F395543

General Info

Members Datasets Scaffolds Average Seq Length
300 162 600 207

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0243118|Ga0495645_0243118_386_1099
Length 229
Sequence MVAYRSSKSDDGSLIPRSRADLRRGFTMEVAMNAQEHWEKIYGTKSPDRVSWFRPHLETSLVLVERAARADRSASIIDVGGGASTLVDDLIERGYLNVTILDISQAAHEAAKGVRWLRADVTQSNFPQRSFDVWHDRAVFHFLTRPEDRLAYVRNVATTVKPGGHVIVSTFGPEGPTKCSGLDVVRYDAESLHEEFGSRFRLVESLKELHDTPFGTAQQFLYCYCALEQ

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.33
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 22.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0243118 3300046543 Unclassified 1200
2 Ga0070658_10104542 3300005327 Unclassified 2343
3 Ga0070683_100006647 3300005329 Bacteria 9711
4 Ga0070683_100932628 3300005329 Bacteria 833
5 Ga0070670_100249466 3300005331 Unclassified 1546
6 Ga0068869_100045128 3300005334 Bacteria 3172
7 Ga0068869_100322362 3300005334 Unclassified 1253
8 Ga0068868_100075810 3300005338 Bacteria 2688
9 Ga0068868_100388296 3300005338 Bacteria 1202
10 Ga0070660_100111667 3300005339 Bacteria 2175
11 Ga0070691_10137732 3300005341 Bacteria 1241
12 Ga0070687_100160299 3300005343 Bacteria 1329
13 Ga0070671_100019413 3300005355 Bacteria 5530
14 Ga0070659_100067140 3300005366 Bacteria 2844
15 Ga0070713_100005388 3300005436 Bacteria 8739
16 Ga0070710_10347611 3300005437 Unclassified 981
17 Ga0070701_10058081 3300005438 Bacteria 2029
18 Ga0070711_100228084 3300005439 Bacteria 1451
19 Ga0070694_100199736 3300005444 Bacteria 1490
20 Ga0070708_100045353 3300005445 Bacteria 3872
21 Ga0070708_100086846 3300005445 Bacteria 2842
22 Ga0070708_100277813 3300005445 Bacteria 1576
23 Ga0070708_100362973 3300005445 Bacteria 1365
24 Ga0070678_100253944 3300005456 Bacteria 1475
25 Ga0070662_100107218 3300005457 Bacteria 2123
26 Ga0070681_10222271 3300005458 Bacteria 1804
27 Ga0068867_100047486 3300005459 Unclassified 3156
28 Ga0070706_100017516 3300005467 Bacteria 6612
29 Ga0070706_100109970 3300005467 Bacteria 2564
30 Ga0070706_100302055 3300005467 Unclassified 1493
31 Ga0070706_100562425 3300005467 Bacteria 1060
32 Ga0070707_100005338 3300005468 Bacteria 12033
33 Ga0070707_100189456 3300005468 Unclassified 2005
34 Ga0070707_100316793 3300005468 Unclassified 1516
35 Ga0070707_100323438 3300005468 Bacteria 1499
36 Ga0070698_100468486 3300005471 Unclassified 1196
37 Ga0070699_100158821 3300005518 Bacteria 2000
38 Ga0070699_100262869 3300005518 Bacteria 1543
39 Ga0070699_100365824 3300005518 Bacteria 1301
40 Ga0070699_100421983 3300005518 Unclassified 1207
41 Ga0070699_100915866 3300005518 Bacteria 803
42 Ga0070699_101034223 3300005518 Unclassified 753
43 Ga0070679_100226113 3300005530 Unclassified 1831
44 Ga0070679_101130541 3300005530 Unclassified 728
45 Ga0070684_100120039 3300005535 Bacteria 2365
46 Ga0070697_100009751 3300005536 Bacteria 7490
47 Ga0070697_100010298 3300005536 Bacteria 7289
48 Ga0070697_100150574 3300005536 Unclassified 1961
49 Ga0070686_100001459 3300005544 Bacteria 13342
50 Ga0070686_100069936 3300005544 Bacteria 2294
51 Ga0070665_100043361 3300005548 Bacteria 4521
52 Ga0070665_100129773 3300005548 Bacteria 2523
53 Ga0070704_100057356 3300005549 Bacteria 2769
54 Ga0070704_100827543 3300005549 Bacteria 829
55 Ga0068855_100005187 3300005563 Bacteria 15892
56 Ga0068855_100104458 3300005563 Bacteria 3259
57 Ga0068855_100704718 3300005563 Bacteria 1080
58 Ga0068855_100933160 3300005563 Unclassified 915
59 Ga0070664_100210305 3300005564 Bacteria 1738
60 Ga0068857_100008997 3300005577 Bacteria 8656
61 Ga0068854_100009261 3300005578 Bacteria 6356
62 Ga0068856_100146549 3300005614 Bacteria 2368
63 Ga0068856_100174113 3300005614 Bacteria 2165
64 Ga0068852_100064170 3300005616 Bacteria 3201
65 Ga0068859_100005437 3300005617 Bacteria 12953
66 Ga0068864_100001206 3300005618 Bacteria 21457
67 Ga0068864_100134174 3300005618 Bacteria 2227
68 Ga0068864_100268872 3300005618 Bacteria 1588
69 Ga0068866_10050545 3300005718 Bacteria 2112
70 Ga0068866_10212528 3300005718 Bacteria 1162
71 Ga0068863_100017991 3300005841 Bacteria 6765
72 Ga0068863_100059848 3300005841 Unclassified 3604
73 Ga0068863_101057523 3300005841 Unclassified 815
74 Ga0068858_100056279 3300005842 Bacteria 3636
75 Ga0068860_100005190 3300005843 Bacteria 13240
76 Ga0068860_100456261 3300005843 Bacteria 1271
77 Ga0070717_10040307 3300006028 Bacteria 3804
78 Ga0070717_10126133 3300006028 Unclassified 2198
79 Ga0070717_10232685 3300006028 Bacteria 1623
80 Ga0070717_10401952 3300006028 Bacteria 1231
81 Ga0070717_10542966 3300006028 Unclassified 1052
82 Ga0070716_100475970 3300006173 Bacteria 916
83 Ga0070712_100044782 3300006175 Bacteria 3052
84 Ga0070712_100091117 3300006175 Bacteria 2233
85 Ga0070712_100130654 3300006175 Bacteria 1903
86 Ga0097621_100235309 3300006237 Bacteria 1600
87 Ga0068871_100020791 3300006358 Bacteria 5033
88 Ga0068871_100062267 3300006358 Bacteria 3048
89 Ga0068871_100064682 3300006358 Bacteria 2995
90 Ga0068865_100001646 3300006881 Bacteria 13097
91 Ga0097620_100005437 3300006931 Bacteria 12953
92 Ga0099794_10002066 3300007265 Bacteria 7285
93 Ga0099794_10004346 3300007265 Bacteria 5550
94 Ga0099794_10083560 3300007265 Bacteria 1578
95 Ga0099794_10097436 3300007265 Bacteria 1465
96 Ga0099794_10196093 3300007265 Bacteria 1033
97 Ga0099795_10003270 3300007788 Unclassified 3987
98 Ga0099795_10031654 3300007788 Bacteria 1823
99 Ga0099795_10037684 3300007788 Bacteria 1703
100 Ga0099795_10116391 3300007788 Bacteria 1064
101 Ga0111539_10003145 3300009094 Bacteria 21833
102 Ga0111539_10079089 3300009094 Bacteria 3868
103 Ga0105245_10012374 3300009098 Bacteria 7426
104 Ga0105245_10053072 3300009098 Bacteria 3638
105 Ga0105245_10169051 3300009098 Bacteria 2081
106 Ga0105247_10239538 3300009101 Unclassified 1236
107 Ga0105243_10006662 3300009148 Bacteria 8918
108 Ga0105243_10085809 3300009148 Bacteria 2581
109 Ga0105241_10014349 3300009174 Bacteria 5801
110 Ga0105241_10293862 3300009174 Unclassified 1392
111 Ga0105241_10376395 3300009174 Bacteria 1239
112 Ga0105242_10007819 3300009176 Bacteria 8229
113 Ga0105242_10014193 3300009176 Bacteria 6167
114 Ga0105242_10141093 3300009176 Bacteria 2091
115 Ga0105242_10232596 3300009176 Bacteria 1652
116 Ga0105248_10007939 3300009177 Bacteria 11664
117 Ga0105248_10011908 3300009177 Bacteria 9594
118 Ga0105248_10102617 3300009177 Bacteria 3224
119 Ga0105248_10362639 3300009177 Bacteria 1631
120 Ga0105237_10109720 3300009545 Unclassified 2751
121 Ga0105237_10123727 3300009545 Bacteria 2581
122 Ga0105238_10008111 3300009551 Bacteria 10503
123 Ga0105238_10015769 3300009551 Bacteria 7650
124 Ga0105238_10078376 3300009551 Bacteria 3294
125 Ga0105249_10217911 3300009553 Bacteria 1877
126 Ga0105249_10385294 3300009553 Bacteria 1429
127 Ga0099796_10029095 3300010159 Bacteria 1779
128 Ga0099796_10034835 3300010159 Bacteria 1665
129 Ga0105239_10008936 3300010375 Bacteria 11336
130 Ga0105239_10289617 3300010375 Bacteria 1844
131 Ga0105246_10608473 3300011119 Bacteria 945
132 Ga0157373_10359286 3300013100 Unclassified 1039
133 Ga0157370_10023609 3300013104 Bacteria 6104
134 Ga0157370_10068565 3300013104 Bacteria 3352
135 Ga0157369_10024932 3300013105 Bacteria 6646
136 Ga0157369_10472334 3300013105 Bacteria 1298
137 Ga0157374_10104724 3300013296 Unclassified 2716
138 Ga0157374_10124221 3300013296 Bacteria 2493
139 Ga0157374_10147596 3300013296 Bacteria 2285
140 Ga0157378_10004965 3300013297 Bacteria 11664
141 Ga0157378_10036633 3300013297 Bacteria 4341
142 Ga0157378_10072177 3300013297 Bacteria 3102
143 Ga0157378_10160246 3300013297 Bacteria 2103
144 Ga0157378_10654367 3300013297 Unclassified 1067
145 Ga0157378_10794811 3300013297 Bacteria 971
146 Ga0163162_10002384 3300013306 Bacteria 17661
147 Ga0163162_10172135 3300013306 Unclassified 2290
148 Ga0157372_10002894 3300013307 Bacteria 18560
149 Ga0157372_10003150 3300013307 Bacteria 17790
150 Ga0157372_10498871 3300013307 Bacteria 1419
151 Ga0163163_10011896 3300014325 Bacteria 7915
152 Ga0163163_10046014 3300014325 Bacteria 4285
153 Ga0163163_10082965 3300014325 Unclassified 3210
154 Ga0163163_10172859 3300014325 Bacteria 2207
155 Ga0163163_10192193 3300014325 Bacteria 2089
156 Ga0163163_11477541 3300014325 Unclassified 741
157 Ga0157376_10145031 3300014969 Bacteria 2134
158 Ga0157376_10892236 3300014969 Unclassified 907
159 Ga0157376_11346200 3300014969 Unclassified 745
160 Ga0207654_10062797 3300025911 Bacteria 2178
161 Ga0207707_10174139 3300025912 Bacteria 1880
162 Ga0207695_10011773 3300025913 Bacteria 10568
163 Ga0207671_10010642 3300025914 Bacteria 7567
164 Ga0207693_10001215 3300025915 Bacteria 22979
165 Ga0207693_10136904 3300025915 Bacteria 1925
166 Ga0207663_10232071 3300025916 Unclassified 1349
167 Ga0207657_10265417 3300025919 Bacteria 1365
168 Ga0207646_10353408 3300025922 Unclassified 1328
169 Ga0207694_10006093 3300025924 Bacteria 9218
170 Ga0207694_10106755 3300025924 Bacteria 2224
171 Ga0207694_10128868 3300025924 Bacteria 2026
172 Ga0207650_10001986 3300025925 Bacteria 14342
173 Ga0207650_10638802 3300025925 Bacteria 897
174 Ga0207687_10313652 3300025927 Unclassified 1267
175 Ga0207700_10108554 3300025928 Bacteria 2228
176 Ga0207700_10137144 3300025928 Bacteria 2006
177 Ga0207664_10607235 3300025929 Bacteria 982
178 Ga0207690_10149291 3300025932 Bacteria 1731
179 Ga0207706_10021247 3300025933 Bacteria 5831
180 Ga0207686_10007676 3300025934 Bacteria 5815
181 Ga0207686_10014920 3300025934 Unclassified 4337
182 Ga0207686_10087053 3300025934 Bacteria 2054
183 Ga0207709_10023243 3300025935 Bacteria 3526
184 Ga0207704_10010011 3300025938 Unclassified 4602
185 Ga0207711_10102041 3300025941 Bacteria 2539
186 Ga0207711_10408756 3300025941 Unclassified 1261
187 Ga0207689_10076543 3300025942 Bacteria 2750
188 Ga0207661_10051432 3300025944 Bacteria 3287
189 Ga0207661_10292036 3300025944 Bacteria 1459
190 Ga0207661_10527994 3300025944 Bacteria 1080
191 Ga0207667_10006885 3300025949 Bacteria 13735
192 Ga0207667_10063274 3300025949 Unclassified 3865
193 Ga0207667_11128931 3300025949 Unclassified 766
194 Ga0207640_10032440 3300025981 Unclassified 3239
195 Ga0207677_10373111 3300026023 Bacteria 1202
196 Ga0207702_10096176 3300026078 Bacteria 2604
197 Ga0207702_10179725 3300026078 Bacteria 1947
198 Ga0207641_10006807 3300026088 Bacteria 9574
199 Ga0207641_10835271 3300026088 Bacteria 912
200 Ga0207648_10059368 3300026089 Unclassified 3336
201 Ga0207676_10002163 3300026095 Bacteria 14184
202 Ga0207676_10348664 3300026095 Bacteria 1368
203 Ga0207674_10002402 3300026116 Bacteria 23626
204 Ga0207698_10031382 3300026142 Bacteria 3834
205 Ga0209179_1037312 3300027512 Bacteria 1014
206 Ga0210002_1014423 3300027617 Bacteria 1239
207 Ga0209588_1057432 3300027671 Bacteria 1258
208 Ga0207428_10030328 3300027907 Unclassified 4471
209 Ga0268264_10018340 3300028381 Bacteria 5722
210 Ga0268264_10246500 3300028381 Bacteria 1657
211 Ga0265338_10136233 3300028800 Unclassified 1930
212 Ga0265338_10356532 3300028800 Unclassified 1050
213 Ga0265328_10012596 3300031239 Unclassified 3363
214 Ga0265339_10000055 3300031249 Bacteria 99907
215 Ga0265314_10058595 3300031711 Bacteria 2638
216 Ga0265342_10031372 3300031712 Unclassified 3285
217 Ga0307410_10130845 3300031852 Bacteria 1843
218 Ga0373926_0003366 3300035083 Bacteria 5147
219 Ga0373954_0029929 3300035118 Unclassified 2511
220 Ga0373954_0107070 3300035118 Unclassified 1351
221 Ga0373956_0000543 3300035119 Bacteria 15424
222 Ga0373946_0003754 3300035171 Bacteria 5389
223 Ga0373955_0062043 3300035172 Bacteria 2066
224 Ga0373935_0323150 3300035692 Bacteria 1095
225 Ga0373927_0000325 3300035695 Bacteria 37534
226 Ga0373927_0120433 3300035695 Bacteria 1713
227 Ga0373933_0001956 3300035724 Bacteria 11878
228 Ga0373933_0181946 3300035724 Bacteria 1341
229 Ga0373933_0227537 3300035724 Bacteria 1197
230 Ga0373947_0006624 3300035725 Bacteria 6724
231 Ga0373937_0001643 3300036401 Bacteria 18796
232 Ga0373937_0017056 3300036401 Bacteria 6459
233 Ga0373937_0197166 3300036401 Unclassified 1892
234 Ga0373937_1297940 3300036401 Bacteria 676
235 Ga0373925_0001428 3300037068 Bacteria 20688
236 Ga0453684_0597711 3300044712 Unclassified 1210
237 Ga0495651_0001232 3300046462 Bacteria 19780
238 Ga0495651_0033201 3300046462 Bacteria 4025
239 Ga0495653_0006894 3300046463 Bacteria 9339
240 Ga0495664_0046828 3300046477 Bacteria 2566
241 Ga0495664_0285346 3300046477 Unclassified 997
242 Ga0495608_0009451 3300046511 Bacteria 6816
243 Ga0495608_0264843 3300046511 Bacteria 1069
244 Ga0495608_0268871 3300046511 Bacteria 1060
245 Ga0495628_0000057 3300046516 Bacteria 89094
246 Ga0495628_0089973 3300046516 Unclassified 2376
247 Ga0495630_0037541 3300046517 Bacteria 3623
248 Ga0495666_0221420 3300046526 Unclassified 866
249 Ga0495652_0004089 3300046529 Bacteria 14082
250 Ga0495652_0229289 3300046529 Unclassified 1390
251 Ga0495652_0590196 3300046529 Unclassified 759
252 Ga0495640_0262364 3300046533 Unclassified 1079
253 Ga0495587_0002214 3300046536 Bacteria 13003
254 Ga0495587_0062593 3300046536 Unclassified 2178
255 Ga0495645_0032258 3300046543 Bacteria 3820
256 Ga0495667_0006553 3300046559 Bacteria 7904
257 Ga0495667_0193958 3300046559 Unclassified 1301
258 Ga0495635_0126605 3300046663 Bacteria 1742
259 Ga0495635_0151645 3300046663 Unclassified 1578
260 Ga0495657_0006523 3300046675 Bacteria 9124
261 Ga0495657_0071219 3300046675 Bacteria 2270
262 Ga0495600_0005208 3300046809 Bacteria 7819
263 Ga0495600_0198698 3300046809 Bacteria 1288
264 Ga0495604_0012262 3300047317 Bacteria 6814
265 Ga0495604_0095713 3300047317 Bacteria 2193
266 Ga0495674_0007261 3300047319 Bacteria 10604
267 Ga0495674_0355510 3300047319 Unclassified 1188
268 Ga0495680_0001156 3300047322 Bacteria 29106
269 Ga0495680_0054963 3300047322 Bacteria 3089
270 Ga0495680_0115712 3300047322 Unclassified 1984
271 Ga0495675_0000852 3300047444 Bacteria 18630
272 Ga0495675_0113966 3300047444 Unclassified 1686
273 Ga0495684_0016499 3300047471 Bacteria 5687
274 Ga0495684_0025671 3300047471 Bacteria 4527
275 Ga0495684_0034152 3300047471 Bacteria 3902
276 Ga0495602_0014004 3300048088 Bacteria 8163
277 Ga0495602_0226392 3300048088 Bacteria 1408
278 Ga0495602_0268205 3300048088 Unclassified 1263
279 Ga0496101_0223633 3300048904 Bacteria 1461
280 Ga0496105_0248248 3300048908 Bacteria 1442
281 Ga0496107_0103114 3300048910 Bacteria 2093
282 Ga0496108_0052038 3300048911 Bacteria 3431
283 Ga0496109_0255378 3300048912 Bacteria 1651
284 Ga0496110_0260260 3300048913 Bacteria 1579
285 Ga0496112_0044718 3300048915 Bacteria 4339
286 Ga0496112_0100624 3300048915 Bacteria 2860
287 Ga0496113_0054302 3300048916 Bacteria 2998
288 Ga0496115_0029098 3300048918 Bacteria 4337
289 Ga0501032_0217403 3300049569 Bacteria 1244
290 Ga0501080_0001458 3300049742 Bacteria 19905
291 nmdc:mga08y16_313896_c1 3300050511 Bacteria 1614
292 nmdc:mga08y16_6484_c1 3300050511 Bacteria 12279
293 Ga0495601_0059812 3300053077 Bacteria 2417
294 Ga0495601_0174489 3300053077 Unclassified 1405
295 Ga0495595_0009137 3300053084 Bacteria 4095
296 Ga0495595_0037437 3300053084 Bacteria 2205
297 Ga0495619_0073156 3300053085 Unclassified 2296
298 Ga0495619_0075350 3300053085 Bacteria 2264
299 Ga0495619_0157494 3300053085 Bacteria 1568
300 Ga0495619_0394243 3300053085 Unclassified 956
301 Ga0495645_0243118
302 Ga0070658_10104542
303 Ga0070683_100006647
304 Ga0070683_100932628
305 Ga0070670_100249466
306 Ga0068869_100045128
307 Ga0068869_100322362
308 Ga0068868_100075810
309 Ga0068868_100388296
310 Ga0070660_100111667
311 Ga0070691_10137732
312 Ga0070687_100160299
313 Ga0070671_100019413
314 Ga0070659_100067140
315 Ga0070713_100005388
316 Ga0070710_10347611
317 Ga0070701_10058081
318 Ga0070711_100228084
319 Ga0070694_100199736
320 Ga0070708_100045353
321 Ga0070708_100086846
322 Ga0070708_100277813
323 Ga0070708_100362973
324 Ga0070678_100253944
325 Ga0070662_100107218
326 Ga0070681_10222271
327 Ga0068867_100047486
328 Ga0070706_100017516
329 Ga0070706_100109970
330 Ga0070706_100302055
331 Ga0070706_100562425
332 Ga0070707_100005338
333 Ga0070707_100189456
334 Ga0070707_100316793
335 Ga0070707_100323438
336 Ga0070698_100468486
337 Ga0070699_100158821
338 Ga0070699_100262869
339 Ga0070699_100365824
340 Ga0070699_100421983
341 Ga0070699_100915866
342 Ga0070699_101034223
343 Ga0070679_100226113
344 Ga0070679_101130541
345 Ga0070684_100120039
346 Ga0070697_100009751
347 Ga0070697_100010298
348 Ga0070697_100150574
349 Ga0070686_100001459
350 Ga0070686_100069936
351 Ga0070665_100043361
352 Ga0070665_100129773
353 Ga0070704_100057356
354 Ga0070704_100827543
355 Ga0068855_100005187
356 Ga0068855_100104458
357 Ga0068855_100704718
358 Ga0068855_100933160
359 Ga0070664_100210305
360 Ga0068857_100008997
361 Ga0068854_100009261
362 Ga0068856_100146549
363 Ga0068856_100174113
364 Ga0068852_100064170
365 Ga0068859_100005437
366 Ga0068864_100001206
367 Ga0068864_100134174
368 Ga0068864_100268872
369 Ga0068866_10050545
370 Ga0068866_10212528
371 Ga0068863_100017991
372 Ga0068863_100059848
373 Ga0068863_101057523
374 Ga0068858_100056279
375 Ga0068860_100005190
376 Ga0068860_100456261
377 Ga0070717_10040307
378 Ga0070717_10126133
379 Ga0070717_10232685
380 Ga0070717_10401952
381 Ga0070717_10542966
382 Ga0070716_100475970
383 Ga0070712_100044782
384 Ga0070712_100091117
385 Ga0070712_100130654
386 Ga0097621_100235309
387 Ga0068871_100020791
388 Ga0068871_100062267
389 Ga0068871_100064682
390 Ga0068865_100001646
391 Ga0097620_100005437
392 Ga0099794_10002066
393 Ga0099794_10004346
394 Ga0099794_10083560
395 Ga0099794_10097436
396 Ga0099794_10196093
397 Ga0099795_10003270
398 Ga0099795_10031654
399 Ga0099795_10037684
400 Ga0099795_10116391
401 Ga0111539_10003145
402 Ga0111539_10079089
403 Ga0105245_10012374
404 Ga0105245_10053072
405 Ga0105245_10169051
406 Ga0105247_10239538
407 Ga0105243_10006662
408 Ga0105243_10085809
409 Ga0105241_10014349
410 Ga0105241_10293862
411 Ga0105241_10376395
412 Ga0105242_10007819
413 Ga0105242_10014193
414 Ga0105242_10141093
415 Ga0105242_10232596
416 Ga0105248_10007939
417 Ga0105248_10011908
418 Ga0105248_10102617
419 Ga0105248_10362639
420 Ga0105237_10109720
421 Ga0105237_10123727
422 Ga0105238_10008111
423 Ga0105238_10015769
424 Ga0105238_10078376
425 Ga0105249_10217911
426 Ga0105249_10385294
427 Ga0099796_10029095
428 Ga0099796_10034835
429 Ga0105239_10008936
430 Ga0105239_10289617
431 Ga0105246_10608473
432 Ga0157373_10359286
433 Ga0157370_10023609
434 Ga0157370_10068565
435 Ga0157369_10024932
436 Ga0157369_10472334
437 Ga0157374_10104724
438 Ga0157374_10124221
439 Ga0157374_10147596
440 Ga0157378_10004965
441 Ga0157378_10036633
442 Ga0157378_10072177
443 Ga0157378_10160246
444 Ga0157378_10654367
445 Ga0157378_10794811
446 Ga0163162_10002384
447 Ga0163162_10172135
448 Ga0157372_10002894
449 Ga0157372_10003150
450 Ga0157372_10498871
451 Ga0163163_10011896
452 Ga0163163_10046014
453 Ga0163163_10082965
454 Ga0163163_10172859
455 Ga0163163_10192193
456 Ga0163163_11477541
457 Ga0157376_10145031
458 Ga0157376_10892236
459 Ga0157376_11346200
460 Ga0207654_10062797
461 Ga0207707_10174139
462 Ga0207695_10011773
463 Ga0207671_10010642
464 Ga0207693_10001215
465 Ga0207693_10136904
466 Ga0207663_10232071
467 Ga0207657_10265417
468 Ga0207646_10353408
469 Ga0207694_10006093
470 Ga0207694_10106755
471 Ga0207694_10128868
472 Ga0207650_10001986
473 Ga0207650_10638802
474 Ga0207687_10313652
475 Ga0207700_10108554
476 Ga0207700_10137144
477 Ga0207664_10607235
478 Ga0207690_10149291
479 Ga0207706_10021247
480 Ga0207686_10007676
481 Ga0207686_10014920
482 Ga0207686_10087053
483 Ga0207709_10023243
484 Ga0207704_10010011
485 Ga0207711_10102041
486 Ga0207711_10408756
487 Ga0207689_10076543
488 Ga0207661_10051432
489 Ga0207661_10292036
490 Ga0207661_10527994
491 Ga0207667_10006885
492 Ga0207667_10063274
493 Ga0207667_11128931
494 Ga0207640_10032440
495 Ga0207677_10373111
496 Ga0207702_10096176
497 Ga0207702_10179725
498 Ga0207641_10006807
499 Ga0207641_10835271
500 Ga0207648_10059368
501 Ga0207676_10002163
502 Ga0207676_10348664
503 Ga0207674_10002402
504 Ga0207698_10031382
505 Ga0209179_1037312
506 Ga0210002_1014423
507 Ga0209588_1057432
508 Ga0207428_10030328
509 Ga0268264_10018340
510 Ga0268264_10246500
511 Ga0265338_10136233
512 Ga0265338_10356532
513 Ga0265328_10012596
514 Ga0265339_10000055
515 Ga0265314_10058595
516 Ga0265342_10031372
517 Ga0307410_10130845
518 Ga0373926_0003366
519 Ga0373954_0029929
520 Ga0373954_0107070
521 Ga0373956_0000543
522 Ga0373946_0003754
523 Ga0373955_0062043
524 Ga0373935_0323150
525 Ga0373927_0000325
526 Ga0373927_0120433
527 Ga0373933_0001956
528 Ga0373933_0181946
529 Ga0373933_0227537
530 Ga0373947_0006624
531 Ga0373937_0001643
532 Ga0373937_0017056
533 Ga0373937_0197166
534 Ga0373937_1297940
535 Ga0373925_0001428
536 Ga0453684_0597711
537 Ga0495651_0001232
538 Ga0495651_0033201
539 Ga0495653_0006894
540 Ga0495664_0046828
541 Ga0495664_0285346
542 Ga0495608_0009451
543 Ga0495608_0264843
544 Ga0495608_0268871
545 Ga0495628_0000057
546 Ga0495628_0089973
547 Ga0495630_0037541
548 Ga0495666_0221420
549 Ga0495652_0004089
550 Ga0495652_0229289
551 Ga0495652_0590196
552 Ga0495640_0262364
553 Ga0495587_0002214
554 Ga0495587_0062593
555 Ga0495645_0032258
556 Ga0495667_0006553
557 Ga0495667_0193958
558 Ga0495635_0126605
559 Ga0495635_0151645
560 Ga0495657_0006523
561 Ga0495657_0071219
562 Ga0495600_0005208
563 Ga0495600_0198698
564 Ga0495604_0012262
565 Ga0495604_0095713
566 Ga0495674_0007261
567 Ga0495674_0355510
568 Ga0495680_0001156
569 Ga0495680_0054963
570 Ga0495680_0115712
571 Ga0495675_0000852
572 Ga0495675_0113966
573 Ga0495684_0016499
574 Ga0495684_0025671
575 Ga0495684_0034152
576 Ga0495602_0014004
577 Ga0495602_0226392
578 Ga0495602_0268205
579 Ga0496101_0223633
580 Ga0496105_0248248
581 Ga0496107_0103114
582 Ga0496108_0052038
583 Ga0496109_0255378
584 Ga0496110_0260260
585 Ga0496112_0044718
586 Ga0496112_0100624
587 Ga0496113_0054302
588 Ga0496115_0029098
589 Ga0501032_0217403
590 Ga0501080_0001458
591 nmdc:mga08y16_313896_c1
592 nmdc:mga08y16_6484_c1
593 Ga0495601_0059812
594 Ga0495601_0174489
595 Ga0495595_0009137
596 Ga0495595_0037437
597 Ga0495619_0073156
598 Ga0495619_0075350
599 Ga0495619_0157494
600 Ga0495619_0394243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

77

168

0.94

PF13649

Methyltransf_25

Methyltransferase domain

76

164

0.92

PF08242

Methyltransf_12

Methyltransferase domain

77

166

0.87

PF13489

Methyltransf_23

Methyltransferase domain

56

210

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5doo-assembly1.cif.gz_A the structure of pkmt2 from rickettsia typhi 0.8294 40 149
3ofj-assembly1.cif.gz_A crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 0.8278 27 203
3e23-assembly1.cif.gz_A crystal structure of the rpa2492 protein in complex with sam from rhodopseudomonas palustris, northeast structural genomics consortium target rpr299 0.8276 5 203
3sm3-assembly1.cif.gz_A-2 crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. 0.8227 33 203
5dpl-assembly1.cif.gz_A the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.822 40 151
ID Description Score Start End Superfamily
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8776 42 144 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8645 42 154 3.40.50.150
af_O07251_1_150_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8432 67 204 3.40.50.150
af_Q96IZ6_183_373_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8272 43 203 3.40.50.150
3sm3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8227 33 203 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7U7AZP1-F1-model_v4 Methyltransferase type 12 0.9939 4 204 GO:0008168
GO:0032259
AF-A0A6L5DAJ4-F1-model_v4 deleted 0.9901 2 203
AF-A0A7H9UQK0-F1-model_v4 deleted 0.9879 1 203
AF-A0A848UAS2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9878 3 144 GO:0008168
GO:0032259
AF-A0A1G1Q839-F1-model_v4 Methyltransferase 0.9852 1 203 GO:0008168
GO:0032259

Map