F395550

General Info

Members Datasets Scaffolds Average Seq Length
300 175 295 352

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0015626|Ga0495672_0015626_2321_3538
Length 405
Sequence MAAGKPGKVVSCKKHKATNHSSWPTGCWSKNNASVPFNQLFCIQSTTMIKDFRIGGNRVLTHTVFWIVFLLANGFVWGYCFETTYFFGDSFRAELIDLPFLGAIVYTNLYFFLPRFFARKKYLTYLLLAAIAVSVTALVMRIVHVKLTDTLFPVSWDNKRIYDLYFIGRIVLLNIGPVLIVSTIIKLCQYWYYEQNAAQELLKEKLAAELNYLKAQVHPHFLFNTLNNLYSLTLTKSDQAPPVVLKLSGLMSYMLYDSQESRIALEKEIAHIRNYIDLEKIRYGKRLEVSFNVHGNTQNVYIPPLLLMPFVENAFKHGVSNETKEAWVTIDLKIKESSLVIKVENSKAAGIITENKFNYRNGIGLKNVKRRLALLYPGRHDLAVDDDREHYAVDLKLLLPENQLA

Samples

Sample ID Description Type Environment
1 2739367663 Pedobacter sp. YR510 Isolate Unclassified
2 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
3 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
4 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
124 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
164 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
167 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
168 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 0.33
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 9.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002004 3300001989 Bacteria 7793
2 JGI24735J21928_10001407 3300002067 Bacteria 8496
3 rootH1_10002094 3300003316 Bacteria 14234
4 rootH1_10009461 3300003316 Bacteria 6736
5 rootH1_10009461 3300003323 Bacteria 16505
6 rootH1_10071627 3300003316 Unclassified 4568
7 rootH1_10096175 3300003316 Bacteria 4572
8 rootH2_10003017 3300003320 Bacteria 58480
9 rootH2_10007509 3300003320 Bacteria 13677
10 rootH2_10148617 3300003320 Bacteria 2870
11 rootH2_10281941 3300003320 Bacteria 1974
12 rootL2_10007072 3300003322 Bacteria 12293
13 rootL2_10010510 3300003322 Bacteria 11379
14 rootL2_10086237 3300003322 Bacteria 2714
15 rootL2_10162655 3300003322 Bacteria 5250
16 rootL2_10166230 3300003322 Unclassified 3326
17 rootL2_10217296 3300003322 Bacteria 7133
18 rootL2_10225262 3300003322 Bacteria 1917
19 rootH1_10038086 3300003316 Bacteria 4347
20 rootH1_10038086 3300003323 Bacteria 6519
21 rootH1_10077232 3300003323 Bacteria 2247
22 JGI25160J50197_1007109 3300003354 Bacteria 4417
23 Ga0055536_1008939 3300003781 Bacteria 4225
24 Ga0055531_10000210 3300003794 Bacteria 64274
25 Ga0055531_10002422 3300003794 Bacteria 12490
26 Ga0065165_1000078 3300005262 Bacteria 162412
27 Ga0070676_10000105 3300005328 Bacteria 30184
28 Ga0070676_10009396 3300005328 Bacteria 5283
29 Ga0070670_100177517 3300005331 Bacteria 1848
30 Ga0068869_100042793 3300005334 Bacteria 3249
31 Ga0068869_100079317 3300005334 Bacteria 2447
32 Ga0070666_10018670 3300005335 Unclassified 4464
33 Ga0070666_10028595 3300005335 Bacteria 3659
34 Ga0070666_10104581 3300005335 Unclassified 1954
35 Ga0070666_10111084 3300005335 Bacteria 1896
36 Ga0070680_100025412 3300005336 Unclassified 4734
37 Ga0070682_100048644 3300005337 Bacteria 2641
38 Ga0068868_100004880 3300005338 Bacteria 9415
39 Ga0068868_100019067 3300005338 Bacteria 5136
40 Ga0070660_100067674 3300005339 Bacteria 2783
41 Ga0070661_100043436 3300005344 Bacteria 3283
42 Ga0070668_100000189 3300005347 Bacteria 40304
43 Ga0070668_100069739 3300005347 Bacteria 2735
44 Ga0070668_100098263 3300005347 Bacteria 2317
45 Ga0070669_100124580 3300005353 Bacteria 1970
46 Ga0070675_100019608 3300005354 Bacteria 5390
47 Ga0070673_100000051 3300005364 Bacteria 48567
48 Ga0070673_100029778 3300005364 Bacteria 4075
49 Ga0070673_100370515 3300005364 Bacteria 1275
50 Ga0070659_100000407 3300005366 Bacteria 32639
51 Ga0070667_100001060 3300005367 Bacteria 25131
52 Ga0070667_100007775 3300005367 Bacteria 8887
53 Ga0070667_100020647 3300005367 Bacteria 5469
54 Ga0070663_100007360 3300005455 Bacteria 6697
55 Ga0070678_100015832 3300005456 Unclassified 4804
56 Ga0070678_100024187 3300005456 Bacteria 4061
57 Ga0070662_100001209 3300005457 Bacteria 15878
58 Ga0068867_100001965 3300005459 Bacteria 14332
59 Ga0068867_100029732 3300005459 Bacteria 3937
60 Ga0068853_100004339 3300005539 Bacteria 10973
61 Ga0070672_100000795 3300005543 Bacteria 18799
62 Ga0070672_100311594 3300005543 Bacteria 1336
63 Ga0070665_100000047 3300005548 Bacteria 269702
64 Ga0070665_100003694 3300005548 Bacteria 16208
65 Ga0070665_100013114 3300005548 Bacteria 8345
66 Ga0068855_100000224 3300005563 Bacteria 72367
67 Ga0068855_100017492 3300005563 Bacteria 8622
68 Ga0068855_100511168 3300005563 Bacteria 1304
69 Ga0070664_100105345 3300005564 Bacteria 2456
70 Ga0068857_100026643 3300005577 Bacteria 5095
71 Ga0068854_100152713 3300005578 Bacteria 1782
72 Ga0068852_100071984 3300005616 Bacteria 3037
73 Ga0068859_100013318 3300005617 Bacteria 8252
74 Ga0068859_100069932 3300005617 Bacteria 3545
75 Ga0068864_100000441 3300005618 Bacteria 36073
76 Ga0068861_100037873 3300005719 Unclassified 3586
77 Ga0068861_100137125 3300005719 Bacteria 1992
78 Ga0068861_100359472 3300005719 Bacteria 1280
79 Ga0068851_10009145 3300005834 Bacteria 4603
80 Ga0068863_100003174 3300005841 Bacteria 16254
81 Ga0068858_100002665 3300005842 Bacteria 17956
82 Ga0068860_100000003 3300005843 Bacteria 575741
83 Ga0068860_100007404 3300005843 Bacteria 10981
84 Ga0068860_100007895 3300005843 Bacteria 10625
85 Ga0068860_100008661 3300005843 Bacteria 10134
86 Ga0068860_100052990 3300005843 Bacteria 3857
87 Ga0097621_100001237 3300006237 Bacteria 17695
88 Ga0097621_100041783 3300006237 Bacteria 3692
89 Ga0097621_100361019 3300006237 Bacteria 1294
90 Ga0068871_100002428 3300006358 Bacteria 12727
91 Ga0068871_100106049 3300006358 Bacteria 2359
92 Ga0075428_100064728 3300006844 Bacteria 4005
93 Ga0068865_100002242 3300006881 Bacteria 11373
94 Ga0097620_100013319 3300006931 Bacteria 8252
95 Ga0097620_100069931 3300006931 Bacteria 3545
96 Ga0105240_10000093 3300009093 Bacteria 181967
97 Ga0105240_10011681 3300009093 Bacteria 12202
98 Ga0105240_10102969 3300009093 Bacteria 3469
99 Ga0111539_10005186 3300009094 Bacteria 16884
100 Ga0111539_10005240 3300009094 Bacteria 16795
101 Ga0111539_10436531 3300009094 Bacteria 1525
102 Ga0105241_10013552 3300009174 Bacteria 5975
103 Ga0105241_10055914 3300009174 Bacteria 3024
104 Ga0105242_10039570 3300009176 Bacteria 3796
105 Ga0105248_10080758 3300009177 Bacteria 3655
106 Ga0105237_10000323 3300009545 Bacteria 67328
107 Ga0105237_10000671 3300009545 Bacteria 47262
108 Ga0105237_10154006 3300009545 Bacteria 2295
109 Ga0105249_10079440 3300009553 Unclassified 3045
110 Ga0105249_10244868 3300009553 Unclassified 1774
111 Ga0105239_10000017 3300010375 Bacteria 290760
112 Ga0105239_10005924 3300010375 Bacteria 14228
113 Ga0105239_10084199 3300010375 Bacteria 3502
114 Ga0105239_10103650 3300010375 Bacteria 3149
115 Ga0105246_10023047 3300011119 Bacteria 4025
116 Ga0105246_10074136 3300011119 Bacteria 2405
117 Ga0157373_10000545 3300013100 Bacteria 29511
118 Ga0157373_10015773 3300013100 Bacteria 5517
119 Ga0157371_10000164 3300013102 Bacteria 96408
120 Ga0157371_10035647 3300013102 Unclassified 3565
121 Ga0157370_10136765 3300013104 Bacteria 2283
122 Ga0157370_10175564 3300013104 Bacteria 1991
123 Ga0157369_10012709 3300013105 Bacteria 9548
124 Ga0157369_10186038 3300013105 Bacteria 2184
125 Ga0157374_10010173 3300013296 Bacteria 8086
126 Ga0157374_10038944 3300013296 Bacteria 4372
127 Ga0157378_10022781 3300013297 Bacteria 5513
128 Ga0163162_10000567 3300013306 Bacteria 34135
129 Ga0163162_10001628 3300013306 Bacteria 21031
130 Ga0163162_10027621 3300013306 Bacteria 5613
131 Ga0163162_10054534 3300013306 Bacteria 4022
132 Ga0163162_10089649 3300013306 Bacteria 3156
133 Ga0163162_10209190 3300013306 Bacteria 2080
134 Ga0163162_10279890 3300013306 Bacteria 1800
135 Ga0163162_10292838 3300013306 Bacteria 1759
136 Ga0157372_10000021 3300013307 Bacteria 207801
137 Ga0157372_10000249 3300013307 Bacteria 59656
138 Ga0157372_10016245 3300013307 Bacteria 7987
139 Ga0157375_10001725 3300013308 Bacteria 18775
140 Ga0157375_10019275 3300013308 Bacteria 6202
141 Ga0163163_10097528 3300014325 Bacteria 2960
142 Ga0157380_10004475 3300014326 Bacteria 9683
143 Ga0157380_10005894 3300014326 Bacteria 8573
144 Ga0157380_10034390 3300014326 Bacteria 3909
145 Ga0157380_10043754 3300014326 Bacteria 3507
146 Ga0157380_10075497 3300014326 Bacteria 2740
147 Ga0157379_10000253 3300014968 Bacteria 41906
148 Ga0157376_10000630 3300014969 Bacteria 22861
149 Ga0157376_10332036 3300014969 Bacteria 1449
150 Ga0163161_10002240 3300017792 Bacteria 13918
151 Ga0163161_10002978 3300017792 Bacteria 11986
152 Ga0163161_10075477 3300017792 Bacteria 2474
153 Ga0213872_10010671 3300021361 Unclassified 4365
154 Ga0209026_1000472 3300025250 Bacteria 30801
155 Ga0209233_1002670 3300025261 Bacteria 6460
156 Ga0209455_1005623 3300025272 Bacteria 3837
157 Ga0209676_1000616 3300025292 Bacteria 52007
158 Ga0209050_1002677 3300025298 Bacteria 14533
159 Ga0209257_1000007 3300025304 Bacteria 1564415
160 Ga0209257_1000025 3300025304 Bacteria 724838
161 Ga0207656_10005198 3300025321 Bacteria 4577
162 Ga0207680_10001073 3300025903 Bacteria 12895
163 Ga0207680_10028848 3300025903 Unclassified 3110
164 Ga0207647_10000159 3300025904 Bacteria 53276
165 Ga0207645_10000335 3300025907 Bacteria 39268
166 Ga0207643_10006773 3300025908 Bacteria 6147
167 Ga0207643_10062126 3300025908 Bacteria 2134
168 Ga0207695_10000135 3300025913 Bacteria 217822
169 Ga0207671_10002299 3300025914 Bacteria 20645
170 Ga0207671_10017382 3300025914 Bacteria 5548
171 Ga0207649_10046741 3300025920 Bacteria 2661
172 Ga0207652_10009537 3300025921 Bacteria 7806
173 Ga0207681_10023034 3300025923 Bacteria 3977
174 Ga0207681_10054424 3300025923 Bacteria 2721
175 Ga0207690_10022005 3300025932 Bacteria 3960
176 Ga0207706_10009126 3300025933 Bacteria 9119
177 Ga0207706_10011158 3300025933 Bacteria 8190
178 Ga0207704_10001685 3300025938 Bacteria 9898
179 Ga0207691_10000010 3300025940 Bacteria 150194
180 Ga0207691_10015989 3300025940 Bacteria 7128
181 Ga0207689_10089685 3300025942 Bacteria 2525
182 Ga0207667_10000266 3300025949 Bacteria 72382
183 Ga0207651_10000470 3300025960 Bacteria 17016
184 Ga0207651_10031091 3300025960 Bacteria 3408
185 Ga0207651_10161578 3300025960 Bacteria 1757
186 Ga0207712_10021652 3300025961 Bacteria 4222
187 Ga0207668_10000674 3300025972 Bacteria 20969
188 Ga0207668_10048680 3300025972 Bacteria 2910
189 Ga0207640_10187058 3300025981 Bacteria 1558
190 Ga0207658_10001882 3300025986 Bacteria 15708
191 Ga0207658_10011132 3300025986 Bacteria 6126
192 Ga0207677_10019751 3300026023 Bacteria 4076
193 Ga0207677_10078219 3300026023 Bacteria 2361
194 Ga0207703_10001274 3300026035 Bacteria 23393
195 Ga0207639_10027748 3300026041 Bacteria 4128
196 Ga0207678_10043559 3300026067 Bacteria 3883
197 Ga0207641_10007531 3300026088 Bacteria 9057
198 Ga0207648_10012748 3300026089 Bacteria 7854
199 Ga0207648_10022534 3300026089 Bacteria 5653
200 Ga0207648_10025159 3300026089 Bacteria 5307
201 Ga0207676_10005450 3300026095 Bacteria 9003
202 Ga0207674_10020090 3300026116 Bacteria 7224
203 Ga0207674_10025618 3300026116 Bacteria 6282
204 Ga0207675_100012217 3300026118 Bacteria 8020
205 Ga0207675_100032117 3300026118 Bacteria 4891
206 Ga0207675_100147956 3300026118 Bacteria 2234
207 Ga0207683_10003245 3300026121 Bacteria 14192
208 Ga0207683_10040691 3300026121 Bacteria 4057
209 Ga0207683_10116684 3300026121 Bacteria 2393
210 Ga0207698_10053050 3300026142 Bacteria 3110
211 Ga0207428_10053031 3300027907 Bacteria 3235
212 Ga0268266_10000104 3300028379 Bacteria 178320
213 Ga0268266_10004570 3300028379 Bacteria 13224
214 Ga0268265_10088966 3300028380 Bacteria 2462
215 Ga0268265_10110333 3300028380 Bacteria 2244
216 Ga0268264_10000028 3300028381 Bacteria 426662
217 Ga0268264_10005691 3300028381 Bacteria 10565
218 Ga0268264_10005728 3300028381 Bacteria 10532
219 Ga0268264_10238796 3300028381 Bacteria 1682
220 Ga0265334_10012767 3300028573 Bacteria 3525
221 Ga0316176_1043102 3300030732 Bacteria 1608
222 Ga0316183_1159766 3300030742 Bacteria 38773
223 Ga0316181_1003659 3300030744 Bacteria 18296
224 Ga0265327_10000034 3300031251 Bacteria 316018
225 Ga0265327_10000048 3300031251 Bacteria 269173
226 Ga0307509_10036024 3300031507 Bacteria 5423
227 Ga0307408_100016675 3300031548 Unclassified 4910
228 Ga0307408_100039741 3300031548 Bacteria 3328
229 Ga0316576_10109160 3300031727 Bacteria 2073
230 Ga0316576_10182300 3300031727 Bacteria 1584
231 Ga0307516_10000111 3300031730 Bacteria 94707
232 Ga0307516_10000579 3300031730 Bacteria 49479
233 Ga0307411_10096195 3300032005 Unclassified 2081
234 Ga0373956_0105938 3300035119 Unclassified 1307
235 Ga0373935_0134480 3300035692 Unclassified 1665
236 Ga0395900_0265939 3300037418 Bacteria 1711
237 Ga0400483_144337 3300039062 Bacteria 1494
238 Ga0436361_0666982 3300039447 Bacteria 10101
239 Ga0451577_0079256 3300042876 Unclassified 2928
240 Ga0453683_0045522 3300044673 Bacteria 2751
241 Ga0466965_0039268 3300044683 Bacteria 2327
242 Ga0466961_0091712 3300044693 Bacteria 1918
243 Ga0453684_0001568 3300044712 Bacteria 63367
244 Ga0453684_0039970 3300044712 Bacteria 6379
245 Ga0453684_0072195 3300044712 Bacteria 4359
246 Ga0453684_0134820 3300044712 Bacteria 2958
247 Ga0453684_0519930 3300044712 Bacteria 1315
248 Ga0466968_0024822 3300044735 Bacteria 2452
249 Ga0451576_0003300 3300045051 Bacteria 22416
250 Ga0451576_0034004 3300045051 Bacteria 5416
251 Ga0451576_0086893 3300045051 Bacteria 3253
252 Ga0466958_0245966 3300045836 Bacteria 1143
253 Ga0495627_011990 3300046453 Unclassified 3088
254 Ga0495627_028868 3300046453 Bacteria 1769
255 Ga0495638_0000003 3300046460 Bacteria 888792
256 Ga0495638_0116269 3300046460 Bacteria 1584
257 Ga0495580_0044599 3300046472 Bacteria 3153
258 Ga0495606_0000844 3300046507 Bacteria 46120
259 Ga0495606_0006996 3300046507 Bacteria 10241
260 Ga0495606_0008305 3300046507 Bacteria 9052
261 Ga0495610_0006279 3300046512 Bacteria 8227
262 Ga0495648_0008311 3300046524 Bacteria 8182
263 Ga0495652_0096825 3300046529 Bacteria 2402
264 Ga0495633_0000561 3300046558 Bacteria 36426
265 Ga0495633_0000869 3300046558 Bacteria 26201
266 Ga0495633_0002987 3300046558 Bacteria 11568
267 Ga0495661_0000114 3300046665 Bacteria 95935
268 Ga0495661_0039149 3300046665 Bacteria 2948
269 Ga0495658_0060542 3300046683 Unclassified 2172
270 Ga0495660_0017375 3300046810 Bacteria 4142
271 Ga0495672_0015626 3300047320 Bacteria 5146
272 Ga0495687_000244 3300047443 Bacteria 74586
273 Ga0495685_052705 3300047447 Bacteria 1378
274 Ga0495684_0279978 3300047471 Unclassified 1204
275 Ga0495686_0123147 3300047472 Bacteria 1543
276 Ga0496114_0142562 3300048917 Bacteria 2076
277 Ga0496126_0024324 3300048929 Bacteria 5849
278 Ga0501300_002591 3300049523 Unclassified 2713
279 Ga0501202_011837 3300049652 Bacteria 1639
280 Ga0501217_005369 3300049661 Bacteria 2676
281 Ga0501236_005544 3300049670 Bacteria 1528
282 Ga0501257_002432 3300049686 Unclassified 3922
283 Ga0501264_000237 3300049761 Bacteria 8866
284 nmdc:mga08y16_22620_c1 3300050511 Bacteria 6637
285 nmdc:mga08y16_47164_c1 3300050511 Bacteria 4510
286 nmdc:mga08y16_98780_c1 3300050511 Bacteria 3040
287 Ga0500646_0048112 3300053090 Unclassified 1222
288 Ga0500618_002968 3300053125 Bacteria 6055
289 Ga0500604_0020352 3300053151 Bacteria 1867
290 Ga0500616_0000007 3300053153 Bacteria 836875
291 Ga0500622_0000103 3300053156 Bacteria 86203
292 Ga0500622_0000181 3300053156 Bacteria 67823
293 Ga0500622_0000920 3300053156 Bacteria 24973
294 Ga0500622_0014483 3300053156 Bacteria 4233
295 Ga0500611_000007 3300053727 Bacteria 210964

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049661 Ga0501217_005369 Ga0501217_005369_873_1820 264
2 3300005335 Ga0070666_10104581 Ga0070666_101045812 269
3 3300047447 Ga0495685_052705 Ga0495685_052705_147_1166 271
4 3300044693 Ga0466961_0091712 Ga0466961_0091712_180_1154 287
5 3300045836 Ga0466958_0245966 Ga0466958_0245966_102_1076 287
6 3300048917 Ga0496114_0142562 Ga0496114_0142562_45_1016 288
7 3300044735 Ga0466968_0024822 Ga0466968_0024822_676_1716 290
8 3300009094 Ga0111539_10436531 Ga0111539_104365312 295
9 3300017792 Ga0163161_10002240 Ga0163161_1000224010 301
10 3300046453 Ga0495627_011990 Ga0495627_011990_1767_2702 301
11 3300046558 Ga0495633_0000869 Ga0495633_0000869_263_1198 301
12 3300013296 Ga0157374_10038944 Ga0157374_100389444 305
13 3300046453 Ga0495627_028868 Ga0495627_028868_751_1752 305
14 3300011119 Ga0105246_10074136 Ga0105246_100741363 307
15 3300013105 Ga0157369_10186038 Ga0157369_101860383 307
16 3300035119 Ga0373956_0105938 Ga0373956_0105938_69_1040 307
17 3300035692 Ga0373935_0134480 Ga0373935_0134480_314_1285 307
18 3300046472 Ga0495580_0044599 Ga0495580_0044599_232_1203 307
19 3300046683 Ga0495658_0060542 Ga0495658_0060542_405_1376 307
20 3300047471 Ga0495684_0279978 Ga0495684_0279978_130_1101 307
21 3300025250 Ga0209026_1000472 Ga0209026_100047217 308
22 3300030732 Ga0316176_1043102 Ga0316176_10431022 309
23 3300005335 Ga0070666_10018670 Ga0070666_100186704 310
24 3300025903 Ga0207680_10028848 Ga0207680_100288482 310
25 3300028573 Ga0265334_10012767 Ga0265334_100127673 311
26 3300025298 Ga0209050_1002677 Ga0209050_10026772 313
27 3300046460 Ga0495638_0000003 Ga0495638_0000003_229305_230273 313
28 3300053153 Ga0500616_0000007 Ga0500616_0000007_556925_557893 313
29 3300005455 Ga0070663_100007360 Ga0070663_1000073605 316
30 3300013104 Ga0157370_10136765 Ga0157370_101367652 316
31 3300013105 Ga0157369_10012709 Ga0157369_100127094 316
32 3300013307 Ga0157372_10000021 Ga0157372_10000021164 316
33 3300026067 Ga0207678_10043559 Ga0207678_100435593 316
34 3300046558 Ga0495633_0000561 Ga0495633_0000561_27183_28226 316
35 3300053090 Ga0500646_0048112 Ga0500646_0048112_91_1131 316
36 3300005843 Ga0068860_100007404 Ga0068860_1000074043 318
37 3300009093 Ga0105240_10011681 Ga0105240_100116815 318
38 3300009545 Ga0105237_10000323 Ga0105237_1000032321 318
39 3300010375 Ga0105239_10005924 Ga0105239_100059245 318
40 3300013306 Ga0163162_10292838 Ga0163162_102928382 318
41 3300014326 Ga0157380_10005894 Ga0157380_100058948 318
42 3300025914 Ga0207671_10002299 Ga0207671_1000229922 318
43 3300050511 nmdc:mga08y16_22620_c1 nmdc:mga08y16_22620_c1_1798_2781 318
44 iso_pu_bacteria 2977232053 2977233073 319
45 3300002067 JGI24735J21928_10001407 JGI24735J21928_100014075 320
46 3300013104 Ga0157370_10175564 Ga0157370_101755642 320
47 3300025261 Ga0209233_1002670 Ga0209233_10026707 320
48 3300025904 Ga0207647_10000159 Ga0207647_1000015929 320
49 3300026116 Ga0207674_10020090 Ga0207674_100200907 320
50 3300037418 Ga0395900_0265939 Ga0395900_0265939_23_1096 320
51 3300053125 Ga0500618_002968 Ga0500618_002968_2766_3872 322
52 iso_pu_bacteria 2842903701 2842906562 322
53 3300003322 rootL2_10225262 rootL2_102252622 324
54 3300013100 Ga0157373_10000545 Ga0157373_100005457 325
55 3300013102 Ga0157371_10000164 Ga0157371_1000016488 325
56 3300013307 Ga0157372_10000249 Ga0157372_1000024954 325
57 3300005539 Ga0068853_100004339 Ga0068853_10000433911 326
58 3300028381 Ga0268264_10000028 Ga0268264_1000002869 326
59 3300030742 Ga0316183_1159766 Ga0316183_11597663 326
60 3300030744 Ga0316181_1003659 Ga0316181_100365911 326
61 3300003316 rootH1_10009461 rootH1_100094612 327
62 3300005339 Ga0070660_100067674 Ga0070660_1000676742 327
63 3300005366 Ga0070659_100000407 Ga0070659_1000004075 327
64 3300025914 Ga0207671_10017382 Ga0207671_100173827 327
65 3300025932 Ga0207690_10022005 Ga0207690_100220055 327
66 3300003316 rootH1_10002094 rootH1_100020947 328
67 3300003320 rootH2_10003017 rootH2_1000301746 328
68 3300031251 Ga0265327_10000034 Ga0265327_1000003486 329
69 3300031507 Ga0307509_10036024 Ga0307509_100360245 329
70 3300042876 Ga0451577_0079256 Ga0451577_0079256_1627_2691 329
71 3300044712 Ga0453684_0134820 Ga0453684_0134820_1707_2771 329
72 3300044712 Ga0453684_0519930 Ga0453684_0519930_222_1250 329
73 3300045051 Ga0451576_0086893 Ga0451576_0086893_881_1945 329
74 3300003322 rootL2_10007072 rootL2_1000707210 330
75 3300053156 Ga0500622_0000103 Ga0500622_0000103_55151_56170 330
76 3300053156 Ga0500622_0000181 Ga0500622_0000181_30563_31582 330
77 3300003794 Ga0055531_10002422 Ga0055531_100024227 331
78 3300009093 Ga0105240_10000093 Ga0105240_1000009324 331
79 3300025304 Ga0209257_1000007 Ga0209257_10000071291 331
80 3300025913 Ga0207695_10000135 Ga0207695_10000135115 331
81 3300049523 Ga0501300_002591 Ga0501300_002591_625_1785 331
82 3300005843 Ga0068860_100000003 Ga0068860_100000003425 332
83 3300009553 Ga0105249_10079440 Ga0105249_100794402 332
84 3300013306 Ga0163162_10001628 Ga0163162_1000162812 332
85 3300048929 Ga0496126_0024324 Ga0496126_0024324_2592_3644 332
86 3300053156 Ga0500622_0000920 Ga0500622_0000920_16179_17225 332
87 iso_pu_bacteria 2919692658 2919696511 332
88 3300005328 Ga0070676_10000105 Ga0070676_1000010521 333
89 3300005335 Ga0070666_10028595 Ga0070666_100285954 333
90 3300005337 Ga0070682_100048644 Ga0070682_1000486441 333
91 3300005338 Ga0068868_100004880 Ga0068868_1000048807 333
92 3300005344 Ga0070661_100043436 Ga0070661_1000434363 333
93 3300005347 Ga0070668_100000189 Ga0070668_10000018930 333
94 3300005364 Ga0070673_100000051 Ga0070673_10000005149 333
95 3300005367 Ga0070667_100001060 Ga0070667_10000106017 333
96 3300005457 Ga0070662_100001209 Ga0070662_1000012096 333
97 3300005459 Ga0068867_100001965 Ga0068867_1000019659 333
98 3300005543 Ga0070672_100000795 Ga0070672_10000079510 333
99 3300005548 Ga0070665_100000047 Ga0070665_100000047167 333
100 3300005548 Ga0070665_100003694 Ga0070665_1000036942 333
101 3300005563 Ga0068855_100017492 Ga0068855_1000174927 333
102 3300005564 Ga0070664_100105345 Ga0070664_1001053454 333
103 3300005578 Ga0068854_100152713 Ga0068854_1001527132 333
104 3300005618 Ga0068864_100000441 Ga0068864_10000044119 333
105 3300005719 Ga0068861_100137125 Ga0068861_1001371252 333
106 3300005834 Ga0068851_10009145 Ga0068851_100091452 333
107 3300005841 Ga0068863_100003174 Ga0068863_1000031742 333
108 3300005842 Ga0068858_100002665 Ga0068858_10000266521 333
109 3300005843 Ga0068860_100008661 Ga0068860_1000086614 333
110 3300006237 Ga0097621_100001237 Ga0097621_1000012375 333
111 3300006358 Ga0068871_100002428 Ga0068871_1000024288 333
112 3300006881 Ga0068865_100002242 Ga0068865_1000022425 333
113 3300009176 Ga0105242_10039570 Ga0105242_100395704 333
114 3300009177 Ga0105248_10080758 Ga0105248_100807584 333
115 3300010375 Ga0105239_10084199 Ga0105239_100841992 333
116 3300013296 Ga0157374_10010173 Ga0157374_100101735 333
117 3300013297 Ga0157378_10022781 Ga0157378_100227815 333
118 3300013306 Ga0163162_10000567 Ga0163162_1000056719 333
119 3300013308 Ga0157375_10001725 Ga0157375_100017259 333
120 3300014968 Ga0157379_10000253 Ga0157379_100002537 333
121 3300014969 Ga0157376_10000630 Ga0157376_1000063018 333
122 3300017792 Ga0163161_10002978 Ga0163161_100029789 333
123 3300025321 Ga0207656_10005198 Ga0207656_100051985 333
124 3300025903 Ga0207680_10001073 Ga0207680_1000107316 333
125 3300025907 Ga0207645_10000335 Ga0207645_1000033536 333
126 3300025920 Ga0207649_10046741 Ga0207649_100467414 333
127 3300025933 Ga0207706_10011158 Ga0207706_100111585 333
128 3300025938 Ga0207704_10001685 Ga0207704_100016851 333
129 3300025940 Ga0207691_10000010 Ga0207691_1000001051 333
130 3300025942 Ga0207689_10089685 Ga0207689_100896852 333
131 3300025960 Ga0207651_10000470 Ga0207651_1000047010 333
132 3300025972 Ga0207668_10000674 Ga0207668_1000067422 333
133 3300025981 Ga0207640_10187058 Ga0207640_101870581 333
134 3300025986 Ga0207658_10001882 Ga0207658_1000188218 333
135 3300026023 Ga0207677_10019751 Ga0207677_100197512 333
136 3300026035 Ga0207703_10001274 Ga0207703_1000127419 333
137 3300026088 Ga0207641_10007531 Ga0207641_100075312 333
138 3300026089 Ga0207648_10025159 Ga0207648_100251593 333
139 3300026095 Ga0207676_10005450 Ga0207676_100054505 333
140 3300026118 Ga0207675_100147956 Ga0207675_1001479563 333
141 3300026121 Ga0207683_10040691 Ga0207683_100406914 333
142 3300028379 Ga0268266_10000104 Ga0268266_1000010478 333
143 3300028379 Ga0268266_10004570 Ga0268266_100045703 333
144 3300028381 Ga0268264_10005691 Ga0268264_100056915 333
145 3300044712 Ga0453684_0001568 Ga0453684_0001568_47857_48900 333
146 3300044712 Ga0453684_0039970 Ga0453684_0039970_636_1718 333
147 3300044712 Ga0453684_0072195 Ga0453684_0072195_76_1203 333
148 3300045051 Ga0451576_0003300 Ga0451576_0003300_6004_7086 333
149 3300046460 Ga0495638_0116269 Ga0495638_0116269_26_1111 333
150 3300046524 Ga0495648_0008311 Ga0495648_0008311_3440_4525 333
151 3300047443 Ga0495687_000244 Ga0495687_000244_9289_10374 333
152 3300003354 JGI25160J50197_1007109 JGI25160J50197_10071094 334
153 3300005367 Ga0070667_100020647 Ga0070667_1000206476 334
154 3300005843 Ga0068860_100007895 Ga0068860_1000078955 334
155 3300025986 Ga0207658_10011132 Ga0207658_100111323 334
156 3300028381 Ga0268264_10005728 Ga0268264_100057285 334
157 3300039062 Ga0400483_144337 Ga0400483_144337_141_1256 334
158 3300044683 Ga0466965_0039268 Ga0466965_0039268_176_1237 334
159 3300003316 rootH1_10071627 rootH1_100716274 335
160 3300003320 rootH2_10281941 rootH2_102819412 335
161 3300003322 rootL2_10010510 rootL2_1001051011 335
162 3300003322 rootL2_10166230 rootL2_101662302 335
163 3300005331 Ga0070670_100177517 Ga0070670_1001775172 335
164 3300005334 Ga0068869_100079317 Ga0068869_1000793173 335
165 3300005347 Ga0070668_100098263 Ga0070668_1000982631 335
166 3300005353 Ga0070669_100124580 Ga0070669_1001245801 335
167 3300005354 Ga0070675_100019608 Ga0070675_1000196087 335
168 3300005543 Ga0070672_100311594 Ga0070672_1003115942 335
169 3300005563 Ga0068855_100511168 Ga0068855_1005111681 335
170 3300005577 Ga0068857_100026643 Ga0068857_1000266432 335
171 3300005617 Ga0068859_100013318 Ga0068859_1000133186 335
172 3300005719 Ga0068861_100037873 Ga0068861_1000378734 335
173 3300006844 Ga0075428_100064728 Ga0075428_1000647283 335
174 3300006931 Ga0097620_100013319 Ga0097620_1000133196 335
175 3300009094 Ga0111539_10005186 Ga0111539_100051863 335
176 3300009094 Ga0111539_10005240 Ga0111539_100052407 335
177 3300013306 Ga0163162_10054534 Ga0163162_100545344 335
178 3300014326 Ga0157380_10043754 Ga0157380_100437542 335
179 3300025908 Ga0207643_10062126 Ga0207643_100621262 335
180 3300025923 Ga0207681_10023034 Ga0207681_100230342 335
181 3300025933 Ga0207706_10009126 Ga0207706_100091262 335
182 3300025961 Ga0207712_10021652 Ga0207712_100216522 335
183 3300026089 Ga0207648_10022534 Ga0207648_100225346 335
184 3300026116 Ga0207674_10025618 Ga0207674_100256186 335
185 3300026118 Ga0207675_100032117 Ga0207675_1000321172 335
186 3300027907 Ga0207428_10053031 Ga0207428_100530313 335
187 3300028380 Ga0268265_10110333 Ga0268265_101103332 335
188 3300031251 Ga0265327_10000048 Ga0265327_10000048197 335
189 3300031730 Ga0307516_10000579 Ga0307516_1000057927 335
190 3300050511 nmdc:mga08y16_47164_c1 nmdc:mga08y16_47164_c1_3124_4179 335
191 3300050511 nmdc:mga08y16_98780_c1 nmdc:mga08y16_98780_c1_825_1865 335
192 3300005456 Ga0070678_100015832 Ga0070678_1000158323 336
193 3300026121 Ga0207683_10116684 Ga0207683_101166842 336
194 3300003781 Ga0055536_1008939 Ga0055536_10089394 337
195 3300005262 Ga0065165_1000078 Ga0065165_100007886 337
196 3300005336 Ga0070680_100025412 Ga0070680_1000254124 337
197 3300009093 Ga0105240_10102969 Ga0105240_101029692 337
198 3300009545 Ga0105237_10000671 Ga0105237_1000067137 337
199 3300010375 Ga0105239_10000017 Ga0105239_10000017117 337
200 3300013308 Ga0157375_10019275 Ga0157375_100192755 337
201 3300025292 Ga0209676_1000616 Ga0209676_100061619 337
202 3300025921 Ga0207652_10009537 Ga0207652_1000953710 337
203 3300046810 Ga0495660_0017375 Ga0495660_0017375_848_1891 337
204 3300009174 Ga0105241_10013552 Ga0105241_100135523 338
205 3300031730 Ga0307516_10000111 Ga0307516_1000011119 338
206 3300003320 rootH2_10007509 rootH2_100075098 339
207 3300003322 rootL2_10162655 rootL2_101626555 339
208 3300003794 Ga0055531_10000210 Ga0055531_1000021043 339
209 3300005563 Ga0068855_100000224 Ga0068855_1000002249 339
210 3300005616 Ga0068852_100071984 Ga0068852_1000719842 339
211 3300009545 Ga0105237_10154006 Ga0105237_101540061 339
212 3300009553 Ga0105249_10244868 Ga0105249_102448682 339
213 3300010375 Ga0105239_10103650 Ga0105239_101036503 339
214 3300013306 Ga0163162_10027621 Ga0163162_100276213 339
215 3300021361 Ga0213872_10010671 Ga0213872_100106713 339
216 3300025272 Ga0209455_1005623 Ga0209455_10056235 339
217 3300025304 Ga0209257_1000025 Ga0209257_1000025132 339
218 3300025949 Ga0207667_10000266 Ga0207667_1000026671 339
219 3300026142 Ga0207698_10053050 Ga0207698_100530503 339
220 3300031548 Ga0307408_100016675 Ga0307408_1000166752 339
221 3300031727 Ga0316576_10182300 Ga0316576_101823002 339
222 3300039447 Ga0436361_0666982 Ga0436361_0666982_2218_3261 339
223 3300046507 Ga0495606_0006996 Ga0495606_0006996_6202_7254 339
224 3300047472 Ga0495686_0123147 Ga0495686_0123147_124_1176 339
225 3300049670 Ga0501236_005544 Ga0501236_005544_314_1363 339
226 3300049686 Ga0501257_002432 Ga0501257_002432_672_1721 339
227 3300031727 Ga0316576_10109160 Ga0316576_101091602 340
228 3300053727 Ga0500611_000007 Ga0500611_000007_187032_188114 340
229 3300003323 rootH1_10077232 rootH1_100772321 341
230 3300009174 Ga0105241_10055914 Ga0105241_100559141 341
231 3300011119 Ga0105246_10023047 Ga0105246_100230473 341
232 3300013306 Ga0163162_10279890 Ga0163162_102798902 341
233 3300014325 Ga0163163_10097528 Ga0163163_100975282 341
234 3300014326 Ga0157380_10075497 Ga0157380_100754971 341
235 3300014969 Ga0157376_10332036 Ga0157376_103320362 341
236 3300003322 rootL2_10217296 rootL2_102172964 342
237 3300003323 rootH1_10038086 rootH1_100380863 342
238 3300032005 Ga0307411_10096195 Ga0307411_100961952 343
239 3300014326 Ga0157380_10034390 Ga0157380_100343904 344
240 3300047320 Ga0495672_0015626 Ga0495672_0015626_2321_3538 345
241 3300053156 Ga0500622_0014483 Ga0500622_0014483_821_1894 345
242 iso_pu_bacteria 2839989709 2839991945 345
243 3300053151 Ga0500604_0020352 Ga0500604_0020352_580_1650 346
244 3300005328 Ga0070676_10009396 Ga0070676_100093965 348
245 3300005334 Ga0068869_100042793 Ga0068869_1000427933 348
246 3300005335 Ga0070666_10111084 Ga0070666_101110842 348
247 3300005338 Ga0068868_100019067 Ga0068868_1000190672 348
248 3300005347 Ga0070668_100069739 Ga0070668_1000697392 348
249 3300005364 Ga0070673_100029778 Ga0070673_1000297783 348
250 3300005367 Ga0070667_100007775 Ga0070667_1000077753 348
251 3300005456 Ga0070678_100024187 Ga0070678_1000241872 348
252 3300005459 Ga0068867_100029732 Ga0068867_1000297323 348
253 3300005548 Ga0070665_100013114 Ga0070665_1000131142 348
254 3300005617 Ga0068859_100069932 Ga0068859_1000699323 348
255 3300005719 Ga0068861_100359472 Ga0068861_1003594721 348
256 3300005843 Ga0068860_100052990 Ga0068860_1000529903 348
257 3300006237 Ga0097621_100041783 Ga0097621_1000417833 348
258 3300006931 Ga0097620_100069931 Ga0097620_1000699313 348
259 3300013100 Ga0157373_10015773 Ga0157373_100157732 348
260 3300013102 Ga0157371_10035647 Ga0157371_100356472 348
261 3300013307 Ga0157372_10016245 Ga0157372_100162457 348
262 3300025908 Ga0207643_10006773 Ga0207643_100067731 348
263 3300025923 Ga0207681_10054424 Ga0207681_100544243 348
264 3300025940 Ga0207691_10015989 Ga0207691_100159893 348
265 3300025960 Ga0207651_10031091 Ga0207651_100310912 348
266 3300025972 Ga0207668_10048680 Ga0207668_100486803 348
267 3300026023 Ga0207677_10078219 Ga0207677_100782192 348
268 3300026089 Ga0207648_10012748 Ga0207648_100127484 348
269 3300026118 Ga0207675_100012217 Ga0207675_1000122173 348
270 3300026121 Ga0207683_10003245 Ga0207683_1000324513 348
271 3300028380 Ga0268265_10088966 Ga0268265_100889662 348
272 3300028381 Ga0268264_10238796 Ga0268264_102387961 348
273 iso_pu_bacteria 2739367663 2739648243 349
274 3300005364 Ga0070673_100370515 Ga0070673_1003705151 350
275 3300006237 Ga0097621_100361019 Ga0097621_1003610191 350
276 3300006358 Ga0068871_100106049 Ga0068871_1001060492 350
277 3300013306 Ga0163162_10209190 Ga0163162_102091902 350
278 3300017792 Ga0163161_10075477 Ga0163161_100754772 350
279 3300025960 Ga0207651_10161578 Ga0207651_101615782 350
280 3300031548 Ga0307408_100039741 Ga0307408_1000397415 350
281 3300049652 Ga0501202_011837 Ga0501202_011837_265_1425 350
282 3300049761 Ga0501264_000237 Ga0501264_000237_6840_8000 350
283 3300014326 Ga0157380_10004475 Ga0157380_100044757 351
284 3300044673 Ga0453683_0045522 Ga0453683_0045522_1567_2706 356
285 3300045051 Ga0451576_0034004 Ga0451576_0034004_1706_2845 356
286 3300003320 rootH2_10148617 rootH2_101486173 358
287 iso_pu_bacteria 2929154850 2929158378 358
288 3300046665 Ga0495661_0000114 Ga0495661_0000114_75952_77115 361
289 3300046512 Ga0495610_0006279 Ga0495610_0006279_3372_4466 364
290 3300046558 Ga0495633_0002987 Ga0495633_0002987_6017_7111 364
291 3300046665 Ga0495661_0039149 Ga0495661_0039149_1801_2895 364
292 3300003316 rootH1_10096175 rootH1_100961755 365
293 iso_pu_bacteria 2977232053 2977235823 366
294 3300001989 JGI24739J22299_10002004 JGI24739J22299_100020042 371
295 3300003322 rootL2_10086237 rootL2_100862373 371
296 3300013306 Ga0163162_10089649 Ga0163162_100896493 371
297 3300026041 Ga0207639_10027748 Ga0207639_100277483 371
298 3300046507 Ga0495606_0000844 Ga0495606_0000844_10021_11136 371
299 3300046507 Ga0495606_0008305 Ga0495606_0008305_5577_6704 371
300 3300046529 Ga0495652_0096825 Ga0495652_0096825_1225_2340 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

208

287

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1th8-assembly1.cif.gz_A-2 crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.6905 266 356
6swk-assembly1.cif.gz_A-2 the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus 0.6876 176 357
7kjh-assembly2.cif.gz_D plasmodium falciparum protein pf12p bound to nanobody b9 0.6835 330 356
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.6805 222 357
6swj-assembly1.cif.gz_A-2 the kinase domain of gans, a histidine kinase from geobacillus stearothermophilus (with pt) 0.6761 176 357
ID Description Score Start End Superfamily
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8188 223 356 3.30.565.10
af_P0AD14_423_557_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8023 223 356 3.30.565.10
af_Q2G1E0_342_515_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7834 198 359 3.30.565.10
af_Q53705_433_584_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7622 223 362 3.30.565.10
af_P0AA93_414_560_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.7559 222 358 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A537J3P1-F1-model_v4 GHKL domain-containing protein 0.9208 231 357
AF-A0A537J3P1-F1-model_v4 GHKL domain-containing protein 0.914 231 357
AF-A0A2W6V2W6-F1-model_v4 Histidine kinase 0.8979 207 357 GO:0000155
GO:0016020
AF-A0A2W6V2W6-F1-model_v4 Histidine kinase 0.8656 207 357 GO:0000155
GO:0016020
AF-A0A497DP08-F1-model_v4 Signal transduction histidine kinase internal region domain-containing protein 0.8564 150 356 GO:0000155
GO:0016020

Feature Viewer

pLDDT pTM Quality
76.76 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map