F395561
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 207 | 300 | 530 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0000002|Ga0496104_0000002_433119_435224 |
| Length | 614 |
| Sequence | MSSSAAVTAATQAAGVNQLRAQVGTGARYRCGPRWGALGPWIHWPEPLMTESTSLYRRHRPGSFDEVVGQQHVVRTLRNAVEQDKVHHAYLFVGSRGTGKTSMAKILARSLNCERGGSTVTPCGECESCVTIAAGTSVDVIEMDAASNRSVDDVRDLRERVAYAPAGGHWKVYILDEAHMLTKEAWNAFLKTLEEPPPNTVFVLATTEAHKVMATIADRCQRFDFQRPSLEQISEVLTRVAAAESITVDEGATAMIARSASGSFRDALGTLDQLVAFGGDQVTLDSVLEVLGAADAELLFETVDAVAAEDPKAVLLTVEKMARSGRDPAQFARDLLGHLRHLLVTQTTGEVPDTFVVTATDAGRLEAQASSAAAAALVRTIDELASALTAVREGDEARMAVEIALLKAARPDLDPSTEGLLRRIERLEKALSEGGGARGLSQEQGGAAGEGVLDPPAPVPPARDTSQEXXTQDEVVPRGAEEAAATGPAAQNAFDLSEVTRIWPVVLDKLTETAPALAATFEGARPVSLDDDGVKIGFPADKTFNKRKAESPERREALASAFVAVAGQELRPTYVLLDEESAEAEPADEPAPGAADHSDLVARLKSEFNAEEVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 165 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 176 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 177 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 178 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 179 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 196 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 204 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 205 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 206 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2 |
| Nodule | 0 |
| Rhizoplane | 11.67 |
| Rhizosphere | 84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000526 | 3300001977 | Bacteria | 5738 |
| 2 | JGI24034J26672_10000495 | 3300002239 | Bacteria | 5101 |
| 3 | JGI25404J52841_10001038 | 3300003659 | Bacteria | 4611 |
| 4 | Ga0070658_10051144 | 3300005327 | Bacteria | 3349 |
| 5 | Ga0070683_100002626 | 3300005329 | Bacteria | 14369 |
| 6 | Ga0070683_100004015 | 3300005329 | Bacteria | 12046 |
| 7 | Ga0070683_100012670 | 3300005329 | Bacteria | 7332 |
| 8 | Ga0070683_100029359 | 3300005329 | Bacteria | 4978 |
| 9 | Ga0070677_10000013 | 3300005333 | Bacteria | 53677 |
| 10 | Ga0070682_100000077 | 3300005337 | Bacteria | 89055 |
| 11 | Ga0070682_100001328 | 3300005337 | Bacteria | 13995 |
| 12 | Ga0068868_100000467 | 3300005338 | Bacteria | 26933 |
| 13 | Ga0068868_100005792 | 3300005338 | Bacteria | 8707 |
| 14 | Ga0070691_10000014 | 3300005341 | Bacteria | 50487 |
| 15 | Ga0070691_10000822 | 3300005341 | Bacteria | 12463 |
| 16 | Ga0070661_100000116 | 3300005344 | Bacteria | 66712 |
| 17 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 18 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 19 | Ga0070674_100000103 | 3300005356 | Bacteria | 39432 |
| 20 | Ga0070673_100004180 | 3300005364 | Bacteria | 9107 |
| 21 | Ga0070659_100002304 | 3300005366 | Bacteria | 13596 |
| 22 | Ga0070667_100001780 | 3300005367 | Bacteria | 19195 |
| 23 | Ga0070667_100112444 | 3300005367 | Bacteria | 2362 |
| 24 | Ga0070713_100000143 | 3300005436 | Bacteria | 47475 |
| 25 | Ga0070711_100014403 | 3300005439 | Bacteria | 4984 |
| 26 | Ga0070663_100000274 | 3300005455 | Bacteria | 25997 |
| 27 | Ga0070662_100000015 | 3300005457 | Bacteria | 109379 |
| 28 | Ga0070679_100000069 | 3300005530 | Bacteria | 76557 |
| 29 | Ga0070679_100021167 | 3300005530 | Bacteria | 6345 |
| 30 | Ga0068853_100001637 | 3300005539 | Bacteria | 16375 |
| 31 | Ga0068853_100119792 | 3300005539 | Bacteria | 2346 |
| 32 | Ga0070672_100000175 | 3300005543 | Bacteria | 35613 |
| 33 | Ga0070686_100021025 | 3300005544 | Bacteria | 3872 |
| 34 | Ga0070665_100000068 | 3300005548 | Bacteria | 204531 |
| 35 | Ga0070665_100009304 | 3300005548 | Bacteria | 9944 |
| 36 | Ga0070665_100118932 | 3300005548 | Bacteria | 2645 |
| 37 | Ga0070704_100071171 | 3300005549 | Bacteria | 2526 |
| 38 | Ga0068854_100000472 | 3300005578 | Bacteria | 24819 |
| 39 | Ga0068856_100000210 | 3300005614 | Bacteria | 63036 |
| 40 | Ga0068856_100079564 | 3300005614 | Bacteria | 3250 |
| 41 | Ga0068852_100000005 | 3300005616 | Bacteria | 173127 |
| 42 | Ga0068864_100000024 | 3300005618 | Bacteria | 252632 |
| 43 | Ga0068866_10000014 | 3300005718 | Bacteria | 72482 |
| 44 | Ga0068863_100000136 | 3300005841 | Bacteria | 78102 |
| 45 | Ga0068863_100005789 | 3300005841 | Bacteria | 12118 |
| 46 | Ga0068858_100000088 | 3300005842 | Bacteria | 95138 |
| 47 | Ga0068858_100001203 | 3300005842 | Bacteria | 26823 |
| 48 | Ga0068858_100102208 | 3300005842 | Bacteria | 2674 |
| 49 | Ga0081455_10004899 | 3300005937 | Bacteria | 14838 |
| 50 | Ga0081455_10048950 | 3300005937 | Bacteria | 3647 |
| 51 | Ga0081538_10000023 | 3300005981 | Bacteria | 131101 |
| 52 | Ga0081538_10004025 | 3300005981 | Bacteria | 13675 |
| 53 | Ga0081540_1000296 | 3300005983 | Bacteria | 51895 |
| 54 | Ga0081539_10002449 | 3300005985 | Bacteria | 26184 |
| 55 | Ga0075365_10000503 | 3300006038 | Bacteria | 14878 |
| 56 | Ga0075364_10011279 | 3300006051 | Bacteria | 5427 |
| 57 | Ga0070715_10000011 | 3300006163 | Bacteria | 183857 |
| 58 | Ga0070712_100005453 | 3300006175 | Bacteria | 7879 |
| 59 | Ga0070712_100013482 | 3300006175 | Bacteria | 5224 |
| 60 | Ga0075431_100029010 | 3300006847 | Bacteria | 5691 |
| 61 | Ga0075433_10000057 | 3300006852 | Bacteria | 48581 |
| 62 | Ga0075433_10000968 | 3300006852 | Bacteria | 20370 |
| 63 | Ga0075433_10109915 | 3300006852 | Bacteria | 2445 |
| 64 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 65 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 66 | Ga0105245_10000667 | 3300009098 | Bacteria | 31104 |
| 67 | Ga0105245_10022100 | 3300009098 | Bacteria | 5585 |
| 68 | Ga0105245_10030985 | 3300009098 | Bacteria | 4731 |
| 69 | Ga0105247_10000204 | 3300009101 | Bacteria | 58153 |
| 70 | Ga0105242_10002841 | 3300009176 | Bacteria | 13567 |
| 71 | Ga0105248_10000126 | 3300009177 | Bacteria | 88461 |
| 72 | Ga0105238_10000172 | 3300009551 | Bacteria | 70799 |
| 73 | Ga0105249_10009671 | 3300009553 | Bacteria | 8447 |
| 74 | Ga0105239_10190013 | 3300010375 | Bacteria | 2299 |
| 75 | Ga0157369_10000135 | 3300013105 | Bacteria | 105364 |
| 76 | Ga0157374_10006572 | 3300013296 | Bacteria | 9872 |
| 77 | Ga0157378_10039519 | 3300013297 | Bacteria | 4185 |
| 78 | Ga0157372_10000394 | 3300013307 | Bacteria | 48255 |
| 79 | Ga0157375_10000416 | 3300013308 | Bacteria | 38766 |
| 80 | Ga0157375_10028002 | 3300013308 | Bacteria | 5275 |
| 81 | Ga0157379_10011591 | 3300014968 | Bacteria | 7698 |
| 82 | Ga0157379_10043127 | 3300014968 | Bacteria | 4027 |
| 83 | Ga0157376_10152195 | 3300014969 | Bacteria | 2087 |
| 84 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 85 | Ga0207656_10000105 | 3300025321 | Bacteria | 31356 |
| 86 | Ga0207682_10000038 | 3300025893 | Bacteria | 53885 |
| 87 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 88 | Ga0207642_10000043 | 3300025899 | Bacteria | 35963 |
| 89 | Ga0207642_10014005 | 3300025899 | Bacteria | 2945 |
| 90 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 91 | Ga0207705_10041343 | 3300025909 | Bacteria | 3308 |
| 92 | Ga0207707_10025210 | 3300025912 | Bacteria | 5202 |
| 93 | Ga0207671_10092199 | 3300025914 | Bacteria | 2284 |
| 94 | Ga0207693_10007793 | 3300025915 | Bacteria | 8787 |
| 95 | Ga0207693_10070346 | 3300025915 | Bacteria | 2738 |
| 96 | Ga0207663_10011747 | 3300025916 | Bacteria | 4712 |
| 97 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 98 | Ga0207652_10000142 | 3300025921 | Bacteria | 76696 |
| 99 | Ga0207652_10001090 | 3300025921 | Bacteria | 24590 |
| 100 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 101 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 102 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 103 | Ga0207687_10000037 | 3300025927 | Bacteria | 120493 |
| 104 | Ga0207687_10000133 | 3300025927 | Bacteria | 49874 |
| 105 | Ga0207700_10000008 | 3300025928 | Bacteria | 341717 |
| 106 | Ga0207690_10005636 | 3300025932 | Bacteria | 7399 |
| 107 | Ga0207706_10000062 | 3300025933 | Bacteria | 109344 |
| 108 | Ga0207686_10000063 | 3300025934 | Bacteria | 96427 |
| 109 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 110 | Ga0207669_10000115 | 3300025937 | Bacteria | 40041 |
| 111 | Ga0207669_10084131 | 3300025937 | Bacteria | 2049 |
| 112 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 113 | Ga0207691_10000609 | 3300025940 | Bacteria | 35618 |
| 114 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 115 | Ga0207661_10001063 | 3300025944 | Bacteria | 18265 |
| 116 | Ga0207661_10002334 | 3300025944 | Bacteria | 13072 |
| 117 | Ga0207679_10025338 | 3300025945 | Bacteria | 4077 |
| 118 | Ga0207651_10001295 | 3300025960 | Bacteria | 11260 |
| 119 | Ga0207712_10005720 | 3300025961 | Bacteria | 7837 |
| 120 | Ga0207640_10000125 | 3300025981 | Bacteria | 58750 |
| 121 | Ga0207640_10052356 | 3300025981 | Bacteria | 2659 |
| 122 | Ga0207658_10008706 | 3300025986 | Bacteria | 6895 |
| 123 | Ga0207677_10000464 | 3300026023 | Bacteria | 27017 |
| 124 | Ga0207703_10000128 | 3300026035 | Bacteria | 91359 |
| 125 | Ga0207703_10000237 | 3300026035 | Bacteria | 62874 |
| 126 | Ga0207703_10015703 | 3300026035 | Bacteria | 5907 |
| 127 | Ga0207639_10003793 | 3300026041 | Bacteria | 10171 |
| 128 | Ga0207639_10080890 | 3300026041 | Bacteria | 2572 |
| 129 | Ga0207678_10014869 | 3300026067 | Bacteria | 6845 |
| 130 | Ga0207708_10025412 | 3300026075 | Bacteria | 4480 |
| 131 | Ga0207708_10073034 | 3300026075 | Bacteria | 2629 |
| 132 | Ga0207702_10025507 | 3300026078 | Bacteria | 4906 |
| 133 | Ga0207702_10053419 | 3300026078 | Bacteria | 3420 |
| 134 | Ga0207641_10000265 | 3300026088 | Bacteria | 66346 |
| 135 | Ga0207641_10001786 | 3300026088 | Bacteria | 20709 |
| 136 | Ga0207648_10000271 | 3300026089 | Bacteria | 56175 |
| 137 | Ga0207648_10084442 | 3300026089 | Bacteria | 2770 |
| 138 | Ga0207676_10000048 | 3300026095 | Bacteria | 147853 |
| 139 | Ga0207676_10113523 | 3300026095 | Bacteria | 2271 |
| 140 | Ga0207675_100037607 | 3300026118 | Bacteria | 4514 |
| 141 | Ga0207683_10049298 | 3300026121 | Bacteria | 3687 |
| 142 | Ga0207698_10000038 | 3300026142 | Bacteria | 101918 |
| 143 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 144 | Ga0268266_10000313 | 3300028379 | Bacteria | 76938 |
| 145 | Ga0268266_10001032 | 3300028379 | Bacteria | 35051 |
| 146 | Ga0268264_10013507 | 3300028381 | Bacteria | 6725 |
| 147 | Ga0265337_1000126 | 3300028556 | Bacteria | 38633 |
| 148 | Ga0265326_10000144 | 3300028558 | Bacteria | 37151 |
| 149 | Ga0265319_1000266 | 3300028563 | Bacteria | 39456 |
| 150 | Ga0265322_10000009 | 3300028654 | Bacteria | 170768 |
| 151 | Ga0265336_10001523 | 3300028666 | Bacteria | 10447 |
| 152 | Ga0265338_10001825 | 3300028800 | Bacteria | 33381 |
| 153 | Ga0265324_10001496 | 3300029957 | Bacteria | 13252 |
| 154 | Ga0265320_10000024 | 3300031240 | Bacteria | 170768 |
| 155 | Ga0265327_10000649 | 3300031251 | Bacteria | 56238 |
| 156 | Ga0265316_10018722 | 3300031344 | Bacteria | 5946 |
| 157 | Ga0265314_10000570 | 3300031711 | Bacteria | 46890 |
| 158 | Ga0316574_0017497 | 3300035398 | Bacteria | 4197 |
| 159 | Ga0395900_0047454 | 3300037418 | Bacteria | 4422 |
| 160 | Ga0395898_0018653 | 3300037466 | Bacteria | 7072 |
| 161 | Ga0395905_0036867 | 3300037471 | Bacteria | 4592 |
| 162 | Ga0466957_0000177 | 3300044842 | Bacteria | 28545 |
| 163 | Ga0466959_0006346 | 3300045049 | Bacteria | 8181 |
| 164 | Ga0466967_0000005 | 3300045976 | Bacteria | 149543 |
| 165 | Ga0495592_0000600 | 3300046454 | Bacteria | 25385 |
| 166 | Ga0495603_0000074 | 3300046455 | Bacteria | 43833 |
| 167 | Ga0495603_0001152 | 3300046455 | Bacteria | 15404 |
| 168 | Ga0495629_0000055 | 3300046459 | Bacteria | 105268 |
| 169 | Ga0495629_0084694 | 3300046459 | Bacteria | 2212 |
| 170 | Ga0495638_0008356 | 3300046460 | Bacteria | 7342 |
| 171 | Ga0495641_0000020 | 3300046461 | Bacteria | 115404 |
| 172 | Ga0495650_0000188 | 3300046471 | Bacteria | 134775 |
| 173 | Ga0495582_0000013 | 3300046473 | Bacteria | 110372 |
| 174 | Ga0495662_0000021 | 3300046476 | Bacteria | 54969 |
| 175 | Ga0495594_0000007 | 3300046499 | Bacteria | 160047 |
| 176 | Ga0495606_0000057 | 3300046507 | Bacteria | 197956 |
| 177 | Ga0495608_0000079 | 3300046511 | Bacteria | 71469 |
| 178 | Ga0495620_0002330 | 3300046515 | Bacteria | 11010 |
| 179 | Ga0495628_0000965 | 3300046516 | Bacteria | 26318 |
| 180 | Ga0495630_0000011 | 3300046517 | Bacteria | 232063 |
| 181 | Ga0495644_0000693 | 3300046523 | Bacteria | 13956 |
| 182 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 183 | Ga0495652_0017506 | 3300046529 | Bacteria | 6394 |
| 184 | Ga0495645_0002818 | 3300046543 | Bacteria | 11795 |
| 185 | Ga0495622_0000270 | 3300046557 | Bacteria | 39432 |
| 186 | Ga0495667_0000022 | 3300046559 | Bacteria | 176919 |
| 187 | Ga0495656_0000196 | 3300046615 | Bacteria | 21672 |
| 188 | Ga0495634_0000437 | 3300046642 | Bacteria | 41521 |
| 189 | Ga0495634_0000601 | 3300046642 | Bacteria | 34818 |
| 190 | Ga0495625_0000787 | 3300046660 | Bacteria | 43981 |
| 191 | Ga0495635_0000026 | 3300046663 | Bacteria | 142517 |
| 192 | Ga0495588_0001678 | 3300046674 | Bacteria | 9433 |
| 193 | Ga0495657_0000070 | 3300046675 | Bacteria | 92382 |
| 194 | Ga0495599_0014958 | 3300046678 | Bacteria | 4809 |
| 195 | Ga0495647_0000027 | 3300046681 | Bacteria | 58315 |
| 196 | Ga0495658_0000009 | 3300046683 | Bacteria | 110421 |
| 197 | Ga0495669_0000083 | 3300046684 | Bacteria | 62876 |
| 198 | Ga0495669_0000823 | 3300046684 | Bacteria | 13221 |
| 199 | Ga0495613_0000187 | 3300046689 | Bacteria | 60818 |
| 200 | Ga0495613_0000364 | 3300046689 | Bacteria | 39475 |
| 201 | Ga0495624_0000012 | 3300046690 | Bacteria | 124128 |
| 202 | Ga0495624_0000258 | 3300046690 | Bacteria | 41999 |
| 203 | Ga0495670_0041971 | 3300046691 | Bacteria | 2283 |
| 204 | Ga0495649_0000587 | 3300046694 | Bacteria | 30555 |
| 205 | Ga0495600_0023432 | 3300046809 | Bacteria | 3972 |
| 206 | Ga0495600_0037762 | 3300046809 | Bacteria | 3141 |
| 207 | Ga0495600_0046892 | 3300046809 | Bacteria | 2819 |
| 208 | Ga0495604_0000413 | 3300047317 | Bacteria | 38567 |
| 209 | Ga0495604_0000416 | 3300047317 | Bacteria | 38302 |
| 210 | Ga0495674_0001198 | 3300047319 | Bacteria | 25096 |
| 211 | Ga0495676_0005294 | 3300047321 | Bacteria | 11811 |
| 212 | Ga0495676_0010588 | 3300047321 | Bacteria | 8354 |
| 213 | Ga0495680_0000407 | 3300047322 | Bacteria | 48143 |
| 214 | Ga0495680_0000671 | 3300047322 | Bacteria | 38307 |
| 215 | Ga0495675_0000141 | 3300047444 | Bacteria | 50168 |
| 216 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 217 | Ga0496100_0000012 | 3300048903 | Bacteria | 182426 |
| 218 | Ga0496101_0000010 | 3300048904 | Bacteria | 281990 |
| 219 | Ga0496101_0024421 | 3300048904 | Bacteria | 4183 |
| 220 | Ga0496101_0087537 | 3300048904 | Bacteria | 2312 |
| 221 | Ga0496102_0000045 | 3300048905 | Bacteria | 186726 |
| 222 | Ga0496102_0007753 | 3300048905 | Bacteria | 9173 |
| 223 | Ga0496103_0000050 | 3300048906 | Bacteria | 152034 |
| 224 | Ga0496103_0002814 | 3300048906 | Bacteria | 10826 |
| 225 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 226 | Ga0496104_0000013 | 3300048907 | Bacteria | 397163 |
| 227 | Ga0496104_0003587 | 3300048907 | Bacteria | 13403 |
| 228 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 229 | Ga0496105_0000006 | 3300048908 | Bacteria | 393578 |
| 230 | Ga0496106_0000017 | 3300048909 | Bacteria | 181561 |
| 231 | Ga0496106_0000174 | 3300048909 | Bacteria | 46312 |
| 232 | Ga0496106_0004083 | 3300048909 | Bacteria | 10890 |
| 233 | Ga0496107_0000012 | 3300048910 | Bacteria | 181629 |
| 234 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 235 | Ga0496108_0000398 | 3300048911 | Bacteria | 35931 |
| 236 | Ga0496108_0101189 | 3300048911 | Bacteria | 2458 |
| 237 | Ga0496109_0000006 | 3300048912 | Bacteria | 325513 |
| 238 | Ga0496109_0000024 | 3300048912 | Bacteria | 174723 |
| 239 | Ga0496109_0000248 | 3300048912 | Bacteria | 51780 |
| 240 | Ga0496109_0000285 | 3300048912 | Bacteria | 48300 |
| 241 | Ga0496109_0012386 | 3300048912 | Bacteria | 7364 |
| 242 | Ga0496109_0108942 | 3300048912 | Bacteria | 2575 |
| 243 | Ga0496110_0018392 | 3300048913 | Bacteria | 5859 |
| 244 | Ga0496111_0027268 | 3300048914 | Bacteria | 4039 |
| 245 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 246 | Ga0496112_0001779 | 3300048915 | Bacteria | 16928 |
| 247 | Ga0496113_0000080 | 3300048916 | Bacteria | 42084 |
| 248 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 249 | Ga0496115_0000071 | 3300048918 | Bacteria | 91922 |
| 250 | Ga0496115_0000263 | 3300048918 | Bacteria | 46550 |
| 251 | Ga0496115_0022984 | 3300048918 | Bacteria | 4835 |
| 252 | Ga0496116_0000423 | 3300048919 | Bacteria | 59658 |
| 253 | Ga0496117_0001719 | 3300048920 | Bacteria | 30306 |
| 254 | Ga0496118_0001802 | 3300048921 | Bacteria | 30879 |
| 255 | Ga0496118_0054372 | 3300048921 | Bacteria | 3033 |
| 256 | Ga0496119_0007488 | 3300048922 | Bacteria | 9814 |
| 257 | Ga0496121_0004385 | 3300048924 | Bacteria | 19053 |
| 258 | Ga0496121_0043713 | 3300048924 | Bacteria | 3875 |
| 259 | Ga0501032_0009269 | 3300049569 | Bacteria | 7133 |
| 260 | Ga0501033_0010646 | 3300049570 | Bacteria | 7053 |
| 261 | Ga0501034_0052226 | 3300049571 | Bacteria | 4118 |
| 262 | Ga0501036_0056405 | 3300049572 | Bacteria | 3328 |
| 263 | Ga0501038_0015191 | 3300049574 | Bacteria | 7003 |
| 264 | Ga0501042_0033618 | 3300049578 | Bacteria | 3635 |
| 265 | Ga0501046_0012350 | 3300049580 | Bacteria | 7274 |
| 266 | Ga0501047_0013985 | 3300049581 | Bacteria | 7626 |
| 267 | Ga0501047_0015832 | 3300049581 | Bacteria | 7184 |
| 268 | Ga0501070_0012559 | 3300049586 | Bacteria | 7143 |
| 269 | Ga0501070_0018096 | 3300049586 | Bacteria | 5911 |
| 270 | Ga0501075_0032777 | 3300049591 | Bacteria | 3862 |
| 271 | Ga0501076_0030147 | 3300049592 | Bacteria | 4225 |
| 272 | Ga0501079_0031124 | 3300049741 | Bacteria | 4100 |
| 273 | Ga0501079_0066406 | 3300049741 | Bacteria | 2783 |
| 274 | Ga0501080_0041795 | 3300049742 | Bacteria | 4270 |
| 275 | Ga0501035_0014582 | 3300049822 | Bacteria | 7253 |
| 276 | Ga0501044_0019801 | 3300049823 | Bacteria | 7189 |
| 277 | nmdc:mga0yw44_13891_c1 | 3300050492 | Bacteria | 4256 |
| 278 | nmdc:mga06r32_126855_c1 | 3300050510 | Bacteria | 2521 |
| 279 | nmdc:mga0a205_1066_c1 | 3300050515 | Bacteria | 22781 |
| 280 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 281 | Ga0495601_0000031 | 3300053077 | Bacteria | 105493 |
| 282 | Ga0495601_0000196 | 3300053077 | Bacteria | 32072 |
| 283 | Ga0495612_0003966 | 3300053078 | Bacteria | 6146 |
| 284 | Ga0495612_0010132 | 3300053078 | Bacteria | 3812 |
| 285 | Ga0495612_0019089 | 3300053078 | Bacteria | 2746 |
| 286 | Ga0495655_0000004 | 3300053083 | Bacteria | 293683 |
| 287 | Ga0495595_0000004 | 3300053084 | Bacteria | 260821 |
| 288 | Ga0495595_0000167 | 3300053084 | Bacteria | 25731 |
| 289 | Ga0495595_0010800 | 3300053084 | Bacteria | 3805 |
| 290 | Ga0495619_0000042 | 3300053085 | Bacteria | 112453 |
| 291 | Ga0495619_0000061 | 3300053085 | Bacteria | 88943 |
| 292 | Ga0495619_0000098 | 3300053085 | Bacteria | 64979 |
| 293 | Ga0495619_0000173 | 3300053085 | Bacteria | 47525 |
| 294 | Ga0495619_0004260 | 3300053085 | Bacteria | 9118 |
| 295 | Ga0495619_0013246 | 3300053085 | Bacteria | 5198 |
| 296 | Ga0500566_0065932 | 3300053094 | Bacteria | 2041 |
| 297 | Ga0500641_0005892 | 3300053096 | Bacteria | 4339 |
| 298 | Ga0500628_000004 | 3300053129 | Bacteria | 202098 |
| 299 | Ga0501084_0032308 | 3300054114 | Bacteria | 4378 |
| 300 | Ga0530510_0001298 | 3300061734 | Bacteria | 16705 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100037607 | Ga0207675_1000376074 | 469 |
| 2 | 3300049592 | Ga0501076_0030147 | Ga0501076_0030147_923_2590 | 469 |
| 3 | 3300049741 | Ga0501079_0031124 | Ga0501079_0031124_554_2221 | 469 |
| 4 | 3300054114 | Ga0501084_0032308 | Ga0501084_0032308_182_1849 | 469 |
| 5 | 3300061734 | Ga0530510_0001298 | Ga0530510_0001298_2840_4507 | 469 |
| 6 | 3300005341 | Ga0070691_10000822 | Ga0070691_1000082210 | 477 |
| 7 | 3300045049 | Ga0466959_0006346 | Ga0466959_0006346_1882_3495 | 477 |
| 8 | 3300037418 | Ga0395900_0047454 | Ga0395900_0047454_92_1807 | 478 |
| 9 | 3300037466 | Ga0395898_0018653 | Ga0395898_0018653_5163_6878 | 478 |
| 10 | 3300037471 | Ga0395905_0036867 | Ga0395905_0036867_1392_3107 | 478 |
| 11 | 3300026075 | Ga0207708_10073034 | Ga0207708_100730342 | 485 |
| 12 | 3300005333 | Ga0070677_10000013 | Ga0070677_1000001346 | 486 |
| 13 | 3300025893 | Ga0207682_10000038 | Ga0207682_1000003846 | 486 |
| 14 | 3300046615 | Ga0495656_0000196 | Ga0495656_0000196_12230_13993 | 486 |
| 15 | 3300048912 | Ga0496109_0108942 | Ga0496109_0108942_14_1861 | 486 |
| 16 | 3300002239 | JGI24034J26672_10000495 | JGI24034J26672_100004953 | 488 |
| 17 | 3300005338 | Ga0068868_100005792 | Ga0068868_1000057922 | 489 |
| 18 | 3300046471 | Ga0495650_0000188 | Ga0495650_0000188_111981_113816 | 489 |
| 19 | 3300006852 | Ga0075433_10000057 | Ga0075433_1000005726 | 490 |
| 20 | 3300048920 | Ga0496117_0001719 | Ga0496117_0001719_28373_30154 | 490 |
| 21 | 3300048921 | Ga0496118_0001802 | Ga0496118_0001802_8699_10480 | 490 |
| 22 | 3300048924 | Ga0496121_0043713 | Ga0496121_0043713_43_1854 | 490 |
| 23 | 3300003659 | JGI25404J52841_10001038 | JGI25404J52841_100010384 | 491 |
| 24 | 3300005983 | Ga0081540_1000296 | Ga0081540_100029620 | 491 |
| 25 | 3300049741 | Ga0501079_0066406 | Ga0501079_0066406_486_2333 | 491 |
| 26 | 3300025915 | Ga0207693_10070346 | Ga0207693_100703463 | 492 |
| 27 | 3300005544 | Ga0070686_100021025 | Ga0070686_1000210254 | 494 |
| 28 | 3300005937 | Ga0081455_10048950 | Ga0081455_100489504 | 494 |
| 29 | 3300006038 | Ga0075365_10000503 | Ga0075365_1000050315 | 494 |
| 30 | 3300025981 | Ga0207640_10052356 | Ga0207640_100523561 | 494 |
| 31 | 3300026075 | Ga0207708_10025412 | Ga0207708_100254121 | 494 |
| 32 | 3300026089 | Ga0207648_10084442 | Ga0207648_100844422 | 494 |
| 33 | 3300026095 | Ga0207676_10113523 | Ga0207676_101135231 | 494 |
| 34 | 3300026121 | Ga0207683_10049298 | Ga0207683_100492984 | 494 |
| 35 | 3300048911 | Ga0496108_0101189 | Ga0496108_0101189_67_1938 | 494 |
| 36 | 3300048912 | Ga0496109_0012386 | Ga0496109_0012386_5195_7066 | 494 |
| 37 | 3300050492 | nmdc:mga0yw44_13891_c1 | nmdc:mga0yw44_13891_c1_1243_2946 | 494 |
| 38 | 3300005344 | Ga0070661_100000116 | Ga0070661_10000011616 | 495 |
| 39 | 3300005356 | Ga0070674_100000103 | Ga0070674_10000010313 | 495 |
| 40 | 3300005718 | Ga0068866_10000014 | Ga0068866_1000001467 | 495 |
| 41 | 3300006852 | Ga0075433_10109915 | Ga0075433_101099152 | 495 |
| 42 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001747 | 495 |
| 43 | 3300025914 | Ga0207671_10092199 | Ga0207671_100921992 | 495 |
| 44 | 3300025920 | Ga0207649_10000005 | Ga0207649_10000005132 | 495 |
| 45 | 3300025937 | Ga0207669_10000115 | Ga0207669_1000011529 | 495 |
| 46 | 3300046543 | Ga0495645_0002818 | Ga0495645_0002818_5039_6757 | 495 |
| 47 | 3300046642 | Ga0495634_0000601 | Ga0495634_0000601_32336_34084 | 495 |
| 48 | 3300049578 | Ga0501042_0033618 | Ga0501042_0033618_1072_2874 | 495 |
| 49 | 3300006051 | Ga0075364_10011279 | Ga0075364_100112793 | 496 |
| 50 | 3300013297 | Ga0157378_10039519 | Ga0157378_100395193 | 496 |
| 51 | 3300047319 | Ga0495674_0001198 | Ga0495674_0001198_7234_9012 | 496 |
| 52 | 3300005439 | Ga0070711_100014403 | Ga0070711_1000144033 | 497 |
| 53 | 3300005842 | Ga0068858_100000088 | Ga0068858_10000008877 | 497 |
| 54 | 3300025916 | Ga0207663_10011747 | Ga0207663_100117474 | 497 |
| 55 | 3300026035 | Ga0207703_10000237 | Ga0207703_1000023730 | 497 |
| 56 | 3300009098 | Ga0105245_10030985 | Ga0105245_100309852 | 498 |
| 57 | 3300005329 | Ga0070683_100029359 | Ga0070683_1000293593 | 499 |
| 58 | 3300005455 | Ga0070663_100000274 | Ga0070663_10000027410 | 499 |
| 59 | 3300005530 | Ga0070679_100021167 | Ga0070679_1000211673 | 499 |
| 60 | 3300025912 | Ga0207707_10025210 | Ga0207707_100252103 | 499 |
| 61 | 3300025921 | Ga0207652_10001090 | Ga0207652_1000109014 | 499 |
| 62 | 3300026067 | Ga0207678_10014869 | Ga0207678_100148694 | 499 |
| 63 | 3300048907 | Ga0496104_0003587 | Ga0496104_0003587_8187_9968 | 499 |
| 64 | 3300048919 | Ga0496116_0000423 | Ga0496116_0000423_9106_10968 | 499 |
| 65 | 3300048921 | Ga0496118_0054372 | Ga0496118_0054372_614_2476 | 499 |
| 66 | 3300048922 | Ga0496119_0007488 | Ga0496119_0007488_7449_9311 | 499 |
| 67 | 3300048924 | Ga0496121_0004385 | Ga0496121_0004385_61_1842 | 499 |
| 68 | 3300006881 | Ga0068865_100000019 | Ga0068865_10000001981 | 500 |
| 69 | 3300025938 | Ga0207704_10000009 | Ga0207704_1000000910 | 500 |
| 70 | 3300046691 | Ga0495670_0041971 | Ga0495670_0041971_43_1830 | 501 |
| 71 | 3300005539 | Ga0068853_100119792 | Ga0068853_1001197922 | 502 |
| 72 | 3300005937 | Ga0081455_10004899 | Ga0081455_1000489916 | 502 |
| 73 | 3300013307 | Ga0157372_10000394 | Ga0157372_1000039442 | 502 |
| 74 | 3300014968 | Ga0157379_10043127 | Ga0157379_100431273 | 502 |
| 75 | 3300026041 | Ga0207639_10080890 | Ga0207639_100808902 | 502 |
| 76 | 3300046507 | Ga0495606_0000057 | Ga0495606_0000057_148095_149879 | 502 |
| 77 | 3300046517 | Ga0495630_0000011 | Ga0495630_0000011_91688_93391 | 502 |
| 78 | 3300048088 | Ga0495602_0000009 | Ga0495602_0000009_118510_120111 | 502 |
| 79 | 3300025899 | Ga0207642_10014005 | Ga0207642_100140053 | 503 |
| 80 | 3300028556 | Ga0265337_1000126 | Ga0265337_100012628 | 503 |
| 81 | 3300028558 | Ga0265326_10000144 | Ga0265326_1000014412 | 503 |
| 82 | 3300028654 | Ga0265322_10000009 | Ga0265322_1000000954 | 503 |
| 83 | 3300028666 | Ga0265336_10001523 | Ga0265336_100015237 | 503 |
| 84 | 3300029957 | Ga0265324_10001496 | Ga0265324_1000149612 | 503 |
| 85 | 3300031240 | Ga0265320_10000024 | Ga0265320_10000024121 | 503 |
| 86 | 3300031251 | Ga0265327_10000649 | Ga0265327_1000064954 | 503 |
| 87 | 3300031344 | Ga0265316_10018722 | Ga0265316_100187225 | 503 |
| 88 | 3300031711 | Ga0265314_10000570 | Ga0265314_1000057013 | 503 |
| 89 | 3300046642 | Ga0495634_0000437 | Ga0495634_0000437_13121_14821 | 503 |
| 90 | 3300005436 | Ga0070713_100000143 | Ga0070713_10000014330 | 504 |
| 91 | 3300006175 | Ga0070712_100005453 | Ga0070712_1000054535 | 504 |
| 92 | 3300025915 | Ga0207693_10007793 | Ga0207693_100077934 | 504 |
| 93 | 3300025927 | Ga0207687_10000133 | Ga0207687_1000013331 | 504 |
| 94 | 3300025928 | Ga0207700_10000008 | Ga0207700_1000000822 | 504 |
| 95 | 3300046674 | Ga0495588_0001678 | Ga0495588_0001678_4868_6601 | 504 |
| 96 | 3300005367 | Ga0070667_100001780 | Ga0070667_10000178013 | 505 |
| 97 | 3300005548 | Ga0070665_100118932 | Ga0070665_1001189322 | 505 |
| 98 | 3300005578 | Ga0068854_100000472 | Ga0068854_1000004727 | 505 |
| 99 | 3300005981 | Ga0081538_10004025 | Ga0081538_100040254 | 505 |
| 100 | 3300009098 | Ga0105245_10000012 | Ga0105245_1000001245 | 505 |
| 101 | 3300009553 | Ga0105249_10009671 | Ga0105249_100096712 | 505 |
| 102 | 3300025927 | Ga0207687_10000011 | Ga0207687_1000001198 | 505 |
| 103 | 3300025961 | Ga0207712_10005720 | Ga0207712_100057202 | 505 |
| 104 | 3300025981 | Ga0207640_10000125 | Ga0207640_1000012521 | 505 |
| 105 | 3300025986 | Ga0207658_10008706 | Ga0207658_100087062 | 505 |
| 106 | 3300046689 | Ga0495613_0000187 | Ga0495613_0000187_35479_37182 | 505 |
| 107 | 3300005329 | Ga0070683_100012670 | Ga0070683_1000126707 | 507 |
| 108 | 3300005367 | Ga0070667_100112444 | Ga0070667_1001124441 | 507 |
| 109 | 3300005614 | Ga0068856_100000210 | Ga0068856_10000021024 | 507 |
| 110 | 3300025944 | Ga0207661_10002334 | Ga0207661_1000233410 | 507 |
| 111 | 3300025945 | Ga0207679_10025338 | Ga0207679_100253383 | 507 |
| 112 | 3300026078 | Ga0207702_10053419 | Ga0207702_100534192 | 507 |
| 113 | 3300028379 | Ga0268266_10000313 | Ga0268266_1000031365 | 507 |
| 114 | 3300028381 | Ga0268264_10013507 | Ga0268264_100135074 | 507 |
| 115 | 3300046557 | Ga0495622_0000270 | Ga0495622_0000270_34649_36304 | 507 |
| 116 | 3300046809 | Ga0495600_0037762 | Ga0495600_0037762_1240_2925 | 507 |
| 117 | 3300048907 | Ga0496104_0000013 | Ga0496104_0000013_53875_55755 | 507 |
| 118 | 3300048908 | Ga0496105_0000006 | Ga0496105_0000006_341409_343289 | 507 |
| 119 | 3300048918 | Ga0496115_0000263 | Ga0496115_0000263_20848_22557 | 507 |
| 120 | 3300049581 | Ga0501047_0013985 | Ga0501047_0013985_3169_4902 | 507 |
| 121 | 3300053078 | Ga0495612_0019089 | Ga0495612_0019089_391_2193 | 507 |
| 122 | 3300053085 | Ga0495619_0000098 | Ga0495619_0000098_36565_38367 | 507 |
| 123 | 3300005337 | Ga0070682_100001328 | Ga0070682_1000013286 | 508 |
| 124 | 3300005549 | Ga0070704_100071171 | Ga0070704_1000711712 | 508 |
| 125 | 3300005842 | Ga0068858_100102208 | Ga0068858_1001022081 | 508 |
| 126 | 3300025321 | Ga0207656_10000105 | Ga0207656_1000010531 | 508 |
| 127 | 3300026035 | Ga0207703_10015703 | Ga0207703_100157032 | 508 |
| 128 | 3300049586 | Ga0501070_0018096 | Ga0501070_0018096_511_2514 | 508 |
| 129 | 3300053084 | Ga0495595_0010800 | Ga0495595_0010800_1810_3423 | 508 |
| 130 | 3300053096 | Ga0500641_0005892 | Ga0500641_0005892_1810_3630 | 508 |
| 131 | 3300005364 | Ga0070673_100004180 | Ga0070673_10000418010 | 509 |
| 132 | 3300006163 | Ga0070715_10000011 | Ga0070715_1000001168 | 509 |
| 133 | 3300013308 | Ga0157375_10000416 | Ga0157375_1000041618 | 509 |
| 134 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001119 | 509 |
| 135 | 3300025960 | Ga0207651_10001295 | Ga0207651_1000129512 | 509 |
| 136 | 3300046460 | Ga0495638_0008356 | Ga0495638_0008356_745_2469 | 509 |
| 137 | 3300046559 | Ga0495667_0000022 | Ga0495667_0000022_16874_18613 | 509 |
| 138 | 3300046684 | Ga0495669_0000083 | Ga0495669_0000083_19261_20952 | 509 |
| 139 | 3300047321 | Ga0495676_0010588 | Ga0495676_0010588_5214_6902 | 509 |
| 140 | 3300048906 | Ga0496103_0000050 | Ga0496103_0000050_105989_107899 | 509 |
| 141 | 3300048912 | Ga0496109_0000248 | Ga0496109_0000248_15524_17203 | 509 |
| 142 | 3300053085 | Ga0495619_0013246 | Ga0495619_0013246_1869_3494 | 509 |
| 143 | 3300025937 | Ga0207669_10084131 | Ga0207669_100841312 | 510 |
| 144 | 3300046684 | Ga0495669_0000823 | Ga0495669_0000823_262_2064 | 510 |
| 145 | 3300047322 | Ga0495680_0000407 | Ga0495680_0000407_36121_38016 | 510 |
| 146 | 3300048915 | Ga0496112_0001779 | Ga0496112_0001779_8330_10123 | 510 |
| 147 | 3300048916 | Ga0496113_0000080 | Ga0496113_0000080_8313_10106 | 510 |
| 148 | 3300005329 | Ga0070683_100002626 | Ga0070683_10000262612 | 511 |
| 149 | 3300005354 | Ga0070675_100000008 | Ga0070675_100000008220 | 511 |
| 150 | 3300005543 | Ga0070672_100000175 | Ga0070672_10000017528 | 511 |
| 151 | 3300025940 | Ga0207691_10000609 | Ga0207691_100006099 | 511 |
| 152 | 3300046499 | Ga0495594_0000007 | Ga0495594_0000007_112634_114337 | 511 |
| 153 | 3300047317 | Ga0495604_0000416 | Ga0495604_0000416_6623_8320 | 511 |
| 154 | 3300048904 | Ga0496101_0087537 | Ga0496101_0087537_92_2233 | 511 |
| 155 | 3300048913 | Ga0496110_0018392 | Ga0496110_0018392_1789_3552 | 511 |
| 156 | 3300050515 | nmdc:mga0a205_1_c2 | nmdc:mga0a205_1_c2_139159_140820 | 511 |
| 157 | 3300053077 | Ga0495601_0000031 | Ga0495601_0000031_36650_38353 | 511 |
| 158 | 3300053094 | Ga0500566_0065932 | Ga0500566_0065932_64_1872 | 511 |
| 159 | 3300005327 | Ga0070658_10051144 | Ga0070658_100511443 | 512 |
| 160 | 3300005341 | Ga0070691_10000014 | Ga0070691_1000001417 | 512 |
| 161 | 3300005548 | Ga0070665_100009304 | Ga0070665_1000093045 | 512 |
| 162 | 3300013105 | Ga0157369_10000135 | Ga0157369_1000013595 | 512 |
| 163 | 3300014969 | Ga0157376_10152195 | Ga0157376_101521952 | 512 |
| 164 | 3300025909 | Ga0207705_10041343 | Ga0207705_100413433 | 512 |
| 165 | 3300028379 | Ga0268266_10001032 | Ga0268266_1000103229 | 512 |
| 166 | 3300044842 | Ga0466957_0000177 | Ga0466957_0000177_4184_5905 | 512 |
| 167 | 3300046473 | Ga0495582_0000013 | Ga0495582_0000013_18368_20026 | 512 |
| 168 | 3300046683 | Ga0495658_0000009 | Ga0495658_0000009_90356_92014 | 512 |
| 169 | 3300048911 | Ga0496108_0000398 | Ga0496108_0000398_32121_34064 | 512 |
| 170 | 3300048912 | Ga0496109_0000285 | Ga0496109_0000285_14234_16177 | 512 |
| 171 | 3300005338 | Ga0068868_100000467 | Ga0068868_10000046719 | 513 |
| 172 | 3300025934 | Ga0207686_10000063 | Ga0207686_1000006321 | 513 |
| 173 | 3300026023 | Ga0207677_10000464 | Ga0207677_100004648 | 513 |
| 174 | 3300028563 | Ga0265319_1000266 | Ga0265319_100026626 | 513 |
| 175 | 3300028800 | Ga0265338_10001825 | Ga0265338_1000182522 | 513 |
| 176 | 3300046515 | Ga0495620_0002330 | Ga0495620_0002330_9060_10940 | 513 |
| 177 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_402509_404242 | 513 |
| 178 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_99476_101305 | 513 |
| 179 | 3300048918 | Ga0496115_0000071 | Ga0496115_0000071_22987_24816 | 513 |
| 180 | 3300053078 | Ga0495612_0010132 | Ga0495612_0010132_665_2503 | 513 |
| 181 | 3300053083 | Ga0495655_0000004 | Ga0495655_0000004_181307_183085 | 513 |
| 182 | 3300053129 | Ga0500628_000004 | Ga0500628_000004_89722_91500 | 513 |
| 183 | 3300005356 | Ga0070674_100000001 | Ga0070674_100000001166 | 514 |
| 184 | 3300005366 | Ga0070659_100002304 | Ga0070659_1000023047 | 514 |
| 185 | 3300005457 | Ga0070662_100000015 | Ga0070662_10000001593 | 514 |
| 186 | 3300006847 | Ga0075431_100029010 | Ga0075431_1000290105 | 514 |
| 187 | 3300009098 | Ga0105245_10000667 | Ga0105245_1000066724 | 514 |
| 188 | 3300009177 | Ga0105248_10000126 | Ga0105248_1000012675 | 514 |
| 189 | 3300025899 | Ga0207642_10000043 | Ga0207642_100000436 | 514 |
| 190 | 3300025926 | Ga0207659_10000014 | Ga0207659_1000001493 | 514 |
| 191 | 3300025927 | Ga0207687_10000037 | Ga0207687_1000003715 | 514 |
| 192 | 3300025932 | Ga0207690_10005636 | Ga0207690_100056364 | 514 |
| 193 | 3300025933 | Ga0207706_10000062 | Ga0207706_1000006216 | 514 |
| 194 | 3300025937 | Ga0207669_10000002 | Ga0207669_10000002183 | 514 |
| 195 | 3300025941 | Ga0207711_10000024 | Ga0207711_10000024187 | 514 |
| 196 | 3300047317 | Ga0495604_0000413 | Ga0495604_0000413_23982_25805 | 514 |
| 197 | 3300050510 | nmdc:mga06r32_126855_c1 | nmdc:mga06r32_126855_c1_25_1818 | 514 |
| 198 | 3300010375 | Ga0105239_10190013 | Ga0105239_101900131 | 515 |
| 199 | 3300017792 | Ga0163161_10000018 | Ga0163161_1000001897 | 515 |
| 200 | 3300045976 | Ga0466967_0000005 | Ga0466967_0000005_56243_58087 | 515 |
| 201 | 3300046459 | Ga0495629_0000055 | Ga0495629_0000055_96474_98204 | 515 |
| 202 | 3300046511 | Ga0495608_0000079 | Ga0495608_0000079_44538_46226 | 515 |
| 203 | 3300046675 | Ga0495657_0000070 | Ga0495657_0000070_44527_46215 | 515 |
| 204 | 3300046690 | Ga0495624_0000012 | Ga0495624_0000012_776_2668 | 515 |
| 205 | 3300046690 | Ga0495624_0000258 | Ga0495624_0000258_9425_11200 | 515 |
| 206 | 3300047444 | Ga0495675_0000141 | Ga0495675_0000141_47176_48864 | 515 |
| 207 | 3300048912 | Ga0496109_0000024 | Ga0496109_0000024_100874_102670 | 515 |
| 208 | 3300053084 | Ga0495595_0000004 | Ga0495595_0000004_212966_214654 | 515 |
| 209 | 3300053085 | Ga0495619_0000173 | Ga0495619_0000173_1305_2993 | 515 |
| 210 | 3300005618 | Ga0068864_100000024 | Ga0068864_100000024105 | 516 |
| 211 | 3300009101 | Ga0105247_10000204 | Ga0105247_1000020447 | 516 |
| 212 | 3300026041 | Ga0207639_10003793 | Ga0207639_100037936 | 516 |
| 213 | 3300026095 | Ga0207676_10000048 | Ga0207676_10000048148 | 516 |
| 214 | 3300046694 | Ga0495649_0000587 | Ga0495649_0000587_18350_20053 | 516 |
| 215 | 3300048905 | Ga0496102_0000045 | Ga0496102_0000045_44134_46044 | 516 |
| 216 | 3300005841 | Ga0068863_100000136 | Ga0068863_10000013628 | 517 |
| 217 | 3300005841 | Ga0068863_100005789 | Ga0068863_1000057897 | 517 |
| 218 | 3300026088 | Ga0207641_10000265 | Ga0207641_1000026536 | 517 |
| 219 | 3300026088 | Ga0207641_10001786 | Ga0207641_100017867 | 517 |
| 220 | 3300046454 | Ga0495592_0000600 | Ga0495592_0000600_17748_19544 | 517 |
| 221 | 3300046523 | Ga0495644_0000693 | Ga0495644_0000693_11378_13222 | 517 |
| 222 | 3300046689 | Ga0495613_0000364 | Ga0495613_0000364_7181_9070 | 517 |
| 223 | 3300046809 | Ga0495600_0023432 | Ga0495600_0023432_1207_3150 | 517 |
| 224 | 3300047321 | Ga0495676_0005294 | Ga0495676_0005294_3198_4976 | 517 |
| 225 | 3300048903 | Ga0496100_0000012 | Ga0496100_0000012_44259_46037 | 517 |
| 226 | 3300048904 | Ga0496101_0000010 | Ga0496101_0000010_236168_237946 | 517 |
| 227 | 3300048909 | Ga0496106_0000017 | Ga0496106_0000017_43971_45749 | 517 |
| 228 | 3300048910 | Ga0496107_0000012 | Ga0496107_0000012_135807_137585 | 517 |
| 229 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_90089_91849 | 517 |
| 230 | 3300048912 | Ga0496109_0000006 | Ga0496109_0000006_90089_91849 | 517 |
| 231 | 3300049569 | Ga0501032_0009269 | Ga0501032_0009269_3071_5131 | 517 |
| 232 | 3300049570 | Ga0501033_0010646 | Ga0501033_0010646_3083_5143 | 517 |
| 233 | 3300049571 | Ga0501034_0052226 | Ga0501034_0052226_2024_4084 | 517 |
| 234 | 3300049572 | Ga0501036_0056405 | Ga0501036_0056405_35_2095 | 517 |
| 235 | 3300049574 | Ga0501038_0015191 | Ga0501038_0015191_1873_3933 | 517 |
| 236 | 3300049580 | Ga0501046_0012350 | Ga0501046_0012350_2133_4193 | 517 |
| 237 | 3300049581 | Ga0501047_0015832 | Ga0501047_0015832_3071_5131 | 517 |
| 238 | 3300049586 | Ga0501070_0012559 | Ga0501070_0012559_2013_4073 | 517 |
| 239 | 3300049742 | Ga0501080_0041795 | Ga0501080_0041795_1562_3622 | 517 |
| 240 | 3300049822 | Ga0501035_0014582 | Ga0501035_0014582_2104_4164 | 517 |
| 241 | 3300049823 | Ga0501044_0019801 | Ga0501044_0019801_3069_5129 | 517 |
| 242 | 3300005616 | Ga0068852_100000005 | Ga0068852_100000005160 | 518 |
| 243 | 3300005981 | Ga0081538_10000023 | Ga0081538_1000002315 | 518 |
| 244 | 3300006175 | Ga0070712_100013482 | Ga0070712_1000134822 | 518 |
| 245 | 3300009098 | Ga0105245_10022100 | Ga0105245_100221001 | 518 |
| 246 | 3300013308 | Ga0157375_10028002 | Ga0157375_100280022 | 518 |
| 247 | 3300026142 | Ga0207698_10000038 | Ga0207698_1000003881 | 518 |
| 248 | 3300046529 | Ga0495652_0000003 | Ga0495652_0000003_240338_242191 | 518 |
| 249 | 3300046663 | Ga0495635_0000026 | Ga0495635_0000026_97049_98941 | 518 |
| 250 | 3300048904 | Ga0496101_0024421 | Ga0496101_0024421_871_2634 | 518 |
| 251 | 3300048905 | Ga0496102_0007753 | Ga0496102_0007753_3375_5138 | 518 |
| 252 | 3300048906 | Ga0496103_0002814 | Ga0496103_0002814_7458_9221 | 518 |
| 253 | 3300048909 | Ga0496106_0004083 | Ga0496106_0004083_1890_3653 | 518 |
| 254 | 3300048914 | Ga0496111_0027268 | Ga0496111_0027268_2263_4026 | 518 |
| 255 | 3300048918 | Ga0496115_0022984 | Ga0496115_0022984_27_1790 | 518 |
| 256 | 3300005985 | Ga0081539_10002449 | Ga0081539_1000244919 | 519 |
| 257 | 3300006852 | Ga0075433_10000968 | Ga0075433_100009683 | 519 |
| 258 | 3300014968 | Ga0157379_10011591 | Ga0157379_100115918 | 519 |
| 259 | 3300046455 | Ga0495603_0000074 | Ga0495603_0000074_38807_40540 | 519 |
| 260 | 3300046516 | Ga0495628_0000965 | Ga0495628_0000965_4328_6076 | 519 |
| 261 | 3300046660 | Ga0495625_0000787 | Ga0495625_0000787_22872_24728 | 519 |
| 262 | 3300050515 | nmdc:mga0a205_1066_c1 | nmdc:mga0a205_1066_c1_9456_11255 | 519 |
| 263 | 3300053084 | Ga0495595_0000167 | Ga0495595_0000167_23761_25659 | 519 |
| 264 | 3300005530 | Ga0070679_100000069 | Ga0070679_1000000696 | 520 |
| 265 | 3300005539 | Ga0068853_100001637 | Ga0068853_1000016379 | 520 |
| 266 | 3300013296 | Ga0157374_10006572 | Ga0157374_100065725 | 520 |
| 267 | 3300025921 | Ga0207652_10000142 | Ga0207652_1000014276 | 520 |
| 268 | 3300046455 | Ga0495603_0001152 | Ga0495603_0001152_13578_15305 | 520 |
| 269 | 3300046459 | Ga0495629_0084694 | Ga0495629_0084694_32_1879 | 520 |
| 270 | 3300046529 | Ga0495652_0017506 | Ga0495652_0017506_743_2656 | 520 |
| 271 | 3300048909 | Ga0496106_0000174 | Ga0496106_0000174_27192_29105 | 520 |
| 272 | 3300005329 | Ga0070683_100004015 | Ga0070683_1000040157 | 521 |
| 273 | 3300005337 | Ga0070682_100000077 | Ga0070682_10000007739 | 521 |
| 274 | 3300005548 | Ga0070665_100000068 | Ga0070665_1000000688 | 521 |
| 275 | 3300005614 | Ga0068856_100079564 | Ga0068856_1000795642 | 521 |
| 276 | 3300005842 | Ga0068858_100001203 | Ga0068858_10000120322 | 521 |
| 277 | 3300009176 | Ga0105242_10002841 | Ga0105242_100028417 | 521 |
| 278 | 3300025944 | Ga0207661_10001063 | Ga0207661_100010636 | 521 |
| 279 | 3300026035 | Ga0207703_10000128 | Ga0207703_1000012867 | 521 |
| 280 | 3300026078 | Ga0207702_10025507 | Ga0207702_100255072 | 521 |
| 281 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020393 | 521 |
| 282 | 3300046461 | Ga0495641_0000020 | Ga0495641_0000020_16961_18805 | 521 |
| 283 | 3300046678 | Ga0495599_0014958 | Ga0495599_0014958_2377_4293 | 521 |
| 284 | 3300047322 | Ga0495680_0000671 | Ga0495680_0000671_24984_26909 | 521 |
| 285 | 3300049591 | Ga0501075_0032777 | Ga0501075_0032777_1702_3516 | 521 |
| 286 | 3300053077 | Ga0495601_0000196 | Ga0495601_0000196_8010_9770 | 521 |
| 287 | 3300053078 | Ga0495612_0003966 | Ga0495612_0003966_3994_5958 | 521 |
| 288 | 3300009551 | Ga0105238_10000172 | Ga0105238_1000017232 | 523 |
| 289 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004916 | 523 |
| 290 | 3300046809 | Ga0495600_0046892 | Ga0495600_0046892_343_2064 | 523 |
| 291 | 3300053085 | Ga0495619_0004260 | Ga0495619_0004260_5103_6824 | 523 |
| 292 | 3300046681 | Ga0495647_0000027 | Ga0495647_0000027_56_2074 | 524 |
| 293 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_433119_435224 | 525 |
| 294 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_892955_895060 | 525 |
| 295 | 3300053085 | Ga0495619_0000042 | Ga0495619_0000042_44494_46359 | 525 |
| 296 | 3300026089 | Ga0207648_10000271 | Ga0207648_1000027137 | 526 |
| 297 | 3300053085 | Ga0495619_0000061 | Ga0495619_0000061_37543_39294 | 529 |
| 298 | 3300035398 | Ga0316574_0017497 | Ga0316574_0017497_824_2719 | 531 |
| 299 | 3300046476 | Ga0495662_0000021 | Ga0495662_0000021_24320_26194 | 531 |
| 300 | 3300001977 | JGI24746J21847_1000526 | JGI24746J21847_10005262 | 541 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1njf-assembly4.cif.gz_D | nucleotide bound form of an isolated e. coli clamp loader gamma subunit | 0.9492 | 10 | 247 |
| 1njf-assembly4.cif.gz_D | nucleotide bound form of an isolated e. coli clamp loader gamma subunit | 0.9377 | 10 | 247 |
| 2chg-assembly3.cif.gz_C | replication factor c domains 1 and 2 | 0.8696 | 11 | 246 |
| 2chg-assembly3.cif.gz_C | replication factor c domains 1 and 2 | 0.8478 | 11 | 246 |
| 5oaf-assembly1.cif.gz_A | human rvb1/rvb2 heterohexamer in ino80 complex | 0.7842 | 126 | 245 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54BN3_188_243_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9863 | 184 | 231 | 1.10.8.60 |
| af_F4KEM0_516_577_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9674 | 188 | 245 | 1.10.8.60 |
| af_A0A1D6E842_267_330_1.10.8.60 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9671 | 184 | 246 | 1.10.8.60 |
| 1njfD02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9657 | 184 | 247 | 1.10.8.60 |
| 1njfB02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9643 | 184 | 242 | 1.10.8.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F9C3U1-F1-model_v4 | DNA-directed DNA polymerase (EC 2.7.7.7) | 0.9739 | 10 | 166 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 |
| AF-X1IH18-F1-model_v4 | DNA-directed DNA polymerase (EC 2.7.7.7) | 0.9723 | 6 | 232 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 GO:0046872 |
| AF-A0A1F2QCS4-F1-model_v4 | DNA polymerase III subunit gamma/tau (EC 2.7.7.7) | 0.971 | 7 | 196 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 |
| AF-A0A3C1SIS5-F1-model_v4 | DNA polymerase III subunit gamma/tau (EC 2.7.7.7) | 0.97 | 11 | 194 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 |
| AF-A0A536EN07-F1-model_v4 | DNA polymerase III subunit gamma/tau (EC 2.7.7.7) | 0.9683 | 5 | 220 |
GO:0003887
GO:0005524 GO:0006261 GO:0009360 GO:0016887 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar