 Ga0068853_100119792 3300005539 Bacteria 2346
32 Ga0070672_100000175 3300005543 Bacteria 35613
33 Ga0070686_100021025 3300005544 Bacteria 3872
34 Ga0070665_100000068 3300005548 Bacteria 204531
35 Ga0070665_100009304 3300005548 Bacteria 9944
36 Ga0070665_100118932 3300005548 Bacteria 2645
37 Ga0070704_100071171 3300005549 Bacteria 2526
38 Ga0068854_100000472 3300005578 Bacteria 24819
39 Ga0068856_100000210 3300005614 Bacteria 63036
40 Ga0068856_100079564 3300005614 Bacteria 3250
41 Ga0068852_100000005 3300005616 Bacteria 173127
42 Ga0068864_100000024 3300005618 Bacteria 252632
43 Ga0068866_10000014 3300005718 Bacteria 72482
44 Ga0068863_100000136 3300005841 Bacteria 78102
45 Ga0068863_100005789 3300005841 Bacteria 12118
46 Ga0068858_100000088 3300005842 Bacteria 95138
47 Ga0068858_100001203 3300005842 Bacteria 26823
48 Ga0068858_100102208 3300005842 Bacteria 2674
49 Ga0081455_10004899 3300005937 Bacteria 14838
50 Ga0081455_10048950 3300005937 Bacteria 3647
51 Ga0081538_10000023 3300005981 Bacteria 131101
52 Ga0081538_10004025 3300005981 Bacteria 13675
53 Ga0081540_1000296 3300005983 Bacteria 51895
54 Ga0081539_10002449 3300005985 Bacteria 26184
55 Ga0075365_10000503 3300006038 Bacteria 14878
56 Ga0075364_10011279 3300006051 Bacteria 5427
57 Ga0070715_10000011 3300006163 Bacteria 183857
58 Ga0070712_100005453 3300006175 Bacteria 7879
59 Ga0070712_100013482 3300006175 Bacteria 5224
60 Ga0075431_100029010 3300006847 Bacteria 5691
61 Ga0075433_10000057 3300006852 Bacteria 48581
62 Ga0075433_10000968 3300006852 Bacteria 20370
63 Ga0075433_10109915 3300006852 Bacteria 2445
64 Ga0068865_100000019 3300006881 Bacteria 105996
65 Ga0105245_10000012 3300009098 Bacteria 267151
66 Ga0105245_10000667 3300009098 Bacteria 31104
67 Ga0105245_10022100 3300009098 Bacteria 5585
68 Ga0105245_10030985 3300009098 Bacteria 4731
69 Ga0105247_10000204 3300009101 Bacteria 58153
70 Ga0105242_10002841 3300009176 Bacteria 13567
71 Ga0105248_10000126 3300009177 Bacteria 88461
72 Ga0105238_10000172 3300009551 Bacteria 70799
73 Ga0105249_10009671 3300009553 Bacteria 8447
74 Ga0105239_10190013 3300010375 Bacteria 2299
75 Ga0157369_10000135 3300013105 Bacteria 105364
76 Ga0157374_10006572 3300013296 Bacteria 9872
77 Ga0157378_10039519 3300013297 Bacteria 4185
78 Ga0157372_10000394 3300013307 Bacteria 48255
79 Ga0157375_10000416 3300013308 Bacteria 38766
80 Ga0157375_10028002 3300013308 Bacteria 5275
81 Ga0157379_10011591 3300014968 Bacteria 7698
82 Ga0157379_10043127 3300014968 Bacteria 4027
83 Ga0157376_10152195 3300014969 Bacteria 2087
84 Ga0163161_10000018 3300017792 Bacteria 228801
85 Ga0207656_10000105 3300025321 Bacteria 31356
86 Ga0207682_10000038 3300025893 Bacteria 53885
87 Ga0207642_10000001 3300025899 Bacteria 714030
88 Ga0207642_10000043 3300025899 Bacteria 35963
89 Ga0207642_10014005 3300025899 Bacteria 2945
90 Ga0207685_10000001 3300025905 Bacteria 604473
91 Ga0207705_10041343 3300025909 Bacteria 3308
92 Ga0207707_10025210 3300025912 Bacteria 5202
93 Ga0207671_10092199 3300025914 Bacteria 2284
94 Ga0207693_10007793 3300025915 Bacteria 8787
95 Ga0207693_10070346 3300025915 Bacteria 2738
96 Ga0207663_10011747 3300025916 Bacteria 4712
97 Ga0207649_10000005 3300025920 Bacteria 356179
98 Ga0207652_10000142 3300025921 Bacteria 76696
99 Ga0207652_10001090 3300025921 Bacteria 24590
100 Ga0207694_10000004 3300025924 Bacteria 967075
101 Ga0207659_10000014 3300025926 Bacteria 168481
102 Ga0207687_10000011 3300025927 Bacteria 388349
103 Ga0207687_10000037 3300025927 Bacteria 120493
104 Ga0207687_10000133 3300025927 Bacteria 49874
105 Ga0207700_10000008 3300025928 Bacteria 341717
106 Ga0207690_10005636 3300025932 Bacteria 7399
107 Ga0207706_10000062 3300025933 Bacteria 109344
108 Ga0207686_10000063 3300025934 Bacteria 96427
109 Ga0207669_10000002 3300025937 Bacteria 377651
110 Ga0207669_10000115 3300025937 Bacteria 40041
111 Ga0207669_10084131 3300025937 Bacteria 2049
112 Ga0207704_10000009 3300025938 Bacteria 198266
113 Ga0207691_10000609 3300025940 Bacteria 35618
114 Ga0207711_10000024 3300025941 Bacteria 293596
115 Ga0207661_10001063 3300025944 Bacteria 18265
116 Ga0207661_10002334 3300025944 Bacteria 13072
117 Ga0207679_10025338 3300025945 Bacteria 4077
118 Ga0207651_10001295 3300025960 Bacteria 11260
119 Ga0207712_10005720 3300025961 Bacteria 7837
120 Ga0207640_10000125 3300025981 Bacteria 58750
121 Ga0207640_10052356 3300025981 Bacteria 2659
122 Ga0207658_10008706 3300025986 Bacteria 6895
123 Ga0207677_10000464 3300026023 Bacteria 27017
124 Ga0207703_10000128 3300026035 Bacteria 91359
125 Ga0207703_10000237 3300026035 Bacteria 62874
126 Ga0207703_10015703 3300026035 Bacteria 5907
127 Ga0207639_10003793 3300026041 Bacteria 10171
128 Ga0207639_10080890 3300026041 Bacteria 2572
129 Ga0207678_10014869 3300026067 Bacteria 6845
130 Ga0207708_10025412 3300026075 Bacteria 4480
131 Ga0207708_10073034 3300026075 Bacteria 2629
132 Ga0207702_10025507 3300026078 Bacteria 4906
133 Ga0207702_10053419 3300026078 Bacteria 3420
134 Ga0207641_10000265 3300026088 Bacteria 66346
135 Ga0207641_10001786 3300026088 Bacteria 20709
136 Ga0207648_10000271 3300026089 Bacteria 56175
137 Ga0207648_10084442 3300026089 Bacteria 2770
138 Ga0207676_10000048 3300026095 Bacteria 147853
139 Ga0207676_10113523 3300026095 Bacteria 2271
140 Ga0207675_100037607 3300026118 Bacteria 4514
141 Ga0207683_10049298 3300026121 Bacteria 3687
142 Ga0207698_10000038 3300026142 Bacteria 101918
143 Ga0268266_10000020 3300028379 Bacteria 527065
144 Ga0268266_10000313 3300028379 Bacteria 76938
145 Ga0268266_10001032 3300028379 Bacteria 35051
146 Ga0268264_10013507 3300028381 Bacteria 6725
147 Ga0265337_1000126 3300028556 Bacteria 38633
148 Ga0265326_10000144 3300028558 Bacteria 37151
149 Ga0265319_1000266 3300028563 Bacteria 39456
150 Ga0265322_10000009 3300028654 Bacteria 170768
151 Ga0265336_10001523 3300028666 Bacteria 10447
152 Ga0265338_10001825 3300028800 Bacteria 33381
153 Ga0265324_10001496 3300029957 Bacteria 13252
154 Ga0265320_10000024 3300031240 Bacteria 170768
155 Ga0265327_10000649 3300031251 Bacteria 56238
156 Ga0265316_10018722 3300031344 Bacteria 5946
157 Ga0265314_10000570 3300031711 Bacteria 46890
158 Ga0316574_0017497 3300035398 Bacteria 4197
159 Ga0395900_0047454 3300037418 Bacteria 4422
160 Ga0395898_0018653 3300037466 Bacteria 7072
161 Ga0395905_0036867 3300037471 Bacteria 4592
162 Ga0466957_0000177 3300044842 Bacteria 28545
163 Ga0466959_0006346 3300045049 Bacteria 8181
164 Ga0466967_0000005 3300045976 Bacteria 149543
165 Ga0495592_0000600 3300046454 Bacteria 25385
166 Ga0495603_0000074 3300046455 Bacteria 43833
167 Ga0495603_0001152 3300046455 Bacteria 15404
168 Ga0495629_0000055 3300046459 Bacteria 105268
169 Ga0495629_0084694 3300046459 Bacteria 2212
170 Ga0495638_0008356 3300046460 Bacteria 7342
171 Ga0495641_0000020 3300046461 Bacteria 115404
172 Ga0495650_0000188 3300046471 Bacteria 134775
173 Ga0495582_0000013 3300046473 Bacteria 110372
174 Ga0495662_0000021 3300046476 Bacteria 54969
175 Ga0495594_0000007 3300046499 Bacteria 160047
176 Ga0495606_0000057 3300046507 Bacteria 197956
177 Ga0495608_0000079 3300046511 Bacteria 71469
178 Ga0495620_0002330 3300046515 Bacteria 11010
179 Ga0495628_0000965 3300046516 Bacteria 26318
180 Ga0495630_0000011 3300046517 Bacteria 232063
181 Ga0495644_0000693 3300046523 Bacteria 13956
182 Ga0495652_0000003 3300046529 Bacteria 597094
183 Ga0495652_0017506 3300046529 Bacteria 6394
184 Ga0495645_0002818 3300046543 Bacteria 11795
185 Ga0495622_0000270 3300046557 Bacteria 39432
186 Ga0495667_0000022 3300046559 Bacteria 176919
187 Ga0495656_0000196 3300046615 Bacteria 21672
188 Ga0495634_0000437 3300046642 Bacteria 41521
189 Ga0495634_0000601 3300046642 Bacteria 34818
190 Ga0495625_0000787 3300046660 Bacteria 43981
191 Ga0495635_0000026 3300046663 Bacteria 142517
192 Ga0495588_0001678 3300046674 Bacteria 9433
193 Ga0495657_0000070 3300046675 Bacteria 92382
194 Ga0495599_0014958 3300046678 Bacteria 4809
195 Ga0495647_0000027 3300046681 Bacteria 58315
196 Ga0495658_0000009 3300046683 Bacteria 110421
197 Ga0495669_0000083 3300046684 Bacteria 62876
198 Ga0495669_0000823 3300046684 Bacteria 13221
199 Ga0495613_0000187 3300046689 Bacteria 60818
200 Ga0495613_0000364 3300046689 Bacteria 39475
201 Ga0495624_0000012 3300046690 Bacteria 124128
202 Ga0495624_0000258 3300046690 Bacteria 41999
203 Ga0495670_0041971 3300046691 Bacteria 2283
204 Ga0495649_0000587 3300046694 Bacteria 30555
205 Ga0495600_0023432 3300046809 Bacteria 3972
206 Ga0495600_0037762 3300046809 Bacteria 3141
207 Ga0495600_0046892 3300046809 Bacteria 2819
208 Ga0495604_0000413 3300047317 Bacteria 38567
209 Ga0495604_0000416 3300047317 Bacteria 38302
210 Ga0495674_0001198 3300047319 Bacteria 25096
211 Ga0495676_0005294 3300047321 Bacteria 11811
212 Ga0495676_0010588 3300047321 Bacteria 8354
213 Ga0495680_0000407 3300047322 Bacteria 48143
214 Ga0495680_0000671 3300047322 Bacteria 38307
215 Ga0495675_0000141 3300047444 Bacteria 50168
216 Ga0495602_0000009 3300048088 Bacteria 258991
217 Ga0496100_0000012 3300048903 Bacteria 182426
218 Ga0496101_0000010 3300048904 Bacteria 281990
219 Ga0496101_0024421 3300048904 Bacteria 4183
220 Ga0496101_0087537 3300048904 Bacteria 2312
221 Ga0496102_0000045 3300048905 Bacteria 186726
222 Ga0496102_0007753 3300048905 Bacteria 9173
223 Ga0496103_0000050 3300048906 Bacteria 152034
224 Ga0496103_0002814 3300048906 Bacteria 10826
225 Ga0496104_0000002 3300048907 Bacteria 686017
226 Ga0496104_0000013 3300048907 Bacteria 397163
227 Ga0496104_0003587 3300048907 Bacteria 13403
228 Ga0496105_0000001 3300048908 Bacteria 1328178
229 Ga0496105_0000006 3300048908 Bacteria 393578
230 Ga0496106_0000017 3300048909 Bacteria 181561
231 Ga0496106_0000174 3300048909 Bacteria 46312
232 Ga0496106_0004083 3300048909 Bacteria 10890
233 Ga0496107_0000012 3300048910 Bacteria 181629
234 Ga0496108_0000001 3300048911 Bacteria 919044
235 Ga0496108_0000398 3300048911 Bacteria 35931
236 Ga0496108_0101189 3300048911 Bacteria 2458
237 Ga0496109_0000006 3300048912 Bacteria 325513
238 Ga0496109_0000024 3300048912 Bacteria 174723
239 Ga0496109_0000248 3300048912 Bacteria 51780
240 Ga0496109_0000285 3300048912 Bacteria 48300
241 Ga0496109_0012386 3300048912 Bacteria 7364
242 Ga0496109_0108942 3300048912 Bacteria 2575
243 Ga0496110_0018392 3300048913 Bacteria 5859
244 Ga0496111_0027268 3300048914 Bacteria 4039
245 Ga0496112_0000003 3300048915 Bacteria 660147
246 Ga0496112_0001779 3300048915 Bacteria 16928
247 Ga0496113_0000080 3300048916 Bacteria 42084
248 Ga0496114_0000003 3300048917 Bacteria 630981
249 Ga0496115_0000071 3300048918 Bacteria 91922
250 Ga0496115_0000263 3300048918 Bacteria 46550
251 Ga0496115_0022984 3300048918 Bacteria 4835
252 Ga0496116_0000423 3300048919 Bacteria 59658
253 Ga0496117_0001719 3300048920 Bacteria 30306
254 Ga0496118_0001802 3300048921 Bacteria 30879
255 Ga0496118_0054372 3300048921 Bacteria 3033
256 Ga0496119_0007488 3300048922 Bacteria 9814
257 Ga0496121_0004385 3300048924 Bacteria 19053
258 Ga0496121_0043713 3300048924 Bacteria 3875
259 Ga0501032_0009269 3300049569 Bacteria 7133
260 Ga0501033_0010646 3300049570 Bacteria 7053
261 Ga0501034_0052226 3300049571 Bacteria 4118
262 Ga0501036_0056405 3300049572 Bacteria 3328
263 Ga0501038_0015191 3300049574 Bacteria 7003
264 Ga0501042_0033618 3300049578 Bacteria 3635
265 Ga0501046_0012350 3300049580 Bacteria 7274
266 Ga0501047_0013985 3300049581 Bacteria 7626
267 Ga0501047_0015832 3300049581 Bacteria 7184
268 Ga0501070_0012559 3300049586 Bacteria 7143
269 Ga0501070_0018096 3300049586 Bacteria 5911
270 Ga0501075_0032777 3300049591 Bacteria 3862
271 Ga0501076_0030147 3300049592 Bacteria 4225
272 Ga0501079_0031124 3300049741 Bacteria 4100
273 Ga0501079_0066406 3300049741 Bacteria 2783
274 Ga0501080_0041795 3300049742 Bacteria 4270
275 Ga0501035_0014582 3300049822 Bacteria 7253
276 Ga0501044_0019801 3300049823 Bacteria 7189
277 nmdc:mga0yw44_13891_c1 3300050492 Bacteria 4256
278 nmdc:mga06r32_126855_c1 3300050510 Bacteria 2521
279 nmdc:mga0a205_1066_c1 3300050515 Bacteria 22781
280 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
281 Ga0495601_0000031 3300053077 Bacteria 105493
282 Ga0495601_0000196 3300053077 Bacteria 32072
283 Ga0495612_0003966 3300053078 Bacteria 6146
284 Ga0495612_0010132 3300053078 Bacteria 3812
285 Ga0495612_0019089 3300053078 Bacteria 2746
286 Ga0495655_0000004 3300053083 Bacteria 293683
287 Ga0495595_0000004 3300053084 Bacteria 260821
288 Ga0495595_0000167 3300053084 Bacteria 25731
289 Ga0495595_0010800 3300053084 Bacteria 3805
290 Ga0495619_0000042 3300053085 Bacteria 112453
291 Ga0495619_0000061 3300053085 Bacteria 88943
292 Ga0495619_0000098 3300053085 Bacteria 64979
293 Ga0495619_0000173 3300053085 Bacteria 47525
294 Ga0495619_0004260 3300053085 Bacteria 9118
295 Ga0495619_0013246 3300053085 Bacteria 5198
296 Ga0500566_0065932 3300053094 Bacteria 2041
297 Ga0500641_0005892 3300053096 Bacteria 4339
298 Ga0500628_000004 3300053129 Bacteria 202098
299 Ga0501084_0032308 3300054114 Bacteria 4378
300 Ga0530510_0001298 3300061734 Bacteria 16705

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100037607 Ga0207675_1000376074 469
2 3300049592 Ga0501076_0030147 Ga0501076_0030147_923_2590 469
3 3300049741 Ga0501079_0031124 Ga0501079_0031124_554_2221 469
4 3300054114 Ga0501084_0032308 Ga0501084_0032308_182_1849 469
5 3300061734 Ga0530510_0001298 Ga0530510_0001298_2840_4507 469
6 3300005341 Ga0070691_10000822 Ga0070691_1000082210 477
7 3300045049 Ga0466959_0006346 Ga0466959_0006346_1882_3495 477
8 3300037418 Ga0395900_0047454 Ga0395900_0047454_92_1807 478
9 3300037466 Ga0395898_0018653 Ga0395898_0018653_5163_6878 478
10 3300037471 Ga0395905_0036867 Ga0395905_0036867_1392_3107 478
11 3300026075 Ga0207708_10073034 Ga0207708_100730342 485
12 3300005333 Ga0070677_10000013 Ga0070677_1000001346 486
13 3300025893 Ga0207682_10000038 Ga0207682_1000003846 486
14 3300046615 Ga0495656_0000196 Ga0495656_0000196_12230_13993 486
15 3300048912 Ga0496109_0108942 Ga0496109_0108942_14_1861 486
16 3300002239 JGI24034J26672_10000495 JGI24034J26672_100004953 488
17 3300005338 Ga0068868_100005792 Ga0068868_1000057922 489
18 3300046471 Ga0495650_0000188 Ga0495650_0000188_111981_113816 489
19 3300006852 Ga0075433_10000057 Ga0075433_1000005726 490
20 3300048920 Ga0496117_0001719 Ga0496117_0001719_28373_30154 490
21 3300048921 Ga0496118_0001802 Ga0496118_0001802_8699_10480 490
22 3300048924 Ga0496121_0043713 Ga0496121_0043713_43_1854 490
23 3300003659 JGI25404J52841_10001038 JGI25404J52841_100010384 491
24 3300005983 Ga0081540_1000296 Ga0081540_100029620 491
25 3300049741 Ga0501079_0066406 Ga0501079_0066406_486_2333 491
26 3300025915 Ga0207693_10070346 Ga0207693_100703463 492
27 3300005544 Ga0070686_100021025 Ga0070686_1000210254 494
28 3300005937 Ga0081455_10048950 Ga0081455_100489504 494
29 3300006038 Ga0075365_10000503 Ga0075365_1000050315 494
30 3300025981 Ga0207640_10052356 Ga0207640_100523561 494
31 3300026075 Ga0207708_10025412 Ga0207708_100254121 494
32 3300026089 Ga0207648_10084442 Ga0207648_100844422 494
33 3300026095 Ga0207676_10113523 Ga0207676_101135231 494
34 3300026121 Ga0207683_10049298 Ga0207683_100492984 494
35 3300048911 Ga0496108_0101189 Ga0496108_0101189_67_1938 494
36 3300048912 Ga0496109_0012386 Ga0496109_0012386_5195_7066 494
37 3300050492 nmdc:mga0yw44_13891_c1 nmdc:mga0yw44_13891_c1_1243_2946 494
38 3300005344 Ga0070661_100000116 Ga0070661_10000011616 495
39 3300005356 Ga0070674_100000103 Ga0070674_10000010313 495
40 3300005718 Ga0068866_10000014 Ga0068866_1000001467 495
41 3300006852 Ga0075433_10109915 Ga0075433_101099152 495
42 3300025899 Ga0207642_10000001 Ga0207642_10000001747 495
43 3300025914 Ga0207671_10092199 Ga0207671_100921992 495
44 3300025920 Ga0207649_10000005 Ga0207649_10000005132 495
45 3300025937 Ga0207669_10000115 Ga0207669_1000011529 495
46 3300046543 Ga0495645_0002818 Ga0495645_0002818_5039_6757 495
47 3300046642 Ga0495634_0000601 Ga0495634_0000601_32336_34084 495
48 3300049578 Ga0501042_0033618 Ga0501042_0033618_1072_2874 495
49 3300006051 Ga0075364_10011279 Ga0075364_100112793 496
50 3300013297 Ga0157378_10039519 Ga0157378_100395193 496
51 3300047319 Ga0495674_0001198 Ga0495674_0001198_7234_9012 496
52 3300005439 Ga0070711_100014403 Ga0070711_1000144033 497
53 3300005842 Ga0068858_100000088 Ga0068858_10000008877 497
54 3300025916 Ga0207663_10011747 Ga0207663_100117474 497
55 3300026035 Ga0207703_10000237 Ga0207703_1000023730 497
56 3300009098 Ga0105245_10030985 Ga0105245_100309852 498
57 3300005329 Ga0070683_100029359 Ga0070683_1000293593 499
58 3300005455 Ga0070663_100000274 Ga0070663_10000027410 499
59 3300005530 Ga0070679_100021167 Ga0070679_1000211673 499
60 3300025912 Ga0207707_10025210 Ga0207707_100252103 499
61 3300025921 Ga0207652_10001090 Ga0207652_1000109014 499
62 3300026067 Ga0207678_10014869 Ga0207678_100148694 499
63 3300048907 Ga0496104_0003587 Ga0496104_0003587_8187_9968 499
64 3300048919 Ga0496116_0000423 Ga0496116_0000423_9106_10968 499
65 3300048921 Ga0496118_0054372 Ga0496118_0054372_614_2476 499
66 3300048922 Ga0496119_0007488 Ga0496119_0007488_7449_9311 499
67 3300048924 Ga0496121_0004385 Ga0496121_0004385_61_1842 499
68 3300006881 Ga0068865_100000019 Ga0068865_10000001981 500
69 3300025938 Ga0207704_10000009 Ga0207704_1000000910 500
70 3300046691 Ga0495670_0041971 Ga0495670_0041971_43_1830 501
71 3300005539 Ga0068853_100119792 Ga0068853_1001197922 502
72 3300005937 Ga0081455_10004899 Ga0081455_1000489916 502
73 3300013307 Ga0157372_10000394 Ga0157372_1000039442 502
74 3300014968 Ga0157379_10043127 Ga0157379_100431273 502
75 3300026041 Ga0207639_10080890 Ga0207639_100808902 502
76 3300046507 Ga0495606_0000057 Ga0495606_0000057_148095_149879 502
77 3300046517 Ga0495630_0000011 Ga0495630_0000011_91688_93391 502
78 3300048088 Ga0495602_0000009 Ga0495602_0000009_118510_120111 502
79 3300025899 Ga0207642_10014005 Ga0207642_100140053 503
80 3300028556 Ga0265337_1000126 Ga0265337_100012628 503
81 3300028558 Ga0265326_10000144 Ga0265326_1000014412 503
82 3300028654 Ga0265322_10000009 Ga0265322_1000000954 503
83 3300028666 Ga0265336_10001523 Ga0265336_100015237 503
84 3300029957 Ga0265324_10001496 Ga0265324_1000149612 503
85 3300031240 Ga0265320_10000024 Ga0265320_10000024121 503
86 3300031251 Ga0265327_10000649 Ga0265327_1000064954 503
87 3300031344 Ga0265316_10018722 Ga0265316_100187225 503
88 3300031711 Ga0265314_10000570 Ga0265314_1000057013 503
89 3300046642 Ga0495634_0000437 Ga0495634_0000437_13121_14821 503
90 3300005436 Ga0070713_100000143 Ga0070713_10000014330 504
91 3300006175 Ga0070712_100005453 Ga0070712_1000054535 504
92 3300025915 Ga0207693_10007793 Ga0207693_100077934 504
93 3300025927 Ga0207687_10000133 Ga0207687_1000013331 504
94 3300025928 Ga0207700_10000008 Ga0207700_1000000822 504
95 3300046674 Ga0495588_0001678 Ga0495588_0001678_4868_6601 504
96 3300005367 Ga0070667_100001780 Ga0070667_10000178013 505
97 3300005548 Ga0070665_100118932 Ga0070665_1001189322 505
98 3300005578 Ga0068854_100000472 Ga0068854_1000004727 505
99 3300005981 Ga0081538_10004025 Ga0081538_100040254 505
100 3300009098 Ga0105245_10000012 Ga0105245_1000001245 505
101 3300009553 Ga0105249_10009671 Ga0105249_100096712 505
102 3300025927 Ga0207687_10000011 Ga0207687_1000001198 505
103 3300025961 Ga0207712_10005720 Ga0207712_100057202 505
104 3300025981 Ga0207640_10000125 Ga0207640_1000012521 505
105 3300025986 Ga0207658_10008706 Ga0207658_100087062 505
106 3300046689 Ga0495613_0000187 Ga0495613_0000187_35479_37182 505
107 3300005329 Ga0070683_100012670 Ga0070683_1000126707 507
108 3300005367 Ga0070667_100112444 Ga0070667_1001124441 507
109 3300005614 Ga0068856_100000210 Ga0068856_10000021024 507
110 3300025944 Ga0207661_10002334 Ga0207661_1000233410 507
111 3300025945 Ga0207679_10025338 Ga0207679_100253383 507
112 3300026078 Ga0207702_10053419 Ga0207702_100534192 507
113 3300028379 Ga0268266_10000313 Ga0268266_1000031365 507
114 3300028381 Ga0268264_10013507 Ga0268264_100135074 507
115 3300046557 Ga0495622_0000270 Ga0495622_0000270_34649_36304 507
116 3300046809 Ga0495600_0037762 Ga0495600_0037762_1240_2925 507
117 3300048907 Ga0496104_0000013 Ga0496104_0000013_53875_55755 507
118 3300048908 Ga0496105_0000006 Ga0496105_0000006_341409_343289 507
119 3300048918 Ga0496115_0000263 Ga0496115_0000263_20848_22557 507
120 3300049581 Ga0501047_0013985 Ga0501047_0013985_3169_4902 507
121 3300053078 Ga0495612_0019089 Ga0495612_0019089_391_2193 507
122 3300053085 Ga0495619_0000098 Ga0495619_0000098_36565_38367 507
123 3300005337 Ga0070682_100001328 Ga0070682_1000013286 508
124 3300005549 Ga0070704_100071171 Ga0070704_1000711712 508
125 3300005842 Ga0068858_100102208 Ga0068858_1001022081 508
126 3300025321 Ga0207656_10000105 Ga0207656_1000010531 508
127 3300026035 Ga0207703_10015703 Ga0207703_100157032 508
128 3300049586 Ga0501070_0018096 Ga0501070_0018096_511_2514 508
129 3300053084 Ga0495595_0010800 Ga0495595_0010800_1810_3423 508
130 3300053096 Ga0500641_0005892 Ga0500641_0005892_1810_3630 508
131 3300005364 Ga0070673_100004180 Ga0070673_10000418010 509
132 3300006163 Ga0070715_10000011 Ga0070715_1000001168 509
133 3300013308 Ga0157375_10000416 Ga0157375_1000041618 509
134 3300025905 Ga0207685_10000001 Ga0207685_10000001119 509
135 3300025960 Ga0207651_10001295 Ga0207651_1000129512 509
136 3300046460 Ga0495638_0008356 Ga0495638_0008356_745_2469 509
137 3300046559 Ga0495667_0000022 Ga0495667_0000022_16874_18613 509
138 3300046684 Ga0495669_0000083 Ga0495669_0000083_19261_20952 509
139 3300047321 Ga0495676_0010588 Ga0495676_0010588_5214_6902 509
140 3300048906 Ga0496103_0000050 Ga0496103_0000050_105989_107899 509
141 3300048912 Ga0496109_0000248 Ga0496109_0000248_15524_17203 509
142 3300053085 Ga0495619_0013246 Ga0495619_0013246_1869_3494 509
143 3300025937 Ga0207669_10084131 Ga0207669_100841312 510
144 3300046684 Ga0495669_0000823 Ga0495669_0000823_262_2064 510
145 3300047322 Ga0495680_0000407 Ga0495680_0000407_36121_38016 510
146 3300048915 Ga0496112_0001779 Ga0496112_0001779_8330_10123 510
147 3300048916 Ga0496113_0000080 Ga0496113_0000080_8313_10106 510
148 3300005329 Ga0070683_100002626 Ga0070683_10000262612 511
149 3300005354 Ga0070675_100000008 Ga0070675_100000008220 511
150 3300005543 Ga0070672_100000175 Ga0070672_10000017528 511
151 3300025940 Ga0207691_10000609 Ga0207691_100006099 511
152 3300046499 Ga0495594_0000007 Ga0495594_0000007_112634_114337 511
153 3300047317 Ga0495604_0000416 Ga0495604_0000416_6623_8320 511
154 3300048904 Ga0496101_0087537 Ga0496101_0087537_92_2233 511
155 3300048913 Ga0496110_0018392 Ga0496110_0018392_1789_3552 511
156 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_139159_140820 511
157 3300053077 Ga0495601_0000031 Ga0495601_0000031_36650_38353 511
158 3300053094 Ga0500566_0065932 Ga0500566_0065932_64_1872 511
159 3300005327 Ga0070658_10051144 Ga0070658_100511443 512
160 3300005341 Ga0070691_10000014 Ga0070691_1000001417 512
161 3300005548 Ga0070665_100009304 Ga0070665_1000093045 512
162 3300013105 Ga0157369_10000135 Ga0157369_1000013595 512
163 3300014969 Ga0157376_10152195 Ga0157376_101521952 512
164 3300025909 Ga0207705_10041343 Ga0207705_100413433 512
165 3300028379 Ga0268266_10001032 Ga0268266_1000103229 512
166 3300044842 Ga0466957_0000177 Ga0466957_0000177_4184_5905 512
167 3300046473 Ga0495582_0000013 Ga0495582_0000013_18368_20026 512
168 3300046683 Ga0495658_0000009 Ga0495658_0000009_90356_92014 512
169 3300048911 Ga0496108_0000398 Ga0496108_0000398_32121_34064 512
170 3300048912 Ga0496109_0000285 Ga0496109_0000285_14234_16177 512
171 3300005338 Ga0068868_100000467 Ga0068868_10000046719 513
172 3300025934 Ga0207686_10000063 Ga0207686_1000006321 513
173 3300026023 Ga0207677_10000464 Ga0207677_100004648 513
174 3300028563 Ga0265319_1000266 Ga0265319_100026626 513
175 3300028800 Ga0265338_10001825 Ga0265338_1000182522 513
176 3300046515 Ga0495620_0002330 Ga0495620_0002330_9060_10940 513
177 3300048915 Ga0496112_0000003 Ga0496112_0000003_402509_404242 513
178 3300048917 Ga0496114_0000003 Ga0496114_0000003_99476_101305 513
179 3300048918 Ga0496115_0000071 Ga0496115_0000071_22987_24816 513
180 3300053078 Ga0495612_0010132 Ga0495612_0010132_665_2503 513
181 3300053083 Ga0495655_0000004 Ga0495655_0000004_181307_183085 513
182 3300053129 Ga0500628_000004 Ga0500628_000004_89722_91500 513
183 3300005356 Ga0070674_100000001 Ga0070674_100000001166 514
184 3300005366 Ga0070659_100002304 Ga0070659_1000023047 514
185 3300005457 Ga0070662_100000015 Ga0070662_10000001593 514
186 3300006847 Ga0075431_100029010 Ga0075431_1000290105 514
187 3300009098 Ga0105245_10000667 Ga0105245_1000066724 514
188 3300009177 Ga0105248_10000126 Ga0105248_1000012675 514
189 3300025899 Ga0207642_10000043 Ga0207642_100000436 514
190 3300025926 Ga0207659_10000014 Ga0207659_1000001493 514
191 3300025927 Ga0207687_10000037 Ga0207687_1000003715 514
192 3300025932 Ga0207690_10005636 Ga0207690_100056364 514
193 3300025933 Ga0207706_10000062 Ga0207706_1000006216 514
194 3300025937 Ga0207669_10000002 Ga0207669_10000002183 514
195 3300025941 Ga0207711_10000024 Ga0207711_10000024187 514
196 3300047317 Ga0495604_0000413 Ga0495604_0000413_23982_25805 514
197 3300050510 nmdc:mga06r32_126855_c1 nmdc:mga06r32_126855_c1_25_1818 514
198 3300010375 Ga0105239_10190013 Ga0105239_101900131 515
199 3300017792 Ga0163161_10000018 Ga0163161_1000001897 515
200 3300045976 Ga0466967_0000005 Ga0466967_0000005_56243_58087 515
201 3300046459 Ga0495629_0000055 Ga0495629_0000055_96474_98204 515
202 3300046511 Ga0495608_0000079 Ga0495608_0000079_44538_46226 515
203 3300046675 Ga0495657_0000070 Ga0495657_0000070_44527_46215 515
204 3300046690 Ga0495624_0000012 Ga0495624_0000012_776_2668 515
205 3300046690 Ga0495624_0000258 Ga0495624_0000258_9425_11200 515
206 3300047444 Ga0495675_0000141 Ga0495675_0000141_47176_48864 515
207 3300048912 Ga0496109_0000024 Ga0496109_0000024_100874_102670 515
208 3300053084 Ga0495595_0000004 Ga0495595_0000004_212966_214654 515
209 3300053085 Ga0495619_0000173 Ga0495619_0000173_1305_2993 515
210 3300005618 Ga0068864_100000024 Ga0068864_100000024105 516
211 3300009101 Ga0105247_10000204 Ga0105247_1000020447 516
212 3300026041 Ga0207639_10003793 Ga0207639_100037936 516
213 3300026095 Ga0207676_10000048 Ga0207676_10000048148 516
214 3300046694 Ga0495649_0000587 Ga0495649_0000587_18350_20053 516
215 3300048905 Ga0496102_0000045 Ga0496102_0000045_44134_46044 516
216 3300005841 Ga0068863_100000136 Ga0068863_10000013628 517
217 3300005841 Ga0068863_100005789 Ga0068863_1000057897 517
218 3300026088 Ga0207641_10000265 Ga0207641_1000026536 517
219 3300026088 Ga0207641_10001786 Ga0207641_100017867 517
220 3300046454 Ga0495592_0000600 Ga0495592_0000600_17748_19544 517
221 3300046523 Ga0495644_0000693 Ga0495644_0000693_11378_13222 517
222 3300046689 Ga0495613_0000364 Ga0495613_0000364_7181_9070 517
223 3300046809 Ga0495600_0023432 Ga0495600_0023432_1207_3150 517
224 3300047321 Ga0495676_0005294 Ga0495676_0005294_3198_4976 517
225 3300048903 Ga0496100_0000012 Ga0496100_0000012_44259_46037 517
226 3300048904 Ga0496101_0000010 Ga0496101_0000010_236168_237946 517
227 3300048909 Ga0496106_0000017 Ga0496106_0000017_43971_45749 517
228 3300048910 Ga0496107_0000012 Ga0496107_0000012_135807_137585 517
229 3300048911 Ga0496108_0000001 Ga0496108_0000001_90089_91849 517
230 3300048912 Ga0496109_0000006 Ga0496109_0000006_90089_91849 517
231 3300049569 Ga0501032_0009269 Ga0501032_0009269_3071_5131 517
232 3300049570 Ga0501033_0010646 Ga0501033_0010646_3083_5143 517
233 3300049571 Ga0501034_0052226 Ga0501034_0052226_2024_4084 517
234 3300049572 Ga0501036_0056405 Ga0501036_0056405_35_2095 517
235 3300049574 Ga0501038_0015191 Ga0501038_0015191_1873_3933 517
236 3300049580 Ga0501046_0012350 Ga0501046_0012350_2133_4193 517
237 3300049581 Ga0501047_0015832 Ga0501047_0015832_3071_5131 517
238 3300049586 Ga0501070_0012559 Ga0501070_0012559_2013_4073 517
239 3300049742 Ga0501080_0041795 Ga0501080_0041795_1562_3622 517
240 3300049822 Ga0501035_0014582 Ga0501035_0014582_2104_4164 517
241 3300049823 Ga0501044_0019801 Ga0501044_0019801_3069_5129 517
242 3300005616 Ga0068852_100000005 Ga0068852_100000005160 518
243 3300005981 Ga0081538_10000023 Ga0081538_1000002315 518
244 3300006175 Ga0070712_100013482 Ga0070712_1000134822 518
245 3300009098 Ga0105245_10022100 Ga0105245_100221001 518
246 3300013308 Ga0157375_10028002 Ga0157375_100280022 518
247 3300026142 Ga0207698_10000038 Ga0207698_1000003881 518
248 3300046529 Ga0495652_0000003 Ga0495652_0000003_240338_242191 518
249 3300046663 Ga0495635_0000026 Ga0495635_0000026_97049_98941 518
250 3300048904 Ga0496101_0024421 Ga0496101_0024421_871_2634 518
251 3300048905 Ga0496102_0007753 Ga0496102_0007753_3375_5138 518
252 3300048906 Ga0496103_0002814 Ga0496103_0002814_7458_9221 518
253 3300048909 Ga0496106_0004083 Ga0496106_0004083_1890_3653 518
254 3300048914 Ga0496111_0027268 Ga0496111_0027268_2263_4026 518
255 3300048918 Ga0496115_0022984 Ga0496115_0022984_27_1790 518
256 3300005985 Ga0081539_10002449 Ga0081539_1000244919 519
257 3300006852 Ga0075433_10000968 Ga0075433_100009683 519
258 3300014968 Ga0157379_10011591 Ga0157379_100115918 519
259 3300046455 Ga0495603_0000074 Ga0495603_0000074_38807_40540 519
260 3300046516 Ga0495628_0000965 Ga0495628_0000965_4328_6076 519
261 3300046660 Ga0495625_0000787 Ga0495625_0000787_22872_24728 519
262 3300050515 nmdc:mga0a205_1066_c1 nmdc:mga0a205_1066_c1_9456_11255 519
263 3300053084 Ga0495595_0000167 Ga0495595_0000167_23761_25659 519
264 3300005530 Ga0070679_100000069 Ga0070679_1000000696 520
265 3300005539 Ga0068853_100001637 Ga0068853_1000016379 520
266 3300013296 Ga0157374_10006572 Ga0157374_100065725 520
267 3300025921 Ga0207652_10000142 Ga0207652_1000014276 520
268 3300046455 Ga0495603_0001152 Ga0495603_0001152_13578_15305 520
269 3300046459 Ga0495629_0084694 Ga0495629_0084694_32_1879 520
270 3300046529 Ga0495652_0017506 Ga0495652_0017506_743_2656 520
271 3300048909 Ga0496106_0000174 Ga0496106_0000174_27192_29105 520
272 3300005329 Ga0070683_100004015 Ga0070683_1000040157 521
273 3300005337 Ga0070682_100000077 Ga0070682_10000007739 521
274 3300005548 Ga0070665_100000068 Ga0070665_1000000688 521
275 3300005614 Ga0068856_100079564 Ga0068856_1000795642 521
276 3300005842 Ga0068858_100001203 Ga0068858_10000120322 521
277 3300009176 Ga0105242_10002841 Ga0105242_100028417 521
278 3300025944 Ga0207661_10001063 Ga0207661_100010636 521
279 3300026035 Ga0207703_10000128 Ga0207703_1000012867 521
280 3300026078 Ga0207702_10025507 Ga0207702_100255072 521
281 3300028379 Ga0268266_10000020 Ga0268266_10000020393 521
282 3300046461 Ga0495641_0000020 Ga0495641_0000020_16961_18805 521
283 3300046678 Ga0495599_0014958 Ga0495599_0014958_2377_4293 521
284 3300047322 Ga0495680_0000671 Ga0495680_0000671_24984_26909 521
285 3300049591 Ga0501075_0032777 Ga0501075_0032777_1702_3516 521
286 3300053077 Ga0495601_0000196 Ga0495601_0000196_8010_9770 521
287 3300053078 Ga0495612_0003966 Ga0495612_0003966_3994_5958 521
288 3300009551 Ga0105238_10000172 Ga0105238_1000017232 523
289 3300025924 Ga0207694_10000004 Ga0207694_10000004916 523
290 3300046809 Ga0495600_0046892 Ga0495600_0046892_343_2064 523
291 3300053085 Ga0495619_0004260 Ga0495619_0004260_5103_6824 523
292 3300046681 Ga0495647_0000027 Ga0495647_0000027_56_2074 524
293 3300048907 Ga0496104_0000002 Ga0496104_0000002_433119_435224 525
294 3300048908 Ga0496105_0000001 Ga0496105_0000001_892955_895060 525
295 3300053085 Ga0495619_0000042 Ga0495619_0000042_44494_46359 525
296 3300026089 Ga0207648_10000271 Ga0207648_1000027137 526
297 3300053085 Ga0495619_0000061 Ga0495619_0000061_37543_39294 529
298 3300035398 Ga0316574_0017497 Ga0316574_0017497_824_2719 531
299 3300046476 Ga0495662_0000021 Ga0495662_0000021_24320_26194 531
300 3300001977 JGI24746J21847_1000526 JGI24746J21847_10005262 541

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22608

DNAX_ATPase_lid

DNA polymerase III clamp loader subunit, ATPase lid domain

232

280

0.97

PF13177

DNA_pol3_delta2

DNA polymerase III, delta subunit

69

229

0.96

PF12169

DNA_pol3_gamma3

DNA polymerase III subunits gamma and tau domain III

282

424

0.94

PF20964

DnaX_C

DNA polymerase III subunit tau, C-terminal domain

488

599

0.77

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

90

228

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1njf-assembly4.cif.gz_D nucleotide bound form of an isolated e. coli clamp loader gamma subunit 0.9492 10 247
1njf-assembly4.cif.gz_D nucleotide bound form of an isolated e. coli clamp loader gamma subunit 0.9377 10 247
2chg-assembly3.cif.gz_C replication factor c domains 1 and 2 0.8696 11 246
2chg-assembly3.cif.gz_C replication factor c domains 1 and 2 0.8478 11 246
5oaf-assembly1.cif.gz_A human rvb1/rvb2 heterohexamer in ino80 complex 0.7842 126 245
ID Description Score Start End Superfamily
af_Q54BN3_188_243_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9863 184 231 1.10.8.60
af_F4KEM0_516_577_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9674 188 245 1.10.8.60
af_A0A1D6E842_267_330_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9671 184 246 1.10.8.60
1njfD02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9657 184 247 1.10.8.60
1njfB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9643 184 242 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A0F9C3U1-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.9739 10 166 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
AF-X1IH18-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.9723 6 232 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
GO:0046872
AF-A0A1F2QCS4-F1-model_v4 DNA polymerase III subunit gamma/tau (EC 2.7.7.7) 0.971 7 196 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
AF-A0A3C1SIS5-F1-model_v4 DNA polymerase III subunit gamma/tau (EC 2.7.7.7) 0.97 11 194 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
AF-A0A536EN07-F1-model_v4 DNA polymerase III subunit gamma/tau (EC 2.7.7.7) 0.9683 5 220 GO:0003887
GO:0005524
GO:0006261
GO:0009360
GO:0016887
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.7 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map