F395550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 175 | 295 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0015626|Ga0495672_0015626_2321_3538 |
| Length | 405 |
| Sequence | MAAGKPGKVVSCKKHKATNHSSWPTGCWSKNNASVPFNQLFCIQSTTMIKDFRIGGNRVLTHTVFWIVFLLANGFVWGYCFETTYFFGDSFRAELIDLPFLGAIVYTNLYFFLPRFFARKKYLTYLLLAAIAVSVTALVMRIVHVKLTDTLFPVSWDNKRIYDLYFIGRIVLLNIGPVLIVSTIIKLCQYWYYEQNAAQELLKEKLAAELNYLKAQVHPHFLFNTLNNLYSLTLTKSDQAPPVVLKLSGLMSYMLYDSQESRIALEKEIAHIRNYIDLEKIRYGKRLEVSFNVHGNTQNVYIPPLLLMPFVENAFKHGVSNETKEAWVTIDLKIKESSLVIKVENSKAAGIITENKFNYRNGIGLKNVKRRLALLYPGRHDLAVDDDREHYAVDLKLLLPENQLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 2 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 3 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 4 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 5 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 6 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 124 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 125 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 130 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 136 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 137 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 138 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 139 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 164 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 165 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 166 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 168 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 171 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 173 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 175 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.67 |
| Metatranscriptomes | 0 |
| Isolates | 2.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.67 |
| Nodule | 0 |
| Rhizoplane | 0.33 |
| Rhizosphere | 83.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002004 | 3300001989 | Bacteria | 7793 |
| 2 | JGI24735J21928_10001407 | 3300002067 | Bacteria | 8496 |
| 3 | rootH1_10002094 | 3300003316 | Bacteria | 14234 |
| 4 | rootH1_10009461 | 3300003316 | Bacteria | 6736 |
| 5 | rootH1_10009461 | 3300003323 | Bacteria | 16505 |
| 6 | rootH1_10071627 | 3300003316 | Unclassified | 4568 |
| 7 | rootH1_10096175 | 3300003316 | Bacteria | 4572 |
| 8 | rootH2_10003017 | 3300003320 | Bacteria | 58480 |
| 9 | rootH2_10007509 | 3300003320 | Bacteria | 13677 |
| 10 | rootH2_10148617 | 3300003320 | Bacteria | 2870 |
| 11 | rootH2_10281941 | 3300003320 | Bacteria | 1974 |
| 12 | rootL2_10007072 | 3300003322 | Bacteria | 12293 |
| 13 | rootL2_10010510 | 3300003322 | Bacteria | 11379 |
| 14 | rootL2_10086237 | 3300003322 | Bacteria | 2714 |
| 15 | rootL2_10162655 | 3300003322 | Bacteria | 5250 |
| 16 | rootL2_10166230 | 3300003322 | Unclassified | 3326 |
| 17 | rootL2_10217296 | 3300003322 | Bacteria | 7133 |
| 18 | rootL2_10225262 | 3300003322 | Bacteria | 1917 |
| 19 | rootH1_10038086 | 3300003316 | Bacteria | 4347 |
| 20 | rootH1_10038086 | 3300003323 | Bacteria | 6519 |
| 21 | rootH1_10077232 | 3300003323 | Bacteria | 2247 |
| 22 | JGI25160J50197_1007109 | 3300003354 | Bacteria | 4417 |
| 23 | Ga0055536_1008939 | 3300003781 | Bacteria | 4225 |
| 24 | Ga0055531_10000210 | 3300003794 | Bacteria | 64274 |
| 25 | Ga0055531_10002422 | 3300003794 | Bacteria | 12490 |
| 26 | Ga0065165_1000078 | 3300005262 | Bacteria | 162412 |
| 27 | Ga0070676_10000105 | 3300005328 | Bacteria | 30184 |
| 28 | Ga0070676_10009396 | 3300005328 | Bacteria | 5283 |
| 29 | Ga0070670_100177517 | 3300005331 | Bacteria | 1848 |
| 30 | Ga0068869_100042793 | 3300005334 | Bacteria | 3249 |
| 31 | Ga0068869_100079317 | 3300005334 | Bacteria | 2447 |
| 32 | Ga0070666_10018670 | 3300005335 | Unclassified | 4464 |
| 33 | Ga0070666_10028595 | 3300005335 | Bacteria | 3659 |
| 34 | Ga0070666_10104581 | 3300005335 | Unclassified | 1954 |
| 35 | Ga0070666_10111084 | 3300005335 | Bacteria | 1896 |
| 36 | Ga0070680_100025412 | 3300005336 | Unclassified | 4734 |
| 37 | Ga0070682_100048644 | 3300005337 | Bacteria | 2641 |
| 38 | Ga0068868_100004880 | 3300005338 | Bacteria | 9415 |
| 39 | Ga0068868_100019067 | 3300005338 | Bacteria | 5136 |
| 40 | Ga0070660_100067674 | 3300005339 | Bacteria | 2783 |
| 41 | Ga0070661_100043436 | 3300005344 | Bacteria | 3283 |
| 42 | Ga0070668_100000189 | 3300005347 | Bacteria | 40304 |
| 43 | Ga0070668_100069739 | 3300005347 | Bacteria | 2735 |
| 44 | Ga0070668_100098263 | 3300005347 | Bacteria | 2317 |
| 45 | Ga0070669_100124580 | 3300005353 | Bacteria | 1970 |
| 46 | Ga0070675_100019608 | 3300005354 | Bacteria | 5390 |
| 47 | Ga0070673_100000051 | 3300005364 | Bacteria | 48567 |
| 48 | Ga0070673_100029778 | 3300005364 | Bacteria | 4075 |
| 49 | Ga0070673_100370515 | 3300005364 | Bacteria | 1275 |
| 50 | Ga0070659_100000407 | 3300005366 | Bacteria | 32639 |
| 51 | Ga0070667_100001060 | 3300005367 | Bacteria | 25131 |
| 52 | Ga0070667_100007775 | 3300005367 | Bacteria | 8887 |
| 53 | Ga0070667_100020647 | 3300005367 | Bacteria | 5469 |
| 54 | Ga0070663_100007360 | 3300005455 | Bacteria | 6697 |
| 55 | Ga0070678_100015832 | 3300005456 | Unclassified | 4804 |
| 56 | Ga0070678_100024187 | 3300005456 | Bacteria | 4061 |
| 57 | Ga0070662_100001209 | 3300005457 | Bacteria | 15878 |
| 58 | Ga0068867_100001965 | 3300005459 | Bacteria | 14332 |
| 59 | Ga0068867_100029732 | 3300005459 | Bacteria | 3937 |
| 60 | Ga0068853_100004339 | 3300005539 | Bacteria | 10973 |
| 61 | Ga0070672_100000795 | 3300005543 | Bacteria | 18799 |
| 62 | Ga0070672_100311594 | 3300005543 | Bacteria | 1336 |
| 63 | Ga0070665_100000047 | 3300005548 | Bacteria | 269702 |
| 64 | Ga0070665_100003694 | 3300005548 | Bacteria | 16208 |
| 65 | Ga0070665_100013114 | 3300005548 | Bacteria | 8345 |
| 66 | Ga0068855_100000224 | 3300005563 | Bacteria | 72367 |
| 67 | Ga0068855_100017492 | 3300005563 | Bacteria | 8622 |
| 68 | Ga0068855_100511168 | 3300005563 | Bacteria | 1304 |
| 69 | Ga0070664_100105345 | 3300005564 | Bacteria | 2456 |
| 70 | Ga0068857_100026643 | 3300005577 | Bacteria | 5095 |
| 71 | Ga0068854_100152713 | 3300005578 | Bacteria | 1782 |
| 72 | Ga0068852_100071984 | 3300005616 | Bacteria | 3037 |
| 73 | Ga0068859_100013318 | 3300005617 | Bacteria | 8252 |
| 74 | Ga0068859_100069932 | 3300005617 | Bacteria | 3545 |
| 75 | Ga0068864_100000441 | 3300005618 | Bacteria | 36073 |
| 76 | Ga0068861_100037873 | 3300005719 | Unclassified | 3586 |
| 77 | Ga0068861_100137125 | 3300005719 | Bacteria | 1992 |
| 78 | Ga0068861_100359472 | 3300005719 | Bacteria | 1280 |
| 79 | Ga0068851_10009145 | 3300005834 | Bacteria | 4603 |
| 80 | Ga0068863_100003174 | 3300005841 | Bacteria | 16254 |
| 81 | Ga0068858_100002665 | 3300005842 | Bacteria | 17956 |
| 82 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 83 | Ga0068860_100007404 | 3300005843 | Bacteria | 10981 |
| 84 | Ga0068860_100007895 | 3300005843 | Bacteria | 10625 |
| 85 | Ga0068860_100008661 | 3300005843 | Bacteria | 10134 |
| 86 | Ga0068860_100052990 | 3300005843 | Bacteria | 3857 |
| 87 | Ga0097621_100001237 | 3300006237 | Bacteria | 17695 |
| 88 | Ga0097621_100041783 | 3300006237 | Bacteria | 3692 |
| 89 | Ga0097621_100361019 | 3300006237 | Bacteria | 1294 |
| 90 | Ga0068871_100002428 | 3300006358 | Bacteria | 12727 |
| 91 | Ga0068871_100106049 | 3300006358 | Bacteria | 2359 |
| 92 | Ga0075428_100064728 | 3300006844 | Bacteria | 4005 |
| 93 | Ga0068865_100002242 | 3300006881 | Bacteria | 11373 |
| 94 | Ga0097620_100013319 | 3300006931 | Bacteria | 8252 |
| 95 | Ga0097620_100069931 | 3300006931 | Bacteria | 3545 |
| 96 | Ga0105240_10000093 | 3300009093 | Bacteria | 181967 |
| 97 | Ga0105240_10011681 | 3300009093 | Bacteria | 12202 |
| 98 | Ga0105240_10102969 | 3300009093 | Bacteria | 3469 |
| 99 | Ga0111539_10005186 | 3300009094 | Bacteria | 16884 |
| 100 | Ga0111539_10005240 | 3300009094 | Bacteria | 16795 |
| 101 | Ga0111539_10436531 | 3300009094 | Bacteria | 1525 |
| 102 | Ga0105241_10013552 | 3300009174 | Bacteria | 5975 |
| 103 | Ga0105241_10055914 | 3300009174 | Bacteria | 3024 |
| 104 | Ga0105242_10039570 | 3300009176 | Bacteria | 3796 |
| 105 | Ga0105248_10080758 | 3300009177 | Bacteria | 3655 |
| 106 | Ga0105237_10000323 | 3300009545 | Bacteria | 67328 |
| 107 | Ga0105237_10000671 | 3300009545 | Bacteria | 47262 |
| 108 | Ga0105237_10154006 | 3300009545 | Bacteria | 2295 |
| 109 | Ga0105249_10079440 | 3300009553 | Unclassified | 3045 |
| 110 | Ga0105249_10244868 | 3300009553 | Unclassified | 1774 |
| 111 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 112 | Ga0105239_10005924 | 3300010375 | Bacteria | 14228 |
| 113 | Ga0105239_10084199 | 3300010375 | Bacteria | 3502 |
| 114 | Ga0105239_10103650 | 3300010375 | Bacteria | 3149 |
| 115 | Ga0105246_10023047 | 3300011119 | Bacteria | 4025 |
| 116 | Ga0105246_10074136 | 3300011119 | Bacteria | 2405 |
| 117 | Ga0157373_10000545 | 3300013100 | Bacteria | 29511 |
| 118 | Ga0157373_10015773 | 3300013100 | Bacteria | 5517 |
| 119 | Ga0157371_10000164 | 3300013102 | Bacteria | 96408 |
| 120 | Ga0157371_10035647 | 3300013102 | Unclassified | 3565 |
| 121 | Ga0157370_10136765 | 3300013104 | Bacteria | 2283 |
| 122 | Ga0157370_10175564 | 3300013104 | Bacteria | 1991 |
| 123 | Ga0157369_10012709 | 3300013105 | Bacteria | 9548 |
| 124 | Ga0157369_10186038 | 3300013105 | Bacteria | 2184 |
| 125 | Ga0157374_10010173 | 3300013296 | Bacteria | 8086 |
| 126 | Ga0157374_10038944 | 3300013296 | Bacteria | 4372 |
| 127 | Ga0157378_10022781 | 3300013297 | Bacteria | 5513 |
| 128 | Ga0163162_10000567 | 3300013306 | Bacteria | 34135 |
| 129 | Ga0163162_10001628 | 3300013306 | Bacteria | 21031 |
| 130 | Ga0163162_10027621 | 3300013306 | Bacteria | 5613 |
| 131 | Ga0163162_10054534 | 3300013306 | Bacteria | 4022 |
| 132 | Ga0163162_10089649 | 3300013306 | Bacteria | 3156 |
| 133 | Ga0163162_10209190 | 3300013306 | Bacteria | 2080 |
| 134 | Ga0163162_10279890 | 3300013306 | Bacteria | 1800 |
| 135 | Ga0163162_10292838 | 3300013306 | Bacteria | 1759 |
| 136 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 137 | Ga0157372_10000249 | 3300013307 | Bacteria | 59656 |
| 138 | Ga0157372_10016245 | 3300013307 | Bacteria | 7987 |
| 139 | Ga0157375_10001725 | 3300013308 | Bacteria | 18775 |
| 140 | Ga0157375_10019275 | 3300013308 | Bacteria | 6202 |
| 141 | Ga0163163_10097528 | 3300014325 | Bacteria | 2960 |
| 142 | Ga0157380_10004475 | 3300014326 | Bacteria | 9683 |
| 143 | Ga0157380_10005894 | 3300014326 | Bacteria | 8573 |
| 144 | Ga0157380_10034390 | 3300014326 | Bacteria | 3909 |
| 145 | Ga0157380_10043754 | 3300014326 | Bacteria | 3507 |
| 146 | Ga0157380_10075497 | 3300014326 | Bacteria | 2740 |
| 147 | Ga0157379_10000253 | 3300014968 | Bacteria | 41906 |
| 148 | Ga0157376_10000630 | 3300014969 | Bacteria | 22861 |
| 149 | Ga0157376_10332036 | 3300014969 | Bacteria | 1449 |
| 150 | Ga0163161_10002240 | 3300017792 | Bacteria | 13918 |
| 151 | Ga0163161_10002978 | 3300017792 | Bacteria | 11986 |
| 152 | Ga0163161_10075477 | 3300017792 | Bacteria | 2474 |
| 153 | Ga0213872_10010671 | 3300021361 | Unclassified | 4365 |
| 154 | Ga0209026_1000472 | 3300025250 | Bacteria | 30801 |
| 155 | Ga0209233_1002670 | 3300025261 | Bacteria | 6460 |
| 156 | Ga0209455_1005623 | 3300025272 | Bacteria | 3837 |
| 157 | Ga0209676_1000616 | 3300025292 | Bacteria | 52007 |
| 158 | Ga0209050_1002677 | 3300025298 | Bacteria | 14533 |
| 159 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 160 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 161 | Ga0207656_10005198 | 3300025321 | Bacteria | 4577 |
| 162 | Ga0207680_10001073 | 3300025903 | Bacteria | 12895 |
| 163 | Ga0207680_10028848 | 3300025903 | Unclassified | 3110 |
| 164 | Ga0207647_10000159 | 3300025904 | Bacteria | 53276 |
| 165 | Ga0207645_10000335 | 3300025907 | Bacteria | 39268 |
| 166 | Ga0207643_10006773 | 3300025908 | Bacteria | 6147 |
| 167 | Ga0207643_10062126 | 3300025908 | Bacteria | 2134 |
| 168 | Ga0207695_10000135 | 3300025913 | Bacteria | 217822 |
| 169 | Ga0207671_10002299 | 3300025914 | Bacteria | 20645 |
| 170 | Ga0207671_10017382 | 3300025914 | Bacteria | 5548 |
| 171 | Ga0207649_10046741 | 3300025920 | Bacteria | 2661 |
| 172 | Ga0207652_10009537 | 3300025921 | Bacteria | 7806 |
| 173 | Ga0207681_10023034 | 3300025923 | Bacteria | 3977 |
| 174 | Ga0207681_10054424 | 3300025923 | Bacteria | 2721 |
| 175 | Ga0207690_10022005 | 3300025932 | Bacteria | 3960 |
| 176 | Ga0207706_10009126 | 3300025933 | Bacteria | 9119 |
| 177 | Ga0207706_10011158 | 3300025933 | Bacteria | 8190 |
| 178 | Ga0207704_10001685 | 3300025938 | Bacteria | 9898 |
| 179 | Ga0207691_10000010 | 3300025940 | Bacteria | 150194 |
| 180 | Ga0207691_10015989 | 3300025940 | Bacteria | 7128 |
| 181 | Ga0207689_10089685 | 3300025942 | Bacteria | 2525 |
| 182 | Ga0207667_10000266 | 3300025949 | Bacteria | 72382 |
| 183 | Ga0207651_10000470 | 3300025960 | Bacteria | 17016 |
| 184 | Ga0207651_10031091 | 3300025960 | Bacteria | 3408 |
| 185 | Ga0207651_10161578 | 3300025960 | Bacteria | 1757 |
| 186 | Ga0207712_10021652 | 3300025961 | Bacteria | 4222 |
| 187 | Ga0207668_10000674 | 3300025972 | Bacteria | 20969 |
| 188 | Ga0207668_10048680 | 3300025972 | Bacteria | 2910 |
| 189 | Ga0207640_10187058 | 3300025981 | Bacteria | 1558 |
| 190 | Ga0207658_10001882 | 3300025986 | Bacteria | 15708 |
| 191 | Ga0207658_10011132 | 3300025986 | Bacteria | 6126 |
| 192 | Ga0207677_10019751 | 3300026023 | Bacteria | 4076 |
| 193 | Ga0207677_10078219 | 3300026023 | Bacteria | 2361 |
| 194 | Ga0207703_10001274 | 3300026035 | Bacteria | 23393 |
| 195 | Ga0207639_10027748 | 3300026041 | Bacteria | 4128 |
| 196 | Ga0207678_10043559 | 3300026067 | Bacteria | 3883 |
| 197 | Ga0207641_10007531 | 3300026088 | Bacteria | 9057 |
| 198 | Ga0207648_10012748 | 3300026089 | Bacteria | 7854 |
| 199 | Ga0207648_10022534 | 3300026089 | Bacteria | 5653 |
| 200 | Ga0207648_10025159 | 3300026089 | Bacteria | 5307 |
| 201 | Ga0207676_10005450 | 3300026095 | Bacteria | 9003 |
| 202 | Ga0207674_10020090 | 3300026116 | Bacteria | 7224 |
| 203 | Ga0207674_10025618 | 3300026116 | Bacteria | 6282 |
| 204 | Ga0207675_100012217 | 3300026118 | Bacteria | 8020 |
| 205 | Ga0207675_100032117 | 3300026118 | Bacteria | 4891 |
| 206 | Ga0207675_100147956 | 3300026118 | Bacteria | 2234 |
| 207 | Ga0207683_10003245 | 3300026121 | Bacteria | 14192 |
| 208 | Ga0207683_10040691 | 3300026121 | Bacteria | 4057 |
| 209 | Ga0207683_10116684 | 3300026121 | Bacteria | 2393 |
| 210 | Ga0207698_10053050 | 3300026142 | Bacteria | 3110 |
| 211 | Ga0207428_10053031 | 3300027907 | Bacteria | 3235 |
| 212 | Ga0268266_10000104 | 3300028379 | Bacteria | 178320 |
| 213 | Ga0268266_10004570 | 3300028379 | Bacteria | 13224 |
| 214 | Ga0268265_10088966 | 3300028380 | Bacteria | 2462 |
| 215 | Ga0268265_10110333 | 3300028380 | Bacteria | 2244 |
| 216 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 217 | Ga0268264_10005691 | 3300028381 | Bacteria | 10565 |
| 218 | Ga0268264_10005728 | 3300028381 | Bacteria | 10532 |
| 219 | Ga0268264_10238796 | 3300028381 | Bacteria | 1682 |
| 220 | Ga0265334_10012767 | 3300028573 | Bacteria | 3525 |
| 221 | Ga0316176_1043102 | 3300030732 | Bacteria | 1608 |
| 222 | Ga0316183_1159766 | 3300030742 | Bacteria | 38773 |
| 223 | Ga0316181_1003659 | 3300030744 | Bacteria | 18296 |
| 224 | Ga0265327_10000034 | 3300031251 | Bacteria | 316018 |
| 225 | Ga0265327_10000048 | 3300031251 | Bacteria | 269173 |
| 226 | Ga0307509_10036024 | 3300031507 | Bacteria | 5423 |
| 227 | Ga0307408_100016675 | 3300031548 | Unclassified | 4910 |
| 228 | Ga0307408_100039741 | 3300031548 | Bacteria | 3328 |
| 229 | Ga0316576_10109160 | 3300031727 | Bacteria | 2073 |
| 230 | Ga0316576_10182300 | 3300031727 | Bacteria | 1584 |
| 231 | Ga0307516_10000111 | 3300031730 | Bacteria | 94707 |
| 232 | Ga0307516_10000579 | 3300031730 | Bacteria | 49479 |
| 233 | Ga0307411_10096195 | 3300032005 | Unclassified | 2081 |
| 234 | Ga0373956_0105938 | 3300035119 | Unclassified | 1307 |
| 235 | Ga0373935_0134480 | 3300035692 | Unclassified | 1665 |
| 236 | Ga0395900_0265939 | 3300037418 | Bacteria | 1711 |
| 237 | Ga0400483_144337 | 3300039062 | Bacteria | 1494 |
| 238 | Ga0436361_0666982 | 3300039447 | Bacteria | 10101 |
| 239 | Ga0451577_0079256 | 3300042876 | Unclassified | 2928 |
| 240 | Ga0453683_0045522 | 3300044673 | Bacteria | 2751 |
| 241 | Ga0466965_0039268 | 3300044683 | Bacteria | 2327 |
| 242 | Ga0466961_0091712 | 3300044693 | Bacteria | 1918 |
| 243 | Ga0453684_0001568 | 3300044712 | Bacteria | 63367 |
| 244 | Ga0453684_0039970 | 3300044712 | Bacteria | 6379 |
| 245 | Ga0453684_0072195 | 3300044712 | Bacteria | 4359 |
| 246 | Ga0453684_0134820 | 3300044712 | Bacteria | 2958 |
| 247 | Ga0453684_0519930 | 3300044712 | Bacteria | 1315 |
| 248 | Ga0466968_0024822 | 3300044735 | Bacteria | 2452 |
| 249 | Ga0451576_0003300 | 3300045051 | Bacteria | 22416 |
| 250 | Ga0451576_0034004 | 3300045051 | Bacteria | 5416 |
| 251 | Ga0451576_0086893 | 3300045051 | Bacteria | 3253 |
| 252 | Ga0466958_0245966 | 3300045836 | Bacteria | 1143 |
| 253 | Ga0495627_011990 | 3300046453 | Unclassified | 3088 |
| 254 | Ga0495627_028868 | 3300046453 | Bacteria | 1769 |
| 255 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 256 | Ga0495638_0116269 | 3300046460 | Bacteria | 1584 |
| 257 | Ga0495580_0044599 | 3300046472 | Bacteria | 3153 |
| 258 | Ga0495606_0000844 | 3300046507 | Bacteria | 46120 |
| 259 | Ga0495606_0006996 | 3300046507 | Bacteria | 10241 |
| 260 | Ga0495606_0008305 | 3300046507 | Bacteria | 9052 |
| 261 | Ga0495610_0006279 | 3300046512 | Bacteria | 8227 |
| 262 | Ga0495648_0008311 | 3300046524 | Bacteria | 8182 |
| 263 | Ga0495652_0096825 | 3300046529 | Bacteria | 2402 |
| 264 | Ga0495633_0000561 | 3300046558 | Bacteria | 36426 |
| 265 | Ga0495633_0000869 | 3300046558 | Bacteria | 26201 |
| 266 | Ga0495633_0002987 | 3300046558 | Bacteria | 11568 |
| 267 | Ga0495661_0000114 | 3300046665 | Bacteria | 95935 |
| 268 | Ga0495661_0039149 | 3300046665 | Bacteria | 2948 |
| 269 | Ga0495658_0060542 | 3300046683 | Unclassified | 2172 |
| 270 | Ga0495660_0017375 | 3300046810 | Bacteria | 4142 |
| 271 | Ga0495672_0015626 | 3300047320 | Bacteria | 5146 |
| 272 | Ga0495687_000244 | 3300047443 | Bacteria | 74586 |
| 273 | Ga0495685_052705 | 3300047447 | Bacteria | 1378 |
| 274 | Ga0495684_0279978 | 3300047471 | Unclassified | 1204 |
| 275 | Ga0495686_0123147 | 3300047472 | Bacteria | 1543 |
| 276 | Ga0496114_0142562 | 3300048917 | Bacteria | 2076 |
| 277 | Ga0496126_0024324 | 3300048929 | Bacteria | 5849 |
| 278 | Ga0501300_002591 | 3300049523 | Unclassified | 2713 |
| 279 | Ga0501202_011837 | 3300049652 | Bacteria | 1639 |
| 280 | Ga0501217_005369 | 3300049661 | Bacteria | 2676 |
| 281 | Ga0501236_005544 | 3300049670 | Bacteria | 1528 |
| 282 | Ga0501257_002432 | 3300049686 | Unclassified | 3922 |
| 283 | Ga0501264_000237 | 3300049761 | Bacteria | 8866 |
| 284 | nmdc:mga08y16_22620_c1 | 3300050511 | Bacteria | 6637 |
| 285 | nmdc:mga08y16_47164_c1 | 3300050511 | Bacteria | 4510 |
| 286 | nmdc:mga08y16_98780_c1 | 3300050511 | Bacteria | 3040 |
| 287 | Ga0500646_0048112 | 3300053090 | Unclassified | 1222 |
| 288 | Ga0500618_002968 | 3300053125 | Bacteria | 6055 |
| 289 | Ga0500604_0020352 | 3300053151 | Bacteria | 1867 |
| 290 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 291 | Ga0500622_0000103 | 3300053156 | Bacteria | 86203 |
| 292 | Ga0500622_0000181 | 3300053156 | Bacteria | 67823 |
| 293 | Ga0500622_0000920 | 3300053156 | Bacteria | 24973 |
| 294 | Ga0500622_0014483 | 3300053156 | Bacteria | 4233 |
| 295 | Ga0500611_000007 | 3300053727 | Bacteria | 210964 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049661 | Ga0501217_005369 | Ga0501217_005369_873_1820 | 264 |
| 2 | 3300005335 | Ga0070666_10104581 | Ga0070666_101045812 | 269 |
| 3 | 3300047447 | Ga0495685_052705 | Ga0495685_052705_147_1166 | 271 |
| 4 | 3300044693 | Ga0466961_0091712 | Ga0466961_0091712_180_1154 | 287 |
| 5 | 3300045836 | Ga0466958_0245966 | Ga0466958_0245966_102_1076 | 287 |
| 6 | 3300048917 | Ga0496114_0142562 | Ga0496114_0142562_45_1016 | 288 |
| 7 | 3300044735 | Ga0466968_0024822 | Ga0466968_0024822_676_1716 | 290 |
| 8 | 3300009094 | Ga0111539_10436531 | Ga0111539_104365312 | 295 |
| 9 | 3300017792 | Ga0163161_10002240 | Ga0163161_1000224010 | 301 |
| 10 | 3300046453 | Ga0495627_011990 | Ga0495627_011990_1767_2702 | 301 |
| 11 | 3300046558 | Ga0495633_0000869 | Ga0495633_0000869_263_1198 | 301 |
| 12 | 3300013296 | Ga0157374_10038944 | Ga0157374_100389444 | 305 |
| 13 | 3300046453 | Ga0495627_028868 | Ga0495627_028868_751_1752 | 305 |
| 14 | 3300011119 | Ga0105246_10074136 | Ga0105246_100741363 | 307 |
| 15 | 3300013105 | Ga0157369_10186038 | Ga0157369_101860383 | 307 |
| 16 | 3300035119 | Ga0373956_0105938 | Ga0373956_0105938_69_1040 | 307 |
| 17 | 3300035692 | Ga0373935_0134480 | Ga0373935_0134480_314_1285 | 307 |
| 18 | 3300046472 | Ga0495580_0044599 | Ga0495580_0044599_232_1203 | 307 |
| 19 | 3300046683 | Ga0495658_0060542 | Ga0495658_0060542_405_1376 | 307 |
| 20 | 3300047471 | Ga0495684_0279978 | Ga0495684_0279978_130_1101 | 307 |
| 21 | 3300025250 | Ga0209026_1000472 | Ga0209026_100047217 | 308 |
| 22 | 3300030732 | Ga0316176_1043102 | Ga0316176_10431022 | 309 |
| 23 | 3300005335 | Ga0070666_10018670 | Ga0070666_100186704 | 310 |
| 24 | 3300025903 | Ga0207680_10028848 | Ga0207680_100288482 | 310 |
| 25 | 3300028573 | Ga0265334_10012767 | Ga0265334_100127673 | 311 |
| 26 | 3300025298 | Ga0209050_1002677 | Ga0209050_10026772 | 313 |
| 27 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_229305_230273 | 313 |
| 28 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_556925_557893 | 313 |
| 29 | 3300005455 | Ga0070663_100007360 | Ga0070663_1000073605 | 316 |
| 30 | 3300013104 | Ga0157370_10136765 | Ga0157370_101367652 | 316 |
| 31 | 3300013105 | Ga0157369_10012709 | Ga0157369_100127094 | 316 |
| 32 | 3300013307 | Ga0157372_10000021 | Ga0157372_10000021164 | 316 |
| 33 | 3300026067 | Ga0207678_10043559 | Ga0207678_100435593 | 316 |
| 34 | 3300046558 | Ga0495633_0000561 | Ga0495633_0000561_27183_28226 | 316 |
| 35 | 3300053090 | Ga0500646_0048112 | Ga0500646_0048112_91_1131 | 316 |
| 36 | 3300005843 | Ga0068860_100007404 | Ga0068860_1000074043 | 318 |
| 37 | 3300009093 | Ga0105240_10011681 | Ga0105240_100116815 | 318 |
| 38 | 3300009545 | Ga0105237_10000323 | Ga0105237_1000032321 | 318 |
| 39 | 3300010375 | Ga0105239_10005924 | Ga0105239_100059245 | 318 |
| 40 | 3300013306 | Ga0163162_10292838 | Ga0163162_102928382 | 318 |
| 41 | 3300014326 | Ga0157380_10005894 | Ga0157380_100058948 | 318 |
| 42 | 3300025914 | Ga0207671_10002299 | Ga0207671_1000229922 | 318 |
| 43 | 3300050511 | nmdc:mga08y16_22620_c1 | nmdc:mga08y16_22620_c1_1798_2781 | 318 |
| 44 | iso_pu_bacteria | 2977232053 | 2977233073 | 319 |
| 45 | 3300002067 | JGI24735J21928_10001407 | JGI24735J21928_100014075 | 320 |
| 46 | 3300013104 | Ga0157370_10175564 | Ga0157370_101755642 | 320 |
| 47 | 3300025261 | Ga0209233_1002670 | Ga0209233_10026707 | 320 |
| 48 | 3300025904 | Ga0207647_10000159 | Ga0207647_1000015929 | 320 |
| 49 | 3300026116 | Ga0207674_10020090 | Ga0207674_100200907 | 320 |
| 50 | 3300037418 | Ga0395900_0265939 | Ga0395900_0265939_23_1096 | 320 |
| 51 | 3300053125 | Ga0500618_002968 | Ga0500618_002968_2766_3872 | 322 |
| 52 | iso_pu_bacteria | 2842903701 | 2842906562 | 322 |
| 53 | 3300003322 | rootL2_10225262 | rootL2_102252622 | 324 |
| 54 | 3300013100 | Ga0157373_10000545 | Ga0157373_100005457 | 325 |
| 55 | 3300013102 | Ga0157371_10000164 | Ga0157371_1000016488 | 325 |
| 56 | 3300013307 | Ga0157372_10000249 | Ga0157372_1000024954 | 325 |
| 57 | 3300005539 | Ga0068853_100004339 | Ga0068853_10000433911 | 326 |
| 58 | 3300028381 | Ga0268264_10000028 | Ga0268264_1000002869 | 326 |
| 59 | 3300030742 | Ga0316183_1159766 | Ga0316183_11597663 | 326 |
| 60 | 3300030744 | Ga0316181_1003659 | Ga0316181_100365911 | 326 |
| 61 | 3300003316 | rootH1_10009461 | rootH1_100094612 | 327 |
| 62 | 3300005339 | Ga0070660_100067674 | Ga0070660_1000676742 | 327 |
| 63 | 3300005366 | Ga0070659_100000407 | Ga0070659_1000004075 | 327 |
| 64 | 3300025914 | Ga0207671_10017382 | Ga0207671_100173827 | 327 |
| 65 | 3300025932 | Ga0207690_10022005 | Ga0207690_100220055 | 327 |
| 66 | 3300003316 | rootH1_10002094 | rootH1_100020947 | 328 |
| 67 | 3300003320 | rootH2_10003017 | rootH2_1000301746 | 328 |
| 68 | 3300031251 | Ga0265327_10000034 | Ga0265327_1000003486 | 329 |
| 69 | 3300031507 | Ga0307509_10036024 | Ga0307509_100360245 | 329 |
| 70 | 3300042876 | Ga0451577_0079256 | Ga0451577_0079256_1627_2691 | 329 |
| 71 | 3300044712 | Ga0453684_0134820 | Ga0453684_0134820_1707_2771 | 329 |
| 72 | 3300044712 | Ga0453684_0519930 | Ga0453684_0519930_222_1250 | 329 |
| 73 | 3300045051 | Ga0451576_0086893 | Ga0451576_0086893_881_1945 | 329 |
| 74 | 3300003322 | rootL2_10007072 | rootL2_1000707210 | 330 |
| 75 | 3300053156 | Ga0500622_0000103 | Ga0500622_0000103_55151_56170 | 330 |
| 76 | 3300053156 | Ga0500622_0000181 | Ga0500622_0000181_30563_31582 | 330 |
| 77 | 3300003794 | Ga0055531_10002422 | Ga0055531_100024227 | 331 |
| 78 | 3300009093 | Ga0105240_10000093 | Ga0105240_1000009324 | 331 |
| 79 | 3300025304 | Ga0209257_1000007 | Ga0209257_10000071291 | 331 |
| 80 | 3300025913 | Ga0207695_10000135 | Ga0207695_10000135115 | 331 |
| 81 | 3300049523 | Ga0501300_002591 | Ga0501300_002591_625_1785 | 331 |
| 82 | 3300005843 | Ga0068860_100000003 | Ga0068860_100000003425 | 332 |
| 83 | 3300009553 | Ga0105249_10079440 | Ga0105249_100794402 | 332 |
| 84 | 3300013306 | Ga0163162_10001628 | Ga0163162_1000162812 | 332 |
| 85 | 3300048929 | Ga0496126_0024324 | Ga0496126_0024324_2592_3644 | 332 |
| 86 | 3300053156 | Ga0500622_0000920 | Ga0500622_0000920_16179_17225 | 332 |
| 87 | iso_pu_bacteria | 2919692658 | 2919696511 | 332 |
| 88 | 3300005328 | Ga0070676_10000105 | Ga0070676_1000010521 | 333 |
| 89 | 3300005335 | Ga0070666_10028595 | Ga0070666_100285954 | 333 |
| 90 | 3300005337 | Ga0070682_100048644 | Ga0070682_1000486441 | 333 |
| 91 | 3300005338 | Ga0068868_100004880 | Ga0068868_1000048807 | 333 |
| 92 | 3300005344 | Ga0070661_100043436 | Ga0070661_1000434363 | 333 |
| 93 | 3300005347 | Ga0070668_100000189 | Ga0070668_10000018930 | 333 |
| 94 | 3300005364 | Ga0070673_100000051 | Ga0070673_10000005149 | 333 |
| 95 | 3300005367 | Ga0070667_100001060 | Ga0070667_10000106017 | 333 |
| 96 | 3300005457 | Ga0070662_100001209 | Ga0070662_1000012096 | 333 |
| 97 | 3300005459 | Ga0068867_100001965 | Ga0068867_1000019659 | 333 |
| 98 | 3300005543 | Ga0070672_100000795 | Ga0070672_10000079510 | 333 |
| 99 | 3300005548 | Ga0070665_100000047 | Ga0070665_100000047167 | 333 |
| 100 | 3300005548 | Ga0070665_100003694 | Ga0070665_1000036942 | 333 |
| 101 | 3300005563 | Ga0068855_100017492 | Ga0068855_1000174927 | 333 |
| 102 | 3300005564 | Ga0070664_100105345 | Ga0070664_1001053454 | 333 |
| 103 | 3300005578 | Ga0068854_100152713 | Ga0068854_1001527132 | 333 |
| 104 | 3300005618 | Ga0068864_100000441 | Ga0068864_10000044119 | 333 |
| 105 | 3300005719 | Ga0068861_100137125 | Ga0068861_1001371252 | 333 |
| 106 | 3300005834 | Ga0068851_10009145 | Ga0068851_100091452 | 333 |
| 107 | 3300005841 | Ga0068863_100003174 | Ga0068863_1000031742 | 333 |
| 108 | 3300005842 | Ga0068858_100002665 | Ga0068858_10000266521 | 333 |
| 109 | 3300005843 | Ga0068860_100008661 | Ga0068860_1000086614 | 333 |
| 110 | 3300006237 | Ga0097621_100001237 | Ga0097621_1000012375 | 333 |
| 111 | 3300006358 | Ga0068871_100002428 | Ga0068871_1000024288 | 333 |
| 112 | 3300006881 | Ga0068865_100002242 | Ga0068865_1000022425 | 333 |
| 113 | 3300009176 | Ga0105242_10039570 | Ga0105242_100395704 | 333 |
| 114 | 3300009177 | Ga0105248_10080758 | Ga0105248_100807584 | 333 |
| 115 | 3300010375 | Ga0105239_10084199 | Ga0105239_100841992 | 333 |
| 116 | 3300013296 | Ga0157374_10010173 | Ga0157374_100101735 | 333 |
| 117 | 3300013297 | Ga0157378_10022781 | Ga0157378_100227815 | 333 |
| 118 | 3300013306 | Ga0163162_10000567 | Ga0163162_1000056719 | 333 |
| 119 | 3300013308 | Ga0157375_10001725 | Ga0157375_100017259 | 333 |
| 120 | 3300014968 | Ga0157379_10000253 | Ga0157379_100002537 | 333 |
| 121 | 3300014969 | Ga0157376_10000630 | Ga0157376_1000063018 | 333 |
| 122 | 3300017792 | Ga0163161_10002978 | Ga0163161_100029789 | 333 |
| 123 | 3300025321 | Ga0207656_10005198 | Ga0207656_100051985 | 333 |
| 124 | 3300025903 | Ga0207680_10001073 | Ga0207680_1000107316 | 333 |
| 125 | 3300025907 | Ga0207645_10000335 | Ga0207645_1000033536 | 333 |
| 126 | 3300025920 | Ga0207649_10046741 | Ga0207649_100467414 | 333 |
| 127 | 3300025933 | Ga0207706_10011158 | Ga0207706_100111585 | 333 |
| 128 | 3300025938 | Ga0207704_10001685 | Ga0207704_100016851 | 333 |
| 129 | 3300025940 | Ga0207691_10000010 | Ga0207691_1000001051 | 333 |
| 130 | 3300025942 | Ga0207689_10089685 | Ga0207689_100896852 | 333 |
| 131 | 3300025960 | Ga0207651_10000470 | Ga0207651_1000047010 | 333 |
| 132 | 3300025972 | Ga0207668_10000674 | Ga0207668_1000067422 | 333 |
| 133 | 3300025981 | Ga0207640_10187058 | Ga0207640_101870581 | 333 |
| 134 | 3300025986 | Ga0207658_10001882 | Ga0207658_1000188218 | 333 |
| 135 | 3300026023 | Ga0207677_10019751 | Ga0207677_100197512 | 333 |
| 136 | 3300026035 | Ga0207703_10001274 | Ga0207703_1000127419 | 333 |
| 137 | 3300026088 | Ga0207641_10007531 | Ga0207641_100075312 | 333 |
| 138 | 3300026089 | Ga0207648_10025159 | Ga0207648_100251593 | 333 |
| 139 | 3300026095 | Ga0207676_10005450 | Ga0207676_100054505 | 333 |
| 140 | 3300026118 | Ga0207675_100147956 | Ga0207675_1001479563 | 333 |
| 141 | 3300026121 | Ga0207683_10040691 | Ga0207683_100406914 | 333 |
| 142 | 3300028379 | Ga0268266_10000104 | Ga0268266_1000010478 | 333 |
| 143 | 3300028379 | Ga0268266_10004570 | Ga0268266_100045703 | 333 |
| 144 | 3300028381 | Ga0268264_10005691 | Ga0268264_100056915 | 333 |
| 145 | 3300044712 | Ga0453684_0001568 | Ga0453684_0001568_47857_48900 | 333 |
| 146 | 3300044712 | Ga0453684_0039970 | Ga0453684_0039970_636_1718 | 333 |
| 147 | 3300044712 | Ga0453684_0072195 | Ga0453684_0072195_76_1203 | 333 |
| 148 | 3300045051 | Ga0451576_0003300 | Ga0451576_0003300_6004_7086 | 333 |
| 149 | 3300046460 | Ga0495638_0116269 | Ga0495638_0116269_26_1111 | 333 |
| 150 | 3300046524 | Ga0495648_0008311 | Ga0495648_0008311_3440_4525 | 333 |
| 151 | 3300047443 | Ga0495687_000244 | Ga0495687_000244_9289_10374 | 333 |
| 152 | 3300003354 | JGI25160J50197_1007109 | JGI25160J50197_10071094 | 334 |
| 153 | 3300005367 | Ga0070667_100020647 | Ga0070667_1000206476 | 334 |
| 154 | 3300005843 | Ga0068860_100007895 | Ga0068860_1000078955 | 334 |
| 155 | 3300025986 | Ga0207658_10011132 | Ga0207658_100111323 | 334 |
| 156 | 3300028381 | Ga0268264_10005728 | Ga0268264_100057285 | 334 |
| 157 | 3300039062 | Ga0400483_144337 | Ga0400483_144337_141_1256 | 334 |
| 158 | 3300044683 | Ga0466965_0039268 | Ga0466965_0039268_176_1237 | 334 |
| 159 | 3300003316 | rootH1_10071627 | rootH1_100716274 | 335 |
| 160 | 3300003320 | rootH2_10281941 | rootH2_102819412 | 335 |
| 161 | 3300003322 | rootL2_10010510 | rootL2_1001051011 | 335 |
| 162 | 3300003322 | rootL2_10166230 | rootL2_101662302 | 335 |
| 163 | 3300005331 | Ga0070670_100177517 | Ga0070670_1001775172 | 335 |
| 164 | 3300005334 | Ga0068869_100079317 | Ga0068869_1000793173 | 335 |
| 165 | 3300005347 | Ga0070668_100098263 | Ga0070668_1000982631 | 335 |
| 166 | 3300005353 | Ga0070669_100124580 | Ga0070669_1001245801 | 335 |
| 167 | 3300005354 | Ga0070675_100019608 | Ga0070675_1000196087 | 335 |
| 168 | 3300005543 | Ga0070672_100311594 | Ga0070672_1003115942 | 335 |
| 169 | 3300005563 | Ga0068855_100511168 | Ga0068855_1005111681 | 335 |
| 170 | 3300005577 | Ga0068857_100026643 | Ga0068857_1000266432 | 335 |
| 171 | 3300005617 | Ga0068859_100013318 | Ga0068859_1000133186 | 335 |
| 172 | 3300005719 | Ga0068861_100037873 | Ga0068861_1000378734 | 335 |
| 173 | 3300006844 | Ga0075428_100064728 | Ga0075428_1000647283 | 335 |
| 174 | 3300006931 | Ga0097620_100013319 | Ga0097620_1000133196 | 335 |
| 175 | 3300009094 | Ga0111539_10005186 | Ga0111539_100051863 | 335 |
| 176 | 3300009094 | Ga0111539_10005240 | Ga0111539_100052407 | 335 |
| 177 | 3300013306 | Ga0163162_10054534 | Ga0163162_100545344 | 335 |
| 178 | 3300014326 | Ga0157380_10043754 | Ga0157380_100437542 | 335 |
| 179 | 3300025908 | Ga0207643_10062126 | Ga0207643_100621262 | 335 |
| 180 | 3300025923 | Ga0207681_10023034 | Ga0207681_100230342 | 335 |
| 181 | 3300025933 | Ga0207706_10009126 | Ga0207706_100091262 | 335 |
| 182 | 3300025961 | Ga0207712_10021652 | Ga0207712_100216522 | 335 |
| 183 | 3300026089 | Ga0207648_10022534 | Ga0207648_100225346 | 335 |
| 184 | 3300026116 | Ga0207674_10025618 | Ga0207674_100256186 | 335 |
| 185 | 3300026118 | Ga0207675_100032117 | Ga0207675_1000321172 | 335 |
| 186 | 3300027907 | Ga0207428_10053031 | Ga0207428_100530313 | 335 |
| 187 | 3300028380 | Ga0268265_10110333 | Ga0268265_101103332 | 335 |
| 188 | 3300031251 | Ga0265327_10000048 | Ga0265327_10000048197 | 335 |
| 189 | 3300031730 | Ga0307516_10000579 | Ga0307516_1000057927 | 335 |
| 190 | 3300050511 | nmdc:mga08y16_47164_c1 | nmdc:mga08y16_47164_c1_3124_4179 | 335 |
| 191 | 3300050511 | nmdc:mga08y16_98780_c1 | nmdc:mga08y16_98780_c1_825_1865 | 335 |
| 192 | 3300005456 | Ga0070678_100015832 | Ga0070678_1000158323 | 336 |
| 193 | 3300026121 | Ga0207683_10116684 | Ga0207683_101166842 | 336 |
| 194 | 3300003781 | Ga0055536_1008939 | Ga0055536_10089394 | 337 |
| 195 | 3300005262 | Ga0065165_1000078 | Ga0065165_100007886 | 337 |
| 196 | 3300005336 | Ga0070680_100025412 | Ga0070680_1000254124 | 337 |
| 197 | 3300009093 | Ga0105240_10102969 | Ga0105240_101029692 | 337 |
| 198 | 3300009545 | Ga0105237_10000671 | Ga0105237_1000067137 | 337 |
| 199 | 3300010375 | Ga0105239_10000017 | Ga0105239_10000017117 | 337 |
| 200 | 3300013308 | Ga0157375_10019275 | Ga0157375_100192755 | 337 |
| 201 | 3300025292 | Ga0209676_1000616 | Ga0209676_100061619 | 337 |
| 202 | 3300025921 | Ga0207652_10009537 | Ga0207652_1000953710 | 337 |
| 203 | 3300046810 | Ga0495660_0017375 | Ga0495660_0017375_848_1891 | 337 |
| 204 | 3300009174 | Ga0105241_10013552 | Ga0105241_100135523 | 338 |
| 205 | 3300031730 | Ga0307516_10000111 | Ga0307516_1000011119 | 338 |
| 206 | 3300003320 | rootH2_10007509 | rootH2_100075098 | 339 |
| 207 | 3300003322 | rootL2_10162655 | rootL2_101626555 | 339 |
| 208 | 3300003794 | Ga0055531_10000210 | Ga0055531_1000021043 | 339 |
| 209 | 3300005563 | Ga0068855_100000224 | Ga0068855_1000002249 | 339 |
| 210 | 3300005616 | Ga0068852_100071984 | Ga0068852_1000719842 | 339 |
| 211 | 3300009545 | Ga0105237_10154006 | Ga0105237_101540061 | 339 |
| 212 | 3300009553 | Ga0105249_10244868 | Ga0105249_102448682 | 339 |
| 213 | 3300010375 | Ga0105239_10103650 | Ga0105239_101036503 | 339 |
| 214 | 3300013306 | Ga0163162_10027621 | Ga0163162_100276213 | 339 |
| 215 | 3300021361 | Ga0213872_10010671 | Ga0213872_100106713 | 339 |
| 216 | 3300025272 | Ga0209455_1005623 | Ga0209455_10056235 | 339 |
| 217 | 3300025304 | Ga0209257_1000025 | Ga0209257_1000025132 | 339 |
| 218 | 3300025949 | Ga0207667_10000266 | Ga0207667_1000026671 | 339 |
| 219 | 3300026142 | Ga0207698_10053050 | Ga0207698_100530503 | 339 |
| 220 | 3300031548 | Ga0307408_100016675 | Ga0307408_1000166752 | 339 |
| 221 | 3300031727 | Ga0316576_10182300 | Ga0316576_101823002 | 339 |
| 222 | 3300039447 | Ga0436361_0666982 | Ga0436361_0666982_2218_3261 | 339 |
| 223 | 3300046507 | Ga0495606_0006996 | Ga0495606_0006996_6202_7254 | 339 |
| 224 | 3300047472 | Ga0495686_0123147 | Ga0495686_0123147_124_1176 | 339 |
| 225 | 3300049670 | Ga0501236_005544 | Ga0501236_005544_314_1363 | 339 |
| 226 | 3300049686 | Ga0501257_002432 | Ga0501257_002432_672_1721 | 339 |
| 227 | 3300031727 | Ga0316576_10109160 | Ga0316576_101091602 | 340 |
| 228 | 3300053727 | Ga0500611_000007 | Ga0500611_000007_187032_188114 | 340 |
| 229 | 3300003323 | rootH1_10077232 | rootH1_100772321 | 341 |
| 230 | 3300009174 | Ga0105241_10055914 | Ga0105241_100559141 | 341 |
| 231 | 3300011119 | Ga0105246_10023047 | Ga0105246_100230473 | 341 |
| 232 | 3300013306 | Ga0163162_10279890 | Ga0163162_102798902 | 341 |
| 233 | 3300014325 | Ga0163163_10097528 | Ga0163163_100975282 | 341 |
| 234 | 3300014326 | Ga0157380_10075497 | Ga0157380_100754971 | 341 |
| 235 | 3300014969 | Ga0157376_10332036 | Ga0157376_103320362 | 341 |
| 236 | 3300003322 | rootL2_10217296 | rootL2_102172964 | 342 |
| 237 | 3300003323 | rootH1_10038086 | rootH1_100380863 | 342 |
| 238 | 3300032005 | Ga0307411_10096195 | Ga0307411_100961952 | 343 |
| 239 | 3300014326 | Ga0157380_10034390 | Ga0157380_100343904 | 344 |
| 240 | 3300047320 | Ga0495672_0015626 | Ga0495672_0015626_2321_3538 | 345 |
| 241 | 3300053156 | Ga0500622_0014483 | Ga0500622_0014483_821_1894 | 345 |
| 242 | iso_pu_bacteria | 2839989709 | 2839991945 | 345 |
| 243 | 3300053151 | Ga0500604_0020352 | Ga0500604_0020352_580_1650 | 346 |
| 244 | 3300005328 | Ga0070676_10009396 | Ga0070676_100093965 | 348 |
| 245 | 3300005334 | Ga0068869_100042793 | Ga0068869_1000427933 | 348 |
| 246 | 3300005335 | Ga0070666_10111084 | Ga0070666_101110842 | 348 |
| 247 | 3300005338 | Ga0068868_100019067 | Ga0068868_1000190672 | 348 |
| 248 | 3300005347 | Ga0070668_100069739 | Ga0070668_1000697392 | 348 |
| 249 | 3300005364 | Ga0070673_100029778 | Ga0070673_1000297783 | 348 |
| 250 | 3300005367 | Ga0070667_100007775 | Ga0070667_1000077753 | 348 |
| 251 | 3300005456 | Ga0070678_100024187 | Ga0070678_1000241872 | 348 |
| 252 | 3300005459 | Ga0068867_100029732 | Ga0068867_1000297323 | 348 |
| 253 | 3300005548 | Ga0070665_100013114 | Ga0070665_1000131142 | 348 |
| 254 | 3300005617 | Ga0068859_100069932 | Ga0068859_1000699323 | 348 |
| 255 | 3300005719 | Ga0068861_100359472 | Ga0068861_1003594721 | 348 |
| 256 | 3300005843 | Ga0068860_100052990 | Ga0068860_1000529903 | 348 |
| 257 | 3300006237 | Ga0097621_100041783 | Ga0097621_1000417833 | 348 |
| 258 | 3300006931 | Ga0097620_100069931 | Ga0097620_1000699313 | 348 |
| 259 | 3300013100 | Ga0157373_10015773 | Ga0157373_100157732 | 348 |
| 260 | 3300013102 | Ga0157371_10035647 | Ga0157371_100356472 | 348 |
| 261 | 3300013307 | Ga0157372_10016245 | Ga0157372_100162457 | 348 |
| 262 | 3300025908 | Ga0207643_10006773 | Ga0207643_100067731 | 348 |
| 263 | 3300025923 | Ga0207681_10054424 | Ga0207681_100544243 | 348 |
| 264 | 3300025940 | Ga0207691_10015989 | Ga0207691_100159893 | 348 |
| 265 | 3300025960 | Ga0207651_10031091 | Ga0207651_100310912 | 348 |
| 266 | 3300025972 | Ga0207668_10048680 | Ga0207668_100486803 | 348 |
| 267 | 3300026023 | Ga0207677_10078219 | Ga0207677_100782192 | 348 |
| 268 | 3300026089 | Ga0207648_10012748 | Ga0207648_100127484 | 348 |
| 269 | 3300026118 | Ga0207675_100012217 | Ga0207675_1000122173 | 348 |
| 270 | 3300026121 | Ga0207683_10003245 | Ga0207683_1000324513 | 348 |
| 271 | 3300028380 | Ga0268265_10088966 | Ga0268265_100889662 | 348 |
| 272 | 3300028381 | Ga0268264_10238796 | Ga0268264_102387961 | 348 |
| 273 | iso_pu_bacteria | 2739367663 | 2739648243 | 349 |
| 274 | 3300005364 | Ga0070673_100370515 | Ga0070673_1003705151 | 350 |
| 275 | 3300006237 | Ga0097621_100361019 | Ga0097621_1003610191 | 350 |
| 276 | 3300006358 | Ga0068871_100106049 | Ga0068871_1001060492 | 350 |
| 277 | 3300013306 | Ga0163162_10209190 | Ga0163162_102091902 | 350 |
| 278 | 3300017792 | Ga0163161_10075477 | Ga0163161_100754772 | 350 |
| 279 | 3300025960 | Ga0207651_10161578 | Ga0207651_101615782 | 350 |
| 280 | 3300031548 | Ga0307408_100039741 | Ga0307408_1000397415 | 350 |
| 281 | 3300049652 | Ga0501202_011837 | Ga0501202_011837_265_1425 | 350 |
| 282 | 3300049761 | Ga0501264_000237 | Ga0501264_000237_6840_8000 | 350 |
| 283 | 3300014326 | Ga0157380_10004475 | Ga0157380_100044757 | 351 |
| 284 | 3300044673 | Ga0453683_0045522 | Ga0453683_0045522_1567_2706 | 356 |
| 285 | 3300045051 | Ga0451576_0034004 | Ga0451576_0034004_1706_2845 | 356 |
| 286 | 3300003320 | rootH2_10148617 | rootH2_101486173 | 358 |
| 287 | iso_pu_bacteria | 2929154850 | 2929158378 | 358 |
| 288 | 3300046665 | Ga0495661_0000114 | Ga0495661_0000114_75952_77115 | 361 |
| 289 | 3300046512 | Ga0495610_0006279 | Ga0495610_0006279_3372_4466 | 364 |
| 290 | 3300046558 | Ga0495633_0002987 | Ga0495633_0002987_6017_7111 | 364 |
| 291 | 3300046665 | Ga0495661_0039149 | Ga0495661_0039149_1801_2895 | 364 |
| 292 | 3300003316 | rootH1_10096175 | rootH1_100961755 | 365 |
| 293 | iso_pu_bacteria | 2977232053 | 2977235823 | 366 |
| 294 | 3300001989 | JGI24739J22299_10002004 | JGI24739J22299_100020042 | 371 |
| 295 | 3300003322 | rootL2_10086237 | rootL2_100862373 | 371 |
| 296 | 3300013306 | Ga0163162_10089649 | Ga0163162_100896493 | 371 |
| 297 | 3300026041 | Ga0207639_10027748 | Ga0207639_100277483 | 371 |
| 298 | 3300046507 | Ga0495606_0000844 | Ga0495606_0000844_10021_11136 | 371 |
| 299 | 3300046507 | Ga0495606_0008305 | Ga0495606_0008305_5577_6704 | 371 |
| 300 | 3300046529 | Ga0495652_0096825 | Ga0495652_0096825_1225_2340 | 371 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1th8-assembly1.cif.gz_A-2 | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.6905 | 266 | 356 |
| 6swk-assembly1.cif.gz_A-2 | the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus | 0.6876 | 176 | 357 |
| 7kjh-assembly2.cif.gz_D | plasmodium falciparum protein pf12p bound to nanobody b9 | 0.6835 | 330 | 356 |
| 3a0y-assembly1.cif.gz_A | catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) | 0.6805 | 222 | 357 |
| 6swj-assembly1.cif.gz_A-2 | the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus (with pt) | 0.6761 | 176 | 357 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AD14_423_557_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8188 | 223 | 356 | 3.30.565.10 |
| af_P0AD14_423_557_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8023 | 223 | 356 | 3.30.565.10 |
| af_Q2G1E0_342_515_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7834 | 198 | 359 | 3.30.565.10 |
| af_Q53705_433_584_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7622 | 223 | 362 | 3.30.565.10 |
| af_P0AA93_414_560_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.7559 | 222 | 358 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537J3P1-F1-model_v4 | GHKL domain-containing protein | 0.9208 | 231 | 357 |
|
| AF-A0A537J3P1-F1-model_v4 | GHKL domain-containing protein | 0.914 | 231 | 357 |
|
| AF-A0A2W6V2W6-F1-model_v4 | Histidine kinase | 0.8979 | 207 | 357 |
GO:0000155
GO:0016020 |
| AF-A0A2W6V2W6-F1-model_v4 | Histidine kinase | 0.8656 | 207 | 357 |
GO:0000155
GO:0016020 |
| AF-A0A497DP08-F1-model_v4 | Signal transduction histidine kinase internal region domain-containing protein | 0.8564 | 150 | 356 |
GO:0000155
GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar