F395443

General Info

Members Datasets Scaffolds Average Seq Length
300 167 600 274

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10028463|Ga0316576_100284633
Length 311
Sequence MDTRTRYVLPPVAPEGSPALADPSYSSAVAACEWIDAGSDFRDIKYHLSAGEAEGIAKITINRPQKRNAFRPQTLFELQDAFNRARDDEAVGVIILTGQGDLAFCSGGDQAIRGDDGYIGDDEVAKKGIGRLNVLDLQIQIRRTPKPVIAMVAGYAIGGGHVLHVVCDLTVAADNARFGQTGPMVGSFDGGYGSGLLARIIGQKRAREVWYTCRQYGAAQAYDWGLANEVVPIEDLELATVGMAREMLEMSPLALRMLKASHNAADDGLAGVQQLAGDATLLFYMTEEAQHGRDSYKEKRKPDFRQFPKRP

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
91 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
92 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
93 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
94 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
95 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
100 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
167 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10028463 3300031727 Bacteria 3939
2 JGI25407J50210_10002178 3300003373 Bacteria 4582
3 Ga0065704_10078331 3300005289 Bacteria 4462
4 Ga0070667_100274195 3300005367 Bacteria 1513
5 Ga0070709_10000361 3300005434 Bacteria 28094
6 Ga0070714_100000444 3300005435 Bacteria 30013
7 Ga0070714_100000615 3300005435 Bacteria 25442
8 Ga0070714_100245936 3300005435 Bacteria 1652
9 Ga0070713_100000934 3300005436 Bacteria 18669
10 Ga0070710_10000602 3300005437 Bacteria 17146
11 Ga0070711_100000275 3300005439 Bacteria 26678
12 Ga0070708_100000309 3300005445 Bacteria 36655
13 Ga0070708_100021340 3300005445 Bacteria 5474
14 Ga0070708_100137138 3300005445 Bacteria 2267
15 Ga0070708_100425446 3300005445 Bacteria 1252
16 Ga0070706_100000021 3300005467 Bacteria 162774
17 Ga0070706_100000453 3300005467 Bacteria 49124
18 Ga0070706_100364423 3300005467 Bacteria 1346
19 Ga0070707_100000090 3300005468 Bacteria 82022
20 Ga0070707_100004278 3300005468 Bacteria 13374
21 Ga0070707_100005786 3300005468 Bacteria 11532
22 Ga0070707_100008352 3300005468 Bacteria 9614
23 Ga0070707_100020690 3300005468 Bacteria 6209
24 Ga0070707_100055819 3300005468 Bacteria 3786
25 Ga0070707_100072749 3300005468 Bacteria 3314
26 Ga0070707_100234107 3300005468 Bacteria 1787
27 Ga0070707_100316261 3300005468 Bacteria 1517
28 Ga0070707_100372646 3300005468 Bacteria 1387
29 Ga0070698_100004506 3300005471 Bacteria 15317
30 Ga0070698_100006466 3300005471 Bacteria 12713
31 Ga0070698_100007244 3300005471 Bacteria 12014
32 Ga0070698_100645150 3300005471 Bacteria 1000
33 Ga0070699_100000151 3300005518 Bacteria 65827
34 Ga0070699_100000168 3300005518 Bacteria 63225
35 Ga0070699_100059009 3300005518 Bacteria 3325
36 Ga0070699_100316495 3300005518 Bacteria 1402
37 Ga0070697_100002777 3300005536 Bacteria 13479
38 Ga0070697_100348761 3300005536 Bacteria 1278
39 Ga0070704_100001868 3300005549 Bacteria 11613
40 Ga0068861_100402517 3300005719 Bacteria 1215
41 Ga0068860_100284473 3300005843 Bacteria 1617
42 Ga0081538_10000104 3300005981 Bacteria 83555
43 Ga0081539_10011580 3300005985 Bacteria 6952
44 Ga0070717_10000283 3300006028 Bacteria 34479
45 Ga0070717_10001756 3300006028 Bacteria 15098
46 Ga0070717_10045869 3300006028 Bacteria 3574
47 Ga0070716_100000167 3300006173 Bacteria 25955
48 Ga0070712_100031238 3300006175 Bacteria 3586
49 Ga0075428_100076407 3300006844 Bacteria 3656
50 Ga0075431_100047164 3300006847 Bacteria 4442
51 Ga0075429_100016649 3300006880 Bacteria 6368
52 Ga0075436_100010519 3300006914 Bacteria 6345
53 Ga0099794_10014811 3300007265 Bacteria 3426
54 Ga0105245_10302347 3300009098 Bacteria 1570
55 Ga0114129_10078462 3300009147 Bacteria 4593
56 Ga0105241_10315064 3300009174 Bacteria 1347
57 Ga0105249_10494534 3300009553 Bacteria 1267
58 Ga0207692_10000284 3300025898 Bacteria 17470
59 Ga0207685_10001758 3300025905 Bacteria 4710
60 Ga0207699_10000351 3300025906 Bacteria 24518
61 Ga0207684_10000095 3300025910 Bacteria 165210
62 Ga0207684_10000141 3300025910 Bacteria 129376
63 Ga0207684_10003165 3300025910 Bacteria 16190
64 Ga0207684_10049758 3300025910 Bacteria 3555
65 Ga0207684_10112795 3300025910 Bacteria 2327
66 Ga0207684_10199299 3300025910 Bacteria 1727
67 Ga0207693_10004532 3300025915 Bacteria 11738
68 Ga0207663_10005137 3300025916 Bacteria 6580
69 Ga0207646_10000027 3300025922 Bacteria 235383
70 Ga0207646_10000034 3300025922 Bacteria 212493
71 Ga0207646_10000053 3300025922 Bacteria 160799
72 Ga0207646_10001563 3300025922 Bacteria 28033
73 Ga0207646_10006784 3300025922 Bacteria 11785
74 Ga0207646_10013074 3300025922 Bacteria 7950
75 Ga0207646_10020794 3300025922 Bacteria 6077
76 Ga0207646_10061473 3300025922 Bacteria 3353
77 Ga0207646_10216666 3300025922 Bacteria 1729
78 Ga0207646_10233586 3300025922 Bacteria 1661
79 Ga0207646_10310859 3300025922 Bacteria 1424
80 Ga0207700_10000831 3300025928 Bacteria 17851
81 Ga0207664_10000348 3300025929 Bacteria 33824
82 Ga0207664_10000392 3300025929 Bacteria 31387
83 Ga0207664_10151406 3300025929 Bacteria 1971
84 Ga0207644_10188213 3300025931 Bacteria 1622
85 Ga0207706_10063727 3300025933 Bacteria 3245
86 Ga0207665_10000202 3300025939 Bacteria 40056
87 Ga0207712_10137981 3300025961 Bacteria 1868
88 Ga0207668_10251671 3300025972 Bacteria 1435
89 Ga0207658_10050725 3300025986 Bacteria 3055
90 Ga0207675_100010694 3300026118 Bacteria 8596
91 Ga0207428_10002280 3300027907 Bacteria 19250
92 Ga0268265_10123377 3300028380 Bacteria 2139
93 Ga0268265_10383399 3300028380 Bacteria 1294
94 Ga0268264_10279236 3300028381 Bacteria 1564
95 Ga0265334_10037694 3300028573 Bacteria 1905
96 Ga0316575_10022445 3300031665 Bacteria 2435
97 Ga0316579_10012435 3300031691 Bacteria 3642
98 Ga0316576_10005540 3300031727 Bacteria 7730
99 Ga0316576_10012668 3300031727 Bacteria 5577
100 Ga0316576_10070726 3300031727 Bacteria 2573
101 Ga0316576_10075084 3300031727 Bacteria 2500
102 Ga0316576_10097744 3300031727 Bacteria 2192
103 Ga0316578_10012333 3300031728 Bacteria 4504
104 Ga0316578_10094966 3300031728 Bacteria 1784
105 Ga0316578_10097240 3300031728 Bacteria 1763
106 Ga0307405_10021566 3300031731 Bacteria 3623
107 Ga0307405_10222675 3300031731 Bacteria 1385
108 Ga0307413_10300773 3300031824 Bacteria 1216
109 Ga0307410_10022708 3300031852 Bacteria 3884
110 Ga0307410_10150470 3300031852 Bacteria 1732
111 Ga0307406_10297170 3300031901 Bacteria 1239
112 Ga0307407_10004382 3300031903 Bacteria 5983
113 Ga0307407_10021834 3300031903 Bacteria 3309
114 Ga0307407_10024399 3300031903 Bacteria 3171
115 Ga0307412_10033828 3300031911 Bacteria 3252
116 Ga0307412_10462278 3300031911 Bacteria 1048
117 Ga0307409_100002277 3300031995 Bacteria 9943
118 Ga0307409_100018454 3300031995 Bacteria 4691
119 Ga0307416_100002365 3300032002 Bacteria 10794
120 Ga0307416_100006623 3300032002 Bacteria 7270
121 Ga0307416_100015150 3300032002 Bacteria 5312
122 Ga0307416_100061631 3300032002 Bacteria 3062
123 Ga0307411_10006172 3300032005 Bacteria 5965
124 Ga0307415_100000849 3300032126 Bacteria 13973
125 Ga0307415_100015861 3300032126 Bacteria 4473
126 Ga0316583_10004080 3300032133 Bacteria 5190
127 Ga0316585_10041777 3300032137 Bacteria 1461
128 Ga0316585_10048934 3300032137 Bacteria 1355
129 Ga0316580_10068336 3300032139 Bacteria 1089
130 Ga0316592_1010159 3300033524 Bacteria 1894
131 Ga0316588_1001275 3300033528 Bacteria 4056
132 Ga0316596_1007875 3300033541 Bacteria 2526
133 Ga0373934_0025310 3300035086 Bacteria 2297
134 Ga0373939_0127832 3300035114 Bacteria 904
135 Ga0373953_0008158 3300035117 Bacteria 3545
136 Ga0373955_0036942 3300035172 Bacteria 2595
137 Ga0316574_0015564 3300035398 Bacteria 4415
138 Ga0316574_0075001 3300035398 Bacteria 2141
139 Ga0316574_0233127 3300035398 Bacteria 1178
140 Ga0373924_0005196 3300035410 Bacteria 4595
141 Ga0373924_0055958 3300035410 Bacteria 1642
142 Ga0373931_0007383 3300035691 Bacteria 5176
143 Ga0373931_0226665 3300035691 Bacteria 1127
144 Ga0373933_0054614 3300035724 Bacteria 2394
145 Ga0373947_0131904 3300035725 Bacteria 1596
146 Ga0373937_0363068 3300036401 Bacteria 1372
147 Ga0316584_0000281 3300036712 Bacteria 26040
148 Ga0316584_0010316 3300036712 Bacteria 6526
149 Ga0316584_0069165 3300036712 Bacteria 2647
150 Ga0395900_0144038 3300037418 Bacteria 2438
151 Ga0395898_0039346 3300037466 Bacteria 4681
152 Ga0395898_0090842 3300037466 Bacteria 2938
153 Ga0316581_0007204 3300037588 Bacteria 2976
154 Ga0395901_0054827 3300038443 Bacteria 4144
155 Ga0395901_0109634 3300038443 Bacteria 2898
156 Ga0395901_0113791 3300038443 Bacteria 2842
157 Ga0436365_1503511 3300039437 Bacteria 2304
158 Ga0439443_000283 3300042003 Bacteria 4125
159 Ga0439448_0000391 3300042005 Bacteria 9936
160 Ga0439450_000265 3300042008 Bacteria 6365
161 Ga0439451_007265 3300042009 Bacteria 2261
162 Ga0439451_032957 3300042009 Bacteria 1042
163 Ga0439455_0003225 3300042012 Bacteria 3089
164 Ga0439463_000868 3300042016 Bacteria 8316
165 Ga0439463_003241 3300042016 Bacteria 4130
166 Ga0439463_060588 3300042016 Bacteria 967
167 Ga0450923_012837 3300042125 Bacteria 1531
168 Ga0450888_003889 3300042126 Bacteria 1536
169 Ga0439458_0009008 3300042157 Bacteria 2226
170 Ga0439435_0031289 3300042436 Bacteria 1446
171 Ga0439464_0003847 3300042439 Bacteria 3818
172 Ga0439464_0055296 3300042439 Bacteria 1154
173 Ga0439460_0000589 3300042461 Bacteria 7987
174 Ga0439460_0049791 3300042461 Bacteria 1253
175 Ga0439440_0000138 3300042993 Bacteria 10454
176 Ga0439440_0008568 3300042993 Bacteria 2102
177 Ga0466969_0044245 3300044656 Bacteria 2216
178 Ga0495651_0027497 3300046462 Bacteria 4430
179 Ga0495585_0202880 3300046492 Bacteria 1009
180 Ga0495618_0042112 3300046514 Bacteria 2878
181 Ga0495644_0032691 3300046523 Bacteria 1966
182 Ga0495663_0004776 3300046525 Bacteria 3792
183 Ga0495652_0004852 3300046529 Bacteria 12772
184 Ga0495587_0072085 3300046536 Bacteria 2008
185 Ga0495609_0090033 3300046538 Bacteria 1334
186 Ga0495621_0100980 3300046539 Bacteria 1098
187 Ga0495656_0029087 3300046615 Bacteria 2221
188 Ga0495635_0069215 3300046663 Bacteria 2420
189 Ga0495657_0004958 3300046675 Bacteria 10583
190 Ga0495657_0108394 3300046675 Bacteria 1762
191 Ga0495599_0181200 3300046678 Bacteria 1298
192 Ga0495670_0220066 3300046691 Bacteria 1008
193 Ga0495604_0028347 3300047317 Bacteria 4454
194 Ga0495672_0037581 3300047320 Bacteria 2961
195 Ga0495680_0009978 3300047322 Bacteria 8501
196 Ga0495677_0085493 3300047445 Bacteria 1185
197 Ga0495602_0031539 3300048088 Bacteria 5009
198 Ga0495602_0044816 3300048088 Bacteria 4008
199 Ga0501031_0000708 3300049568 Bacteria 19922
200 Ga0501031_0017974 3300049568 Bacteria 4600
201 Ga0501032_0070594 3300049569 Bacteria 2329
202 Ga0501033_0059729 3300049570 Bacteria 2815
203 Ga0501033_0272508 3300049570 Bacteria 1196
204 Ga0501036_0000868 3300049572 Bacteria 22508
205 Ga0501036_0011767 3300049572 Bacteria 7250
206 Ga0501036_0058760 3300049572 Bacteria 3258
207 Ga0501037_0023479 3300049573 Bacteria 4560
208 Ga0501037_0208903 3300049573 Bacteria 1377
209 Ga0501038_0001594 3300049574 Bacteria 21053
210 Ga0501038_0116565 3300049574 Bacteria 2207
211 Ga0501039_0001861 3300049575 Bacteria 15592
212 Ga0501039_0011477 3300049575 Bacteria 6742
213 Ga0501040_0000619 3300049576 Bacteria 21740
214 Ga0501040_0006111 3300049576 Bacteria 7812
215 Ga0501040_0006414 3300049576 Bacteria 7640
216 Ga0501040_0092887 3300049576 Bacteria 2098
217 Ga0501041_0003441 3300049577 Bacteria 9111
218 Ga0501041_0040723 3300049577 Bacteria 2821
219 Ga0501041_0215270 3300049577 Bacteria 1205
220 Ga0501042_0001651 3300049578 Bacteria 13293
221 Ga0501042_0002546 3300049578 Bacteria 11213
222 Ga0501042_0011250 3300049578 Bacteria 6031
223 Ga0501042_0330582 3300049578 Bacteria 1102
224 Ga0501043_0027067 3300049579 Bacteria 4501
225 Ga0501043_0035054 3300049579 Bacteria 3947
226 Ga0501043_0084287 3300049579 Bacteria 2498
227 Ga0501046_0001348 3300049580 Bacteria 23779
228 Ga0501046_0006644 3300049580 Bacteria 10219
229 Ga0501047_0050198 3300049581 Bacteria 4029
230 Ga0501048_0001279 3300049582 Bacteria 19076
231 Ga0501048_0001325 3300049582 Bacteria 18758
232 Ga0501067_0024854 3300049583 Bacteria 3322
233 Ga0501068_0031816 3300049584 Bacteria 3135
234 Ga0501068_0211292 3300049584 Bacteria 1232
235 Ga0501070_0497798 3300049586 Bacteria 979
236 Ga0501070_0546637 3300049586 Bacteria 927
237 Ga0501071_0001890 3300049587 Bacteria 12447
238 Ga0501071_0030821 3300049587 Bacteria 3795
239 Ga0501072_0003321 3300049588 Bacteria 12105
240 Ga0501072_0042769 3300049588 Bacteria 3559
241 Ga0501072_0078618 3300049588 Bacteria 2612
242 Ga0501073_0112061 3300049589 Bacteria 1892
243 Ga0501074_0003309 3300049590 Bacteria 11397
244 Ga0501074_0014156 3300049590 Bacteria 5800
245 Ga0501074_0035842 3300049590 Bacteria 3594
246 Ga0501075_0000224 3300049591 Bacteria 30212
247 Ga0501075_0002800 3300049591 Bacteria 11685
248 Ga0501075_0115450 3300049591 Bacteria 2041
249 Ga0501076_0000544 3300049592 Bacteria 24072
250 Ga0501076_0005088 3300049592 Bacteria 9413
251 Ga0501076_0027365 3300049592 Bacteria 4422
252 Ga0501077_0002174 3300049593 Bacteria 11848
253 Ga0501077_0107321 3300049593 Bacteria 1769
254 Ga0501079_0000580 3300049741 Bacteria 24226
255 Ga0501079_0011051 3300049741 Bacteria 6884
256 Ga0501079_0096380 3300049741 Bacteria 2293
257 Ga0501079_0299408 3300049741 Bacteria 1258
258 Ga0501080_0044427 3300049742 Bacteria 4136
259 Ga0501080_0308778 3300049742 Bacteria 1434
260 Ga0501081_0004091 3300049743 Bacteria 9344
261 Ga0501081_0004270 3300049743 Bacteria 9161
262 Ga0501081_0017569 3300049743 Bacteria 4738
263 Ga0501083_0047300 3300049744 Bacteria 2907
264 Ga0501083_0233538 3300049744 Bacteria 1198
265 Ga0501035_0004285 3300049822 Bacteria 13543
266 Ga0501035_0292240 3300049822 Bacteria 1375
267 Ga0501044_0108227 3300049823 Bacteria 2790
268 Ga0501045_0000261 3300049824 Bacteria 30562
269 Ga0501045_0001915 3300049824 Bacteria 14074
270 Ga0501045_0002709 3300049824 Bacteria 12092
271 nmdc:mga05p37_554911_c1 3300050507 Bacteria 1307
272 nmdc:mga05p37_69253_c1 3300050507 Bacteria 4340
273 nmdc:mga05p37_7014_c1 3300050507 Bacteria 13281
274 nmdc:mga09592_19799_c1 3300050508 Bacteria 5528
275 nmdc:mga09592_19910_c1 3300050508 Bacteria 5513
276 nmdc:mga0qj67_3633_c1 3300050509 Bacteria 11129
277 nmdc:mga06r32_475133_c1 3300050510 Bacteria 1228
278 nmdc:mga06r32_5261_c1 3300050510 Bacteria 11641
279 nmdc:mga06r32_692_c4 3300050510 Bacteria 7794
280 nmdc:mga08y16_3603_c1 3300050511 Bacteria 16079
281 nmdc:mga0n895_147653_c1 3300050512 Bacteria 2381
282 nmdc:mga0n895_32929_c1 3300050512 Bacteria 4977
283 nmdc:mga0rr50_584044_c1 3300050513 Bacteria 952
284 nmdc:mga08x19_207076_c1 3300050514 Bacteria 1346
285 nmdc:mga08x19_47984_c1 3300050514 Bacteria 2735
286 nmdc:mga08x19_57352_c1 3300050514 Bacteria 2516
287 nmdc:mga0a205_3455_c1 3300050515 Bacteria 14107
288 nmdc:mga0a205_91886_c1 3300050515 Bacteria 2933
289 Ga0500568_0000239 3300053139 Bacteria 46970
290 Ga0501084_0000264 3300054114 Bacteria 39550
291 Ga0501084_0004873 3300054114 Bacteria 10959
292 Ga0501084_0016449 3300054114 Bacteria 6143
293 Ga0590075_033628 3300059424 Bacteria 1302
294 Ga0501082_0000767 3300060353 Bacteria 28110
295 Ga0501082_0001425 3300060353 Bacteria 21015
296 Ga0501082_0051341 3300060353 Bacteria 3554
297 Ga0530510_0001223 3300061734 Bacteria 17156
298 Ga0530510_0001940 3300061734 Bacteria 14156
299 8055066095 8055066027 Bacteria 9479577
300 8056062616 8056060235 Bacteria 7259403
301 Ga0316576_10028463
302 JGI25407J50210_10002178
303 Ga0065704_10078331
304 Ga0070667_100274195
305 Ga0070709_10000361
306 Ga0070714_100000444
307 Ga0070714_100000615
308 Ga0070714_100245936
309 Ga0070713_100000934
310 Ga0070710_10000602
311 Ga0070711_100000275
312 Ga0070708_100000309
313 Ga0070708_100021340
314 Ga0070708_100137138
315 Ga0070708_100425446
316 Ga0070706_100000021
317 Ga0070706_100000453
318 Ga0070706_100364423
319 Ga0070707_100000090
320 Ga0070707_100004278
321 Ga0070707_100005786
322 Ga0070707_100008352
323 Ga0070707_100020690
324 Ga0070707_100055819
325 Ga0070707_100072749
326 Ga0070707_100234107
327 Ga0070707_100316261
328 Ga0070707_100372646
329 Ga0070698_100004506
330 Ga0070698_100006466
331 Ga0070698_100007244
332 Ga0070698_100645150
333 Ga0070699_100000151
334 Ga0070699_100000168
335 Ga0070699_100059009
336 Ga0070699_100316495
337 Ga0070697_100002777
338 Ga0070697_100348761
339 Ga0070704_100001868
340 Ga0068861_100402517
341 Ga0068860_100284473
342 Ga0081538_10000104
343 Ga0081539_10011580
344 Ga0070717_10000283
345 Ga0070717_10001756
346 Ga0070717_10045869
347 Ga0070716_100000167
348 Ga0070712_100031238
349 Ga0075428_100076407
350 Ga0075431_100047164
351 Ga0075429_100016649
352 Ga0075436_100010519
353 Ga0099794_10014811
354 Ga0105245_10302347
355 Ga0114129_10078462
356 Ga0105241_10315064
357 Ga0105249_10494534
358 Ga0207692_10000284
359 Ga0207685_10001758
360 Ga0207699_10000351
361 Ga0207684_10000095
362 Ga0207684_10000141
363 Ga0207684_10003165
364 Ga0207684_10049758
365 Ga0207684_10112795
366 Ga0207684_10199299
367 Ga0207693_10004532
368 Ga0207663_10005137
369 Ga0207646_10000027
370 Ga0207646_10000034
371 Ga0207646_10000053
372 Ga0207646_10001563
373 Ga0207646_10006784
374 Ga0207646_10013074
375 Ga0207646_10020794
376 Ga0207646_10061473
377 Ga0207646_10216666
378 Ga0207646_10233586
379 Ga0207646_10310859
380 Ga0207700_10000831
381 Ga0207664_10000348
382 Ga0207664_10000392
383 Ga0207664_10151406
384 Ga0207644_10188213
385 Ga0207706_10063727
386 Ga0207665_10000202
387 Ga0207712_10137981
388 Ga0207668_10251671
389 Ga0207658_10050725
390 Ga0207675_100010694
391 Ga0207428_10002280
392 Ga0268265_10123377
393 Ga0268265_10383399
394 Ga0268264_10279236
395 Ga0265334_10037694
396 Ga0316575_10022445
397 Ga0316579_10012435
398 Ga0316576_10005540
399 Ga0316576_10012668
400 Ga0316576_10070726
401 Ga0316576_10075084
402 Ga0316576_10097744
403 Ga0316578_10012333
404 Ga0316578_10094966
405 Ga0316578_10097240
406 Ga0307405_10021566
407 Ga0307405_10222675
408 Ga0307413_10300773
409 Ga0307410_10022708
410 Ga0307410_10150470
411 Ga0307406_10297170
412 Ga0307407_10004382
413 Ga0307407_10021834
414 Ga0307407_10024399
415 Ga0307412_10033828
416 Ga0307412_10462278
417 Ga0307409_100002277
418 Ga0307409_100018454
419 Ga0307416_100002365
420 Ga0307416_100006623
421 Ga0307416_100015150
422 Ga0307416_100061631
423 Ga0307411_10006172
424 Ga0307415_100000849
425 Ga0307415_100015861
426 Ga0316583_10004080
427 Ga0316585_10041777
428 Ga0316585_10048934
429 Ga0316580_10068336
430 Ga0316592_1010159
431 Ga0316588_1001275
432 Ga0316596_1007875
433 Ga0373934_0025310
434 Ga0373939_0127832
435 Ga0373953_0008158
436 Ga0373955_0036942
437 Ga0316574_0015564
438 Ga0316574_0075001
439 Ga0316574_0233127
440 Ga0373924_0005196
441 Ga0373924_0055958
442 Ga0373931_0007383
443 Ga0373931_0226665
444 Ga0373933_0054614
445 Ga0373947_0131904
446 Ga0373937_0363068
447 Ga0316584_0000281
448 Ga0316584_0010316
449 Ga0316584_0069165
450 Ga0395900_0144038
451 Ga0395898_0039346
452 Ga0395898_0090842
453 Ga0316581_0007204
454 Ga0395901_0054827
455 Ga0395901_0109634
456 Ga0395901_0113791
457 Ga0436365_1503511
458 Ga0439443_000283
459 Ga0439448_0000391
460 Ga0439450_000265
461 Ga0439451_007265
462 Ga0439451_032957
463 Ga0439455_0003225
464 Ga0439463_000868
465 Ga0439463_003241
466 Ga0439463_060588
467 Ga0450923_012837
468 Ga0450888_003889
469 Ga0439458_0009008
470 Ga0439435_0031289
471 Ga0439464_0003847
472 Ga0439464_0055296
473 Ga0439460_0000589
474 Ga0439460_0049791
475 Ga0439440_0000138
476 Ga0439440_0008568
477 Ga0466969_0044245
478 Ga0495651_0027497
479 Ga0495585_0202880
480 Ga0495618_0042112
481 Ga0495644_0032691
482 Ga0495663_0004776
483 Ga0495652_0004852
484 Ga0495587_0072085
485 Ga0495609_0090033
486 Ga0495621_0100980
487 Ga0495656_0029087
488 Ga0495635_0069215
489 Ga0495657_0004958
490 Ga0495657_0108394
491 Ga0495599_0181200
492 Ga0495670_0220066
493 Ga0495604_0028347
494 Ga0495672_0037581
495 Ga0495680_0009978
496 Ga0495677_0085493
497 Ga0495602_0031539
498 Ga0495602_0044816
499 Ga0501031_0000708
500 Ga0501031_0017974
501 Ga0501032_0070594
502 Ga0501033_0059729
503 Ga0501033_0272508
504 Ga0501036_0000868
505 Ga0501036_0011767
506 Ga0501036_0058760
507 Ga0501037_0023479
508 Ga0501037_0208903
509 Ga0501038_0001594
510 Ga0501038_0116565
511 Ga0501039_0001861
512 Ga0501039_0011477
513 Ga0501040_0000619
514 Ga0501040_0006111
515 Ga0501040_0006414
516 Ga0501040_0092887
517 Ga0501041_0003441
518 Ga0501041_0040723
519 Ga0501041_0215270
520 Ga0501042_0001651
521 Ga0501042_0002546
522 Ga0501042_0011250
523 Ga0501042_0330582
524 Ga0501043_0027067
525 Ga0501043_0035054
526 Ga0501043_0084287
527 Ga0501046_0001348
528 Ga0501046_0006644
529 Ga0501047_0050198
530 Ga0501048_0001279
531 Ga0501048_0001325
532 Ga0501067_0024854
533 Ga0501068_0031816
534 Ga0501068_0211292
535 Ga0501070_0497798
536 Ga0501070_0546637
537 Ga0501071_0001890
538 Ga0501071_0030821
539 Ga0501072_0003321
540 Ga0501072_0042769
541 Ga0501072_0078618
542 Ga0501073_0112061
543 Ga0501074_0003309
544 Ga0501074_0014156
545 Ga0501074_0035842
546 Ga0501075_0000224
547 Ga0501075_0002800
548 Ga0501075_0115450
549 Ga0501076_0000544
550 Ga0501076_0005088
551 Ga0501076_0027365
552 Ga0501077_0002174
553 Ga0501077_0107321
554 Ga0501079_0000580
555 Ga0501079_0011051
556 Ga0501079_0096380
557 Ga0501079_0299408
558 Ga0501080_0044427
559 Ga0501080_0308778
560 Ga0501081_0004091
561 Ga0501081_0004270
562 Ga0501081_0017569
563 Ga0501083_0047300
564 Ga0501083_0233538
565 Ga0501035_0004285
566 Ga0501035_0292240
567 Ga0501044_0108227
568 Ga0501045_0000261
569 Ga0501045_0001915
570 Ga0501045_0002709
571 nmdc:mga05p37_554911_c1
572 nmdc:mga05p37_69253_c1
573 nmdc:mga05p37_7014_c1
574 nmdc:mga09592_19799_c1
575 nmdc:mga09592_19910_c1
576 nmdc:mga0qj67_3633_c1
577 nmdc:mga06r32_475133_c1
578 nmdc:mga06r32_5261_c1
579 nmdc:mga06r32_692_c4
580 nmdc:mga08y16_3603_c1
581 nmdc:mga0n895_147653_c1
582 nmdc:mga0n895_32929_c1
583 nmdc:mga0rr50_584044_c1
584 nmdc:mga08x19_207076_c1
585 nmdc:mga08x19_47984_c1
586 nmdc:mga08x19_57352_c1
587 nmdc:mga0a205_3455_c1
588 nmdc:mga0a205_91886_c1
589 Ga0500568_0000239
590 Ga0501084_0000264
591 Ga0501084_0004873
592 Ga0501084_0016449
593 Ga0590075_033628
594 Ga0501082_0000767
595 Ga0501082_0001425
596 Ga0501082_0051341
597 Ga0530510_0001223
598 Ga0530510_0001940
599 8055066095
600 8056062616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

51

308

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

56

282

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iex-assembly1.cif.gz_B crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426 0.9881 5 274
4i42-assembly2.cif.gz_J e.coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa 0.9866 2 274
4i4z-assembly2.cif.gz_G synechocystis sp. pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa 0.986 6 274
2iex-assembly1.cif.gz_A crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426 0.9842 10 274
2iex-assembly1.cif.gz_B crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426 0.9803 5 274
ID Description Score Start End Superfamily
af_Q2FZL5_3_210_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.99 4 210 3.90.226.10
2uzfA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9846 213 261 1.10.12.10
af_Q2FZL5_3_210_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9806 4 210 3.90.226.10
2uzfB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9804 213 261 1.10.12.10
2iexB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9786 213 261 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A1F8IZW8-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36) 0.9877 6 274 GO:0005829
GO:0008935
GO:0009234
AF-A0A2D6BHQ5-F1-model_v4 Multifunctional fusion protein [Includes: Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (SHCHC synthase) (EC 4.2.99.20); 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36)] 0.9857 2 274 GO:0005829
GO:0008935
GO:0009234
GO:0070205
AF-A0A2E7AFD4-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36) 0.9856 3 274 GO:0005829
GO:0008935
GO:0009234
AF-A0A651H4Y8-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36) 0.9852 4 162 GO:0005829
GO:0008935
GO:0009234
AF-A0A6J7SJL0-F1-model_v4 Unannotated protein 0.9849 6 274 GO:0005829
GO:0008935
GO:0009234

Map