F395416

General Info

Members Datasets Scaffolds Average Seq Length
300 149 299 183

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10370136|Ga0207640_103701362
Length 212
Sequence LPEIKKYSEEELIHLLKNRDQTAFSYLYDNYSGALFGIIYKMLEDRELAEDVLQEAFVKIWNNFPSYDNLKGRLFTWMLNIARNLTLDTIRSKGYRKQAKIRDFGNSVDNSINXXXXTNTTESFDALGIRKHLTLLKDEQKQIIDLAYFGGFTQDEISKRLAIPLGTVKTRMRTAIIELRKILQQPGNSICANSLKPIPVRVLRDSGRPCIP

Samples

Sample ID Description Type Environment
1 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
134 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
135 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
136 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
137 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
140 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
141 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
142 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
143 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
144 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
145 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 0.33
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10058599 3300001989 Bacteria 1222
2 rootH1_10047048 3300003316 Bacteria 2968
3 rootH2_10120510 3300003320 Bacteria 5208
4 rootL2_10086859 3300003322 Bacteria 6181
5 Ga0065712_10110322 3300005290 Bacteria 1838
6 Ga0070658_10006339 3300005327 Bacteria 9587
7 Ga0070658_10015933 3300005327 Bacteria 6011
8 Ga0070658_10034460 3300005327 Bacteria 4072
9 Ga0070658_10074124 3300005327 Bacteria 2791
10 Ga0070658_10101850 3300005327 Bacteria 2374
11 Ga0070658_10406907 3300005327 Unclassified 1169
12 Ga0070676_10077962 3300005328 Bacteria 2004
13 Ga0070683_100187964 3300005329 Bacteria 1961
14 Ga0070683_100192565 3300005329 Bacteria 1936
15 Ga0070683_100416744 3300005329 Unclassified 1281
16 Ga0070683_101503330 3300005329 Bacteria 647
17 Ga0070690_100138257 3300005330 Bacteria 1652
18 Ga0070670_100759487 3300005331 Bacteria 874
19 Ga0070677_10193608 3300005333 Bacteria 976
20 Ga0070666_10034316 3300005335 Bacteria 3363
21 Ga0070680_100101623 3300005336 Bacteria 2387
22 Ga0070680_100196143 3300005336 Bacteria 1702
23 Ga0070680_100623340 3300005336 Bacteria 926
24 Ga0070682_100099197 3300005337 Unclassified 1920
25 Ga0070682_100225504 3300005337 Bacteria 1337
26 Ga0070660_100002757 3300005339 Bacteria 12063
27 Ga0070660_100048562 3300005339 Bacteria 3260
28 Ga0070660_100053642 3300005339 Bacteria 3110
29 Ga0070661_100010700 3300005344 Bacteria 6383
30 Ga0070661_100181111 3300005344 Bacteria 1603
31 Ga0070692_10105360 3300005345 Bacteria 1552
32 Ga0070668_100028705 3300005347 Bacteria 4222
33 Ga0070669_100073068 3300005353 Unclassified 2540
34 Ga0070675_100169042 3300005354 Bacteria 1884
35 Ga0070675_100321929 3300005354 Bacteria 1366
36 Ga0070671_100068349 3300005355 Bacteria 2963
37 Ga0070671_100190922 3300005355 Bacteria 1736
38 Ga0070673_100277090 3300005364 Bacteria 1470
39 Ga0070673_101423239 3300005364 Bacteria 653
40 Ga0070659_100140050 3300005366 Bacteria 1969
41 Ga0070667_100136245 3300005367 Bacteria 2147
42 Ga0070667_100427424 3300005367 Bacteria 1208
43 Ga0070667_100443040 3300005367 Bacteria 1186
44 Ga0070663_100065821 3300005455 Bacteria 2624
45 Ga0070663_100168276 3300005455 Bacteria 1692
46 Ga0070663_100170445 3300005455 Bacteria 1682
47 Ga0070663_100316029 3300005455 Bacteria 1255
48 Ga0070662_100011733 3300005457 Bacteria 5785
49 Ga0070681_10135873 3300005458 Bacteria 2390
50 Ga0070681_10445586 3300005458 Bacteria 1207
51 Ga0068867_100403642 3300005459 Unclassified 1153
52 Ga0068867_100415218 3300005459 Bacteria 1139
53 Ga0068867_100642229 3300005459 Unclassified 930
54 Ga0070679_100001499 3300005530 Bacteria 20743
55 Ga0070679_100135754 3300005530 Bacteria 2441
56 Ga0070679_100319847 3300005530 Bacteria 1501
57 Ga0070679_100542856 3300005530 Bacteria 1106
58 Ga0070679_101024801 3300005530 Bacteria 770
59 Ga0070684_100018262 3300005535 Bacteria 5775
60 Ga0070684_100475762 3300005535 Bacteria 1156
61 Ga0068853_100006544 3300005539 Bacteria 9276
62 Ga0068853_100008077 3300005539 Bacteria 8442
63 Ga0068853_100034132 3300005539 Bacteria 4317
64 Ga0068853_100063881 3300005539 Unclassified 3190
65 Ga0070686_100269847 3300005544 Unclassified 1250
66 Ga0070686_100369768 3300005544 Bacteria 1082
67 Ga0070665_101048088 3300005548 Bacteria 827
68 Ga0068855_100018796 3300005563 Bacteria 8306
69 Ga0068855_100050834 3300005563 Bacteria 4883
70 Ga0068855_100152381 3300005563 Bacteria 2628
71 Ga0068855_100489587 3300005563 Bacteria 1338
72 Ga0068855_101004827 3300005563 Bacteria 876
73 Ga0068855_101330049 3300005563 Bacteria 743
74 Ga0070664_100098249 3300005564 Bacteria 2543
75 Ga0068854_100030330 3300005578 Bacteria 3751
76 Ga0068854_100184355 3300005578 Bacteria 1632
77 Ga0068854_100340402 3300005578 Bacteria 1225
78 Ga0068854_100653802 3300005578 Bacteria 903
79 Ga0068854_100790526 3300005578 Bacteria 826
80 Ga0068854_100833438 3300005578 Bacteria 806
81 Ga0068856_100034859 3300005614 Bacteria 4931
82 Ga0068856_100051522 3300005614 Bacteria 4058
83 Ga0068856_100127777 3300005614 Bacteria 2545
84 Ga0068856_100158712 3300005614 Unclassified 2272
85 Ga0068852_100023537 3300005616 Bacteria 4959
86 Ga0068852_100318106 3300005616 Bacteria 1511
87 Ga0068852_100576993 3300005616 Bacteria 1127
88 Ga0068852_100790640 3300005616 Bacteria 962
89 Ga0068852_101138603 3300005616 Bacteria 801
90 Ga0068859_100226285 3300005617 Unclassified 1958
91 Ga0068859_100812394 3300005617 Bacteria 1022
92 Ga0068864_100036597 3300005618 Bacteria 4184
93 Ga0068864_100611483 3300005618 Bacteria 1058
94 Ga0068866_10453473 3300005718 Bacteria 839
95 Ga0068861_100303376 3300005719 Bacteria 1384
96 Ga0068851_10108624 3300005834 Bacteria 1479
97 Ga0068851_10527948 3300005834 Bacteria 711
98 Ga0068870_10404455 3300005840 Unclassified 889
99 Ga0068858_100264324 3300005842 Bacteria 1636
100 Ga0068858_100393521 3300005842 Bacteria 1331
101 Ga0068860_100035207 3300005843 Bacteria 4803
102 Ga0068860_100213352 3300005843 Bacteria 1873
103 Ga0068862_100010232 3300005844 Bacteria 7740
104 Ga0081539_10000910 3300005985 Bacteria 55996
105 Ga0070715_10100674 3300006163 Bacteria 1347
106 Ga0075366_10009956 3300006195 Bacteria 5324
107 Ga0097621_100003997 3300006237 Bacteria 10219
108 Ga0097621_100341591 3300006237 Bacteria 1330
109 Ga0068871_100074198 3300006358 Bacteria 2806
110 Ga0068871_100125898 3300006358 Bacteria 2168
111 Ga0068871_100582702 3300006358 Bacteria 1016
112 Ga0097620_100226292 3300006931 Unclassified 1958
113 Ga0097620_100812586 3300006931 Bacteria 1022
114 Ga0105240_10405608 3300009093 Bacteria 1534
115 Ga0105243_10180938 3300009148 Unclassified 1833
116 Ga0105241_10080693 3300009174 Bacteria 2547
117 Ga0105242_10302107 3300009176 Bacteria 1461
118 Ga0105242_10316491 3300009176 Bacteria 1430
119 Ga0105242_10332031 3300009176 Bacteria 1398
120 Ga0105237_10061879 3300009545 Bacteria 3741
121 Ga0105249_10382271 3300009553 Bacteria 1434
122 Ga0105249_10417675 3300009553 Unclassified 1374
123 Ga0157373_10000744 3300013100 Bacteria 25276
124 Ga0157373_10006313 3300013100 Bacteria 8856
125 Ga0157373_10015952 3300013100 Bacteria 5485
126 Ga0157373_10151458 3300013100 Bacteria 1631
127 Ga0157371_10005253 3300013102 Bacteria 10993
128 Ga0157371_10007464 3300013102 Bacteria 8848
129 Ga0157371_10018751 3300013102 Bacteria 5112
130 Ga0157371_10020291 3300013102 Bacteria 4891
131 Ga0157371_10020602 3300013102 Bacteria 4853
132 Ga0157371_10028461 3300013102 Bacteria 4047
133 Ga0157371_10131835 3300013102 Bacteria 1778
134 Ga0157371_10154562 3300013102 Bacteria 1637
135 Ga0157371_10225711 3300013102 Bacteria 1345
136 Ga0157370_10001966 3300013104 Bacteria 25315
137 Ga0157370_10009435 3300013104 Bacteria 10427
138 Ga0157370_10058486 3300013104 Bacteria 3664
139 Ga0157370_10060593 3300013104 Bacteria 3592
140 Ga0157370_10074406 3300013104 Bacteria 3204
141 Ga0157370_10248839 3300013104 Bacteria 1644
142 Ga0157370_10280515 3300013104 Bacteria 1540
143 Ga0157370_10784113 3300013104 Bacteria 868
144 Ga0157369_10017167 3300013105 Bacteria 8131
145 Ga0157369_10020860 3300013105 Bacteria 7325
146 Ga0157369_10025296 3300013105 Bacteria 6590
147 Ga0157369_10213869 3300013105 Unclassified 2020
148 Ga0157369_10237420 3300013105 Bacteria 1904
149 Ga0157374_10055856 3300013296 Bacteria 3686
150 Ga0157374_10300316 3300013296 Unclassified 1588
151 Ga0157374_10917174 3300013296 Bacteria 894
152 Ga0157378_10036681 3300013297 Bacteria 4338
153 Ga0157378_10124796 3300013297 Bacteria 2377
154 Ga0157378_10729809 3300013297 Bacteria 1012
155 Ga0157378_10923955 3300013297 Bacteria 904
156 Ga0163162_10105425 3300013306 Bacteria 2913
157 Ga0163162_10343442 3300013306 Bacteria 1625
158 Ga0163162_10959450 3300013306 Bacteria 966
159 Ga0163162_11059311 3300013306 Bacteria 918
160 Ga0157372_10023115 3300013307 Bacteria 6737
161 Ga0157372_10052055 3300013307 Unclassified 4558
162 Ga0157372_10081615 3300013307 Bacteria 3660
163 Ga0157372_10093195 3300013307 Bacteria 3428
164 Ga0157372_10238334 3300013307 Bacteria 2110
165 Ga0157372_10266098 3300013307 Bacteria 1991
166 Ga0157372_10402786 3300013307 Bacteria 1594
167 Ga0157375_10118482 3300013308 Bacteria 2754
168 Ga0157375_10625040 3300013308 Bacteria 1235
169 Ga0157375_10858353 3300013308 Bacteria 1054
170 Ga0157379_10409074 3300014968 Bacteria 1248
171 Ga0157379_10898694 3300014968 Bacteria 840
172 Ga0157379_11226618 3300014968 Bacteria 722
173 Ga0157376_10395145 3300014969 Bacteria 1335
174 Ga0157376_10558624 3300014969 Bacteria 1134
175 Ga0163161_10156719 3300017792 Bacteria 1734
176 Ga0207656_10056947 3300025321 Unclassified 1705
177 Ga0207656_10065419 3300025321 Bacteria 1605
178 Ga0207642_10271956 3300025899 Bacteria 971
179 Ga0207680_10100543 3300025903 Bacteria 1857
180 Ga0207647_10100368 3300025904 Bacteria 1718
181 Ga0207643_10355657 3300025908 Bacteria 920
182 Ga0207705_10008705 3300025909 Bacteria 7395
183 Ga0207705_10018818 3300025909 Bacteria 4940
184 Ga0207705_10061211 3300025909 Bacteria 2719
185 Ga0207705_10063506 3300025909 Bacteria 2668
186 Ga0207705_10374452 3300025909 Bacteria 1099
187 Ga0207707_10046168 3300025912 Bacteria 3793
188 Ga0207707_10337884 3300025912 Bacteria 1299
189 Ga0207707_10586735 3300025912 Bacteria 944
190 Ga0207695_10070988 3300025913 Bacteria 3557
191 Ga0207671_10143319 3300025914 Bacteria 1842
192 Ga0207660_10457299 3300025917 Bacteria 1033
193 Ga0207660_10568907 3300025917 Bacteria 922
194 Ga0207657_10011956 3300025919 Bacteria 8590
195 Ga0207657_10048586 3300025919 Bacteria 3704
196 Ga0207657_10053417 3300025919 Bacteria 3500
197 Ga0207657_10124775 3300025919 Bacteria 2115
198 Ga0207657_10146547 3300025919 Bacteria 1925
199 Ga0207657_10464136 3300025919 Bacteria 993
200 Ga0207649_10169227 3300025920 Bacteria 1520
201 Ga0207652_10000367 3300025921 Bacteria 46853
202 Ga0207652_10035976 3300025921 Bacteria 4184
203 Ga0207652_10164641 3300025921 Bacteria 1988
204 Ga0207652_10348170 3300025921 Bacteria 1337
205 Ga0207681_10599588 3300025923 Unclassified 910
206 Ga0207650_10570148 3300025925 Bacteria 950
207 Ga0207659_10316230 3300025926 Bacteria 1287
208 Ga0207659_10354505 3300025926 Bacteria 1218
209 Ga0207644_10119445 3300025931 Bacteria 2005
210 Ga0207644_10178243 3300025931 Bacteria 1664
211 Ga0207690_10246317 3300025932 Bacteria 1378
212 Ga0207706_10026446 3300025933 Bacteria 5194
213 Ga0207686_10226906 3300025934 Bacteria 1352
214 Ga0207686_10229961 3300025934 Bacteria 1344
215 Ga0207709_10334437 3300025935 Bacteria 1138
216 Ga0207689_10072474 3300025942 Unclassified 2830
217 Ga0207661_10042414 3300025944 Bacteria 3587
218 Ga0207661_11115107 3300025944 Bacteria 726
219 Ga0207679_10180195 3300025945 Bacteria 1747
220 Ga0207667_10036567 3300025949 Bacteria 5261
221 Ga0207667_10045069 3300025949 Bacteria 4671
222 Ga0207667_10247878 3300025949 Bacteria 1822
223 Ga0207667_10898108 3300025949 Bacteria 878
224 Ga0207651_10186185 3300025960 Bacteria 1652
225 Ga0207712_10423267 3300025961 Unclassified 1124
226 Ga0207640_10038229 3300025981 Bacteria 3027
227 Ga0207640_10172528 3300025981 Bacteria 1613
228 Ga0207640_10370136 3300025981 Bacteria 1158
229 Ga0207640_10473268 3300025981 Bacteria 1037
230 Ga0207640_10780640 3300025981 Bacteria 826
231 Ga0207658_10152402 3300025986 Bacteria 1885
232 Ga0207658_10420167 3300025986 Bacteria 1179
233 Ga0207658_10449041 3300025986 Unclassified 1141
234 Ga0207658_11658295 3300025986 Bacteria 584
235 Ga0207639_10006922 3300026041 Bacteria 7724
236 Ga0207639_10013205 3300026041 Bacteria 5774
237 Ga0207639_10088230 3300026041 Bacteria 2474
238 Ga0207678_10022450 3300026067 Bacteria 5526
239 Ga0207678_10240634 3300026067 Bacteria 1550
240 Ga0207702_10040682 3300026078 Bacteria 3896
241 Ga0207702_10179723 3300026078 Bacteria 1947
242 Ga0207641_11139133 3300026088 Bacteria 779
243 Ga0207648_10019562 3300026089 Bacteria 6111
244 Ga0207648_10032961 3300026089 Bacteria 4571
245 Ga0207648_10126260 3300026089 Bacteria 2250
246 Ga0207648_10444338 3300026089 Bacteria 1180
247 Ga0207676_10140051 3300026095 Bacteria 2070
248 Ga0207676_10200746 3300026095 Bacteria 1762
249 Ga0207676_10936820 3300026095 Bacteria 851
250 Ga0207675_100222042 3300026118 Bacteria 1821
251 Ga0207683_10184547 3300026121 Bacteria 1892
252 Ga0207698_10084469 3300026142 Bacteria 2574
253 Ga0207698_10221897 3300026142 Unclassified 1709
254 Ga0207698_11419117 3300026142 Bacteria 709
255 Ga0268265_10011975 3300028380 Bacteria 5870
256 Ga0268264_10017026 3300028381 Bacteria 5951
257 Ga0307515_10000002 3300028794 Bacteria 1231751
258 Ga0307509_10136011 3300031507 Bacteria 2403
259 Ga0307413_10280535 3300031824 Bacteria 1253
260 Ga0307406_10386856 3300031901 Bacteria 1105
261 Ga0307416_100734561 3300032002 Bacteria 1079
262 Ga0307414_10097956 3300032004 Bacteria 2199
263 Ga0307414_10163974 3300032004 Bacteria 1769
264 Ga0307415_100476161 3300032126 Bacteria 1086
265 Ga0373931_0341675 3300035691 Unclassified 935
266 Ga0395899_0141339 3300037312 Bacteria 1712
267 Ga0395900_0164885 3300037418 Bacteria 2258
268 Ga0395900_0976683 3300037418 Unclassified 767
269 Ga0395898_0044105 3300037466 Bacteria 4392
270 Ga0395898_0058112 3300037466 Unclassified 3766
271 Ga0395898_0144789 3300037466 Bacteria 2274
272 Ga0395905_0324470 3300037471 Bacteria 1430
273 Ga0450923_004832 3300042125 Bacteria 2138
274 Ga0495598_0096336 3300046537 Bacteria 973
275 Ga0495668_0000310 3300046616 Bacteria 67405
276 Ga0495611_0059741 3300046648 Bacteria 1731
277 Ga0495686_0025182 3300047472 Bacteria 3902
278 Ga0495686_0044572 3300047472 Unclassified 2808
279 Ga0496110_1164251 3300048913 Bacteria 680
280 Ga0501034_0000277 3300049571 Bacteria 92445
281 Ga0501034_1008332 3300049571 Unclassified 716
282 Ga0501070_0044047 3300049586 Bacteria 3714
283 Ga0501201_018413 3300049651 Bacteria 726
284 Ga0501202_095755 3300049652 Bacteria 716
285 Ga0501207_044016 3300049654 Bacteria 782
286 Ga0501217_025492 3300049661 Bacteria 1422
287 Ga0501222_062774 3300049662 Unclassified 565
288 Ga0501223_027122 3300049663 Bacteria 1115
289 Ga0501240_027972 3300049673 Bacteria 888
290 Ga0501243_036268 3300049675 Bacteria 855
291 Ga0501221_078817 3300049704 Bacteria 789
292 Ga0501234_037630 3300049707 Bacteria 788
293 Ga0501232_011781 3300049757 Bacteria 1009
294 Ga0501266_023634 3300049763 Bacteria 849
295 Ga0501279_026683 3300049775 Bacteria 844
296 nmdc:mga0k408_19019_c1 3300050493 Bacteria 3835
297 nmdc:mga07m45_380255_c1 3300050496 Unclassified 820
298 Ga0500566_0317377 3300053094 Unclassified 727
299 Ga0500568_0000527 3300053139 Bacteria 28313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0044572 Ga0495686_0044572_989_1498 150
2 3300050493 nmdc:mga0k408_19019_c1 nmdc:mga0k408_19019_c1_234_743 150
3 3300050496 nmdc:mga07m45_380255_c1 nmdc:mga07m45_380255_c1_243_752 150
4 3300006195 Ga0075366_10009956 Ga0075366_100099563 161
5 3300047472 Ga0495686_0025182 Ga0495686_0025182_3337_3879 161
6 3300031507 Ga0307509_10136011 Ga0307509_101360112 166
7 3300025935 Ga0207709_10334437 Ga0207709_103344371 167
8 3300026089 Ga0207648_10444338 Ga0207648_104443382 167
9 3300049662 Ga0501222_062774 Ga0501222_062774_40_549 168
10 3300049763 Ga0501266_023634 Ga0501266_023634_106_618 169
11 3300005548 Ga0070665_101048088 Ga0070665_1010480881 172
12 3300005616 Ga0068852_101138603 Ga0068852_1011386032 174
13 iso_pu_bacteria 3003233435 3003236135 176
14 3300026089 Ga0207648_10032961 Ga0207648_100329616 178
15 3300046616 Ga0495668_0000310 Ga0495668_0000310_46914_47456 178
16 3300005327 Ga0070658_10406907 Ga0070658_104069072 179
17 3300005329 Ga0070683_100187964 Ga0070683_1001879642 179
18 3300005329 Ga0070683_100416744 Ga0070683_1004167442 179
19 3300005347 Ga0070668_100028705 Ga0070668_1000287054 179
20 3300005459 Ga0068867_100403642 Ga0068867_1004036422 179
21 3300005530 Ga0070679_100319847 Ga0070679_1003198472 179
22 3300005539 Ga0068853_100006544 Ga0068853_1000065446 179
23 3300005563 Ga0068855_100152381 Ga0068855_1001523812 179
24 3300005563 Ga0068855_101004827 Ga0068855_1010048272 179
25 3300005578 Ga0068854_100030330 Ga0068854_1000303302 179
26 3300005614 Ga0068856_100034859 Ga0068856_1000348594 179
27 3300005616 Ga0068852_100023537 Ga0068852_1000235372 179
28 3300005985 Ga0081539_10000910 Ga0081539_100009108 179
29 3300009093 Ga0105240_10405608 Ga0105240_104056082 179
30 3300009148 Ga0105243_10180938 Ga0105243_101809382 179
31 3300009174 Ga0105241_10080693 Ga0105241_100806932 179
32 3300009176 Ga0105242_10332031 Ga0105242_103320313 179
33 3300009545 Ga0105237_10061879 Ga0105237_100618795 179
34 3300013100 Ga0157373_10006313 Ga0157373_100063137 179
35 3300013105 Ga0157369_10017167 Ga0157369_100171671 179
36 3300013296 Ga0157374_10300316 Ga0157374_103003162 179
37 3300013307 Ga0157372_10402786 Ga0157372_104027862 179
38 3300025913 Ga0207695_10070988 Ga0207695_100709883 179
39 3300025914 Ga0207671_10143319 Ga0207671_101433192 179
40 3300025921 Ga0207652_10035976 Ga0207652_100359763 179
41 3300025934 Ga0207686_10229961 Ga0207686_102299612 179
42 3300025949 Ga0207667_10045069 Ga0207667_100450694 179
43 3300025949 Ga0207667_10898108 Ga0207667_108981081 179
44 3300025981 Ga0207640_10038229 Ga0207640_100382293 179
45 3300026041 Ga0207639_10006922 Ga0207639_100069225 179
46 3300026041 Ga0207639_10013205 Ga0207639_100132053 179
47 3300026142 Ga0207698_10084469 Ga0207698_100844692 179
48 3300028794 Ga0307515_10000002 Ga0307515_10000002519 179
49 3300037312 Ga0395899_0141339 Ga0395899_0141339_314_859 179
50 3300042125 Ga0450923_004832 Ga0450923_004832_609_1202 179
51 3300046537 Ga0495598_0096336 Ga0495598_0096336_152_697 179
52 3300053094 Ga0500566_0317377 Ga0500566_0317377_63_605 179
53 3300053139 Ga0500568_0000527 Ga0500568_0000527_10194_10739 179
54 3300001989 JGI24739J22299_10058599 JGI24739J22299_100585992 180
55 3300003316 rootH1_10047048 rootH1_100470483 180
56 3300003320 rootH2_10120510 rootH2_101205104 180
57 3300003322 rootL2_10086859 rootL2_100868594 180
58 3300005290 Ga0065712_10110322 Ga0065712_101103222 180
59 3300005327 Ga0070658_10006339 Ga0070658_100063394 180
60 3300005327 Ga0070658_10015933 Ga0070658_100159337 180
61 3300005327 Ga0070658_10034460 Ga0070658_100344603 180
62 3300005327 Ga0070658_10074124 Ga0070658_100741242 180
63 3300005327 Ga0070658_10101850 Ga0070658_101018502 180
64 3300005328 Ga0070676_10077962 Ga0070676_100779622 180
65 3300005329 Ga0070683_100192565 Ga0070683_1001925652 180
66 3300005329 Ga0070683_101503330 Ga0070683_1015033301 180
67 3300005330 Ga0070690_100138257 Ga0070690_1001382572 180
68 3300005331 Ga0070670_100759487 Ga0070670_1007594872 180
69 3300005333 Ga0070677_10193608 Ga0070677_101936081 180
70 3300005335 Ga0070666_10034316 Ga0070666_100343163 180
71 3300005336 Ga0070680_100101623 Ga0070680_1001016231 180
72 3300005336 Ga0070680_100196143 Ga0070680_1001961432 180
73 3300005336 Ga0070680_100623340 Ga0070680_1006233401 180
74 3300005337 Ga0070682_100099197 Ga0070682_1000991972 180
75 3300005337 Ga0070682_100225504 Ga0070682_1002255042 180
76 3300005339 Ga0070660_100002757 Ga0070660_10000275711 180
77 3300005339 Ga0070660_100048562 Ga0070660_1000485624 180
78 3300005339 Ga0070660_100053642 Ga0070660_1000536422 180
79 3300005344 Ga0070661_100010700 Ga0070661_1000107009 180
80 3300005344 Ga0070661_100181111 Ga0070661_1001811112 180
81 3300005345 Ga0070692_10105360 Ga0070692_101053602 180
82 3300005353 Ga0070669_100073068 Ga0070669_1000730681 180
83 3300005354 Ga0070675_100169042 Ga0070675_1001690422 180
84 3300005354 Ga0070675_100321929 Ga0070675_1003219292 180
85 3300005355 Ga0070671_100068349 Ga0070671_1000683493 180
86 3300005355 Ga0070671_100190922 Ga0070671_1001909222 180
87 3300005364 Ga0070673_100277090 Ga0070673_1002770902 180
88 3300005364 Ga0070673_101423239 Ga0070673_1014232391 180
89 3300005366 Ga0070659_100140050 Ga0070659_1001400502 180
90 3300005367 Ga0070667_100136245 Ga0070667_1001362452 180
91 3300005367 Ga0070667_100427424 Ga0070667_1004274241 180
92 3300005367 Ga0070667_100443040 Ga0070667_1004430402 180
93 3300005455 Ga0070663_100065821 Ga0070663_1000658213 180
94 3300005455 Ga0070663_100168276 Ga0070663_1001682762 180
95 3300005455 Ga0070663_100170445 Ga0070663_1001704452 180
96 3300005455 Ga0070663_100316029 Ga0070663_1003160292 180
97 3300005457 Ga0070662_100011733 Ga0070662_1000117332 180
98 3300005458 Ga0070681_10135873 Ga0070681_101358733 180
99 3300005458 Ga0070681_10445586 Ga0070681_104455862 180
100 3300005459 Ga0068867_100415218 Ga0068867_1004152181 180
101 3300005459 Ga0068867_100642229 Ga0068867_1006422292 180
102 3300005530 Ga0070679_100001499 Ga0070679_1000014992 180
103 3300005530 Ga0070679_100135754 Ga0070679_1001357543 180
104 3300005530 Ga0070679_100542856 Ga0070679_1005428562 180
105 3300005530 Ga0070679_101024801 Ga0070679_1010248011 180
106 3300005535 Ga0070684_100018262 Ga0070684_1000182628 180
107 3300005535 Ga0070684_100475762 Ga0070684_1004757621 180
108 3300005539 Ga0068853_100008077 Ga0068853_1000080779 180
109 3300005539 Ga0068853_100034132 Ga0068853_1000341325 180
110 3300005539 Ga0068853_100063881 Ga0068853_1000638814 180
111 3300005544 Ga0070686_100269847 Ga0070686_1002698472 180
112 3300005544 Ga0070686_100369768 Ga0070686_1003697681 180
113 3300005563 Ga0068855_100018796 Ga0068855_1000187965 180
114 3300005563 Ga0068855_100050834 Ga0068855_1000508342 180
115 3300005563 Ga0068855_100489587 Ga0068855_1004895873 180
116 3300005563 Ga0068855_101330049 Ga0068855_1013300491 180
117 3300005564 Ga0070664_100098249 Ga0070664_1000982493 180
118 3300005578 Ga0068854_100184355 Ga0068854_1001843552 180
119 3300005578 Ga0068854_100340402 Ga0068854_1003404022 180
120 3300005578 Ga0068854_100653802 Ga0068854_1006538021 180
121 3300005578 Ga0068854_100790526 Ga0068854_1007905261 180
122 3300005578 Ga0068854_100833438 Ga0068854_1008334381 180
123 3300005614 Ga0068856_100051522 Ga0068856_1000515223 180
124 3300005614 Ga0068856_100127777 Ga0068856_1001277772 180
125 3300005614 Ga0068856_100158712 Ga0068856_1001587123 180
126 3300005616 Ga0068852_100318106 Ga0068852_1003181062 180
127 3300005616 Ga0068852_100576993 Ga0068852_1005769931 180
128 3300005616 Ga0068852_100790640 Ga0068852_1007906402 180
129 3300005617 Ga0068859_100226285 Ga0068859_1002262852 180
130 3300005617 Ga0068859_100812394 Ga0068859_1008123941 180
131 3300005618 Ga0068864_100036597 Ga0068864_1000365974 180
132 3300005618 Ga0068864_100611483 Ga0068864_1006114832 180
133 3300005718 Ga0068866_10453473 Ga0068866_104534731 180
134 3300005719 Ga0068861_100303376 Ga0068861_1003033762 180
135 3300005834 Ga0068851_10108624 Ga0068851_101086242 180
136 3300005834 Ga0068851_10527948 Ga0068851_105279481 180
137 3300005840 Ga0068870_10404455 Ga0068870_104044551 180
138 3300005842 Ga0068858_100264324 Ga0068858_1002643242 180
139 3300005842 Ga0068858_100393521 Ga0068858_1003935212 180
140 3300005843 Ga0068860_100035207 Ga0068860_1000352073 180
141 3300005843 Ga0068860_100213352 Ga0068860_1002133522 180
142 3300005844 Ga0068862_100010232 Ga0068862_1000102322 180
143 3300006163 Ga0070715_10100674 Ga0070715_101006743 180
144 3300006237 Ga0097621_100003997 Ga0097621_1000039974 180
145 3300006237 Ga0097621_100341591 Ga0097621_1003415912 180
146 3300006358 Ga0068871_100074198 Ga0068871_1000741983 180
147 3300006358 Ga0068871_100125898 Ga0068871_1001258982 180
148 3300006358 Ga0068871_100582702 Ga0068871_1005827022 180
149 3300006931 Ga0097620_100226292 Ga0097620_1002262922 180
150 3300006931 Ga0097620_100812586 Ga0097620_1008125861 180
151 3300009176 Ga0105242_10302107 Ga0105242_103021072 180
152 3300009176 Ga0105242_10316491 Ga0105242_103164911 180
153 3300009553 Ga0105249_10382271 Ga0105249_103822712 180
154 3300009553 Ga0105249_10417675 Ga0105249_104176752 180
155 3300013100 Ga0157373_10000744 Ga0157373_1000074417 180
156 3300013100 Ga0157373_10015952 Ga0157373_100159522 180
157 3300013100 Ga0157373_10151458 Ga0157373_101514582 180
158 3300013102 Ga0157371_10005253 Ga0157371_100052534 180
159 3300013102 Ga0157371_10007464 Ga0157371_100074648 180
160 3300013102 Ga0157371_10018751 Ga0157371_100187515 180
161 3300013102 Ga0157371_10020291 Ga0157371_100202914 180
162 3300013102 Ga0157371_10020602 Ga0157371_100206024 180
163 3300013102 Ga0157371_10028461 Ga0157371_100284612 180
164 3300013102 Ga0157371_10131835 Ga0157371_101318353 180
165 3300013102 Ga0157371_10154562 Ga0157371_101545621 180
166 3300013102 Ga0157371_10225711 Ga0157371_102257112 180
167 3300013104 Ga0157370_10001966 Ga0157370_100019667 180
168 3300013104 Ga0157370_10009435 Ga0157370_100094355 180
169 3300013104 Ga0157370_10058486 Ga0157370_100584862 180
170 3300013104 Ga0157370_10060593 Ga0157370_100605934 180
171 3300013104 Ga0157370_10074406 Ga0157370_100744062 180
172 3300013104 Ga0157370_10248839 Ga0157370_102488393 180
173 3300013104 Ga0157370_10280515 Ga0157370_102805152 180
174 3300013104 Ga0157370_10784113 Ga0157370_107841132 180
175 3300013105 Ga0157369_10020860 Ga0157369_100208602 180
176 3300013105 Ga0157369_10025296 Ga0157369_100252966 180
177 3300013105 Ga0157369_10213869 Ga0157369_102138692 180
178 3300013105 Ga0157369_10237420 Ga0157369_102374203 180
179 3300013296 Ga0157374_10055856 Ga0157374_100558565 180
180 3300013296 Ga0157374_10917174 Ga0157374_109171742 180
181 3300013297 Ga0157378_10036681 Ga0157378_100366812 180
182 3300013297 Ga0157378_10124796 Ga0157378_101247963 180
183 3300013297 Ga0157378_10729809 Ga0157378_107298091 180
184 3300013297 Ga0157378_10923955 Ga0157378_109239551 180
185 3300013306 Ga0163162_10105425 Ga0163162_101054255 180
186 3300013306 Ga0163162_10343442 Ga0163162_103434422 180
187 3300013306 Ga0163162_10959450 Ga0163162_109594501 180
188 3300013306 Ga0163162_11059311 Ga0163162_110593111 180
189 3300013307 Ga0157372_10023115 Ga0157372_100231157 180
190 3300013307 Ga0157372_10052055 Ga0157372_100520554 180
191 3300013307 Ga0157372_10081615 Ga0157372_100816154 180
192 3300013307 Ga0157372_10093195 Ga0157372_100931953 180
193 3300013307 Ga0157372_10238334 Ga0157372_102383343 180
194 3300013307 Ga0157372_10266098 Ga0157372_102660982 180
195 3300013308 Ga0157375_10118482 Ga0157375_101184825 180
196 3300013308 Ga0157375_10625040 Ga0157375_106250402 180
197 3300013308 Ga0157375_10858353 Ga0157375_108583532 180
198 3300014968 Ga0157379_10409074 Ga0157379_104090742 180
199 3300014968 Ga0157379_10898694 Ga0157379_108986941 180
200 3300014968 Ga0157379_11226618 Ga0157379_112266181 180
201 3300014969 Ga0157376_10395145 Ga0157376_103951452 180
202 3300014969 Ga0157376_10558624 Ga0157376_105586242 180
203 3300017792 Ga0163161_10156719 Ga0163161_101567192 180
204 3300025321 Ga0207656_10056947 Ga0207656_100569473 180
205 3300025321 Ga0207656_10065419 Ga0207656_100654192 180
206 3300025899 Ga0207642_10271956 Ga0207642_102719562 180
207 3300025903 Ga0207680_10100543 Ga0207680_101005432 180
208 3300025904 Ga0207647_10100368 Ga0207647_101003682 180
209 3300025908 Ga0207643_10355657 Ga0207643_103556572 180
210 3300025909 Ga0207705_10008705 Ga0207705_100087053 180
211 3300025909 Ga0207705_10018818 Ga0207705_100188182 180
212 3300025909 Ga0207705_10061211 Ga0207705_100612112 180
213 3300025909 Ga0207705_10063506 Ga0207705_100635061 180
214 3300025909 Ga0207705_10374452 Ga0207705_103744522 180
215 3300025912 Ga0207707_10046168 Ga0207707_100461682 180
216 3300025912 Ga0207707_10337884 Ga0207707_103378842 180
217 3300025912 Ga0207707_10586735 Ga0207707_105867352 180
218 3300025917 Ga0207660_10457299 Ga0207660_104572991 180
219 3300025917 Ga0207660_10568907 Ga0207660_105689071 180
220 3300025919 Ga0207657_10011956 Ga0207657_100119562 180
221 3300025919 Ga0207657_10048586 Ga0207657_100485862 180
222 3300025919 Ga0207657_10053417 Ga0207657_100534172 180
223 3300025919 Ga0207657_10124775 Ga0207657_101247752 180
224 3300025919 Ga0207657_10146547 Ga0207657_101465471 180
225 3300025919 Ga0207657_10464136 Ga0207657_104641362 180
226 3300025920 Ga0207649_10169227 Ga0207649_101692272 180
227 3300025921 Ga0207652_10000367 Ga0207652_1000036725 180
228 3300025921 Ga0207652_10164641 Ga0207652_101646412 180
229 3300025921 Ga0207652_10348170 Ga0207652_103481702 180
230 3300025923 Ga0207681_10599588 Ga0207681_105995882 180
231 3300025925 Ga0207650_10570148 Ga0207650_105701482 180
232 3300025926 Ga0207659_10316230 Ga0207659_103162301 180
233 3300025926 Ga0207659_10354505 Ga0207659_103545052 180
234 3300025931 Ga0207644_10119445 Ga0207644_101194452 180
235 3300025931 Ga0207644_10178243 Ga0207644_101782432 180
236 3300025932 Ga0207690_10246317 Ga0207690_102463172 180
237 3300025933 Ga0207706_10026446 Ga0207706_100264465 180
238 3300025934 Ga0207686_10226906 Ga0207686_102269061 180
239 3300025942 Ga0207689_10072474 Ga0207689_100724743 180
240 3300025944 Ga0207661_10042414 Ga0207661_100424143 180
241 3300025944 Ga0207661_11115107 Ga0207661_111151071 180
242 3300025945 Ga0207679_10180195 Ga0207679_101801952 180
243 3300025949 Ga0207667_10036567 Ga0207667_100365672 180
244 3300025949 Ga0207667_10247878 Ga0207667_102478782 180
245 3300025960 Ga0207651_10186185 Ga0207651_101861853 180
246 3300025961 Ga0207712_10423267 Ga0207712_104232672 180
247 3300025981 Ga0207640_10172528 Ga0207640_101725281 180
248 3300025981 Ga0207640_10370136 Ga0207640_103701362 180
249 3300025981 Ga0207640_10473268 Ga0207640_104732681 180
250 3300025981 Ga0207640_10780640 Ga0207640_107806401 180
251 3300025986 Ga0207658_10152402 Ga0207658_101524023 180
252 3300025986 Ga0207658_10420167 Ga0207658_104201672 180
253 3300025986 Ga0207658_10449041 Ga0207658_104490411 180
254 3300025986 Ga0207658_11658295 Ga0207658_116582951 180
255 3300026041 Ga0207639_10088230 Ga0207639_100882302 180
256 3300026067 Ga0207678_10022450 Ga0207678_100224504 180
257 3300026067 Ga0207678_10240634 Ga0207678_102406342 180
258 3300026078 Ga0207702_10040682 Ga0207702_100406822 180
259 3300026078 Ga0207702_10179723 Ga0207702_101797232 180
260 3300026088 Ga0207641_11139133 Ga0207641_111391331 180
261 3300026089 Ga0207648_10019562 Ga0207648_100195624 180
262 3300026089 Ga0207648_10126260 Ga0207648_101262602 180
263 3300026095 Ga0207676_10140051 Ga0207676_101400513 180
264 3300026095 Ga0207676_10200746 Ga0207676_102007462 180
265 3300026095 Ga0207676_10936820 Ga0207676_109368202 180
266 3300026118 Ga0207675_100222042 Ga0207675_1002220421 180
267 3300026121 Ga0207683_10184547 Ga0207683_101845471 180
268 3300026142 Ga0207698_10221897 Ga0207698_102218972 180
269 3300026142 Ga0207698_11419117 Ga0207698_114191171 180
270 3300028380 Ga0268265_10011975 Ga0268265_100119751 180
271 3300028381 Ga0268264_10017026 Ga0268264_100170264 180
272 3300031824 Ga0307413_10280535 Ga0307413_102805352 180
273 3300031901 Ga0307406_10386856 Ga0307406_103868562 180
274 3300032002 Ga0307416_100734561 Ga0307416_1007345612 180
275 3300032004 Ga0307414_10097956 Ga0307414_100979562 180
276 3300032004 Ga0307414_10163974 Ga0307414_101639741 180
277 3300032126 Ga0307415_100476161 Ga0307415_1004761611 180
278 3300035691 Ga0373931_0341675 Ga0373931_0341675_47_655 180
279 3300037418 Ga0395900_0164885 Ga0395900_0164885_34_582 180
280 3300037418 Ga0395900_0976683 Ga0395900_0976683_49_597 180
281 3300037466 Ga0395898_0044105 Ga0395898_0044105_3392_3994 180
282 3300037466 Ga0395898_0058112 Ga0395898_0058112_1161_1709 180
283 3300037466 Ga0395898_0144789 Ga0395898_0144789_481_1029 180
284 3300037471 Ga0395905_0324470 Ga0395905_0324470_480_1028 180
285 3300046648 Ga0495611_0059741 Ga0495611_0059741_552_1100 180
286 3300048913 Ga0496110_1164251 Ga0496110_1164251_22_564 180
287 3300049571 Ga0501034_0000277 Ga0501034_0000277_14650_15222 180
288 3300049571 Ga0501034_1008332 Ga0501034_1008332_54_602 180
289 3300049586 Ga0501070_0044047 Ga0501070_0044047_1009_1557 180
290 3300049651 Ga0501201_018413 Ga0501201_018413_143_688 180
291 3300049652 Ga0501202_095755 Ga0501202_095755_147_692 180
292 3300049654 Ga0501207_044016 Ga0501207_044016_169_714 180
293 3300049661 Ga0501217_025492 Ga0501217_025492_781_1326 180
294 3300049663 Ga0501223_027122 Ga0501223_027122_376_921 180
295 3300049673 Ga0501240_027972 Ga0501240_027972_102_647 180
296 3300049675 Ga0501243_036268 Ga0501243_036268_147_692 180
297 3300049704 Ga0501221_078817 Ga0501221_078817_161_706 180
298 3300049707 Ga0501234_037630 Ga0501234_037630_193_738 180
299 3300049757 Ga0501232_011781 Ga0501232_011781_385_930 180
300 3300049775 Ga0501279_026683 Ga0501279_026683_199_744 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

27

96

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

133

181

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

128

179

0.91

PF07638

Sigma70_ECF

ECF sigma factor

9

185

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vim-assembly1.cif.gz_B-2 the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9663 131 179
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9589 131 174
7r3i-assembly1.cif.gz_A pross optimitzed variant of rhlr (61 mutations) in complex with the synthetic antagonist mbtl 0.9559 131 169
5o8y-assembly1.cif.gz_D conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. 0.9551 131 174
6eo3-assembly1.cif.gz_B conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 0.9547 131 174
ID Description Score Start End Superfamily
af_P9WGH7_10_94_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.981 12 92 1.10.1740.10
1or7B01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9485 12 93 1.10.1740.10
3qp6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9477 131 169 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9329 130 174 1.10.10.10
3vdoA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9301 124 178 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q5WDK1-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9301 1 98 GO:0006352
GO:0016987
AF-A0A4Q5WDK1-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9028 1 98 GO:0006352
GO:0016987
AF-A0A4V1SQL6-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8501 7 118 GO:0006352
GO:0016987
AF-A0A6H9LDW8-F1-model_v4 deleted 0.7934 7 133
AF-A0A4V1SQL6-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7656 7 118 GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
84.91 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map