F395397
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 162 | 295 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300025906|Ga0207699_10449209|Ga0207699_104492091 |
| Length | 122 |
| Sequence | MPIFAASITLASTGAGYWALVVQRLIPPLLLLHPDDNILVARRDIAAGEQVQLDGEDFVIPAAVELGHKLARRALAADTRVLKYGAPIGSMKTAVARGEHVHLHNLRSDYIPSTTRGGSEGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 2 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 3 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 4 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 5 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 118 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 124 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 133 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 134 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 135 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 136 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 162 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 0 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.33 |
| Nodule | 0 |
| Rhizoplane | 5.67 |
| Rhizosphere | 87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10383824 | 3300005328 | Unclassified | 973 |
| 2 | Ga0070676_10745562 | 3300005328 | Bacteria | 718 |
| 3 | Ga0070690_100164459 | 3300005330 | Bacteria | 1523 |
| 4 | Ga0070677_10015312 | 3300005333 | Bacteria | 2715 |
| 5 | Ga0068869_100196199 | 3300005334 | Bacteria | 1590 |
| 6 | Ga0068869_100424949 | 3300005334 | Bacteria | 1097 |
| 7 | Ga0068869_100672771 | 3300005334 | Bacteria | 881 |
| 8 | Ga0068869_100707300 | 3300005334 | Bacteria | 860 |
| 9 | Ga0070682_100032513 | 3300005337 | Bacteria | 3164 |
| 10 | Ga0070682_100623713 | 3300005337 | Bacteria | 855 |
| 11 | Ga0070689_100004511 | 3300005340 | Bacteria | 9430 |
| 12 | Ga0070689_100784565 | 3300005340 | Bacteria | 837 |
| 13 | Ga0070689_100863908 | 3300005340 | Bacteria | 799 |
| 14 | Ga0070689_101285523 | 3300005340 | Bacteria | 659 |
| 15 | Ga0070687_100502357 | 3300005343 | Bacteria | 816 |
| 16 | Ga0070692_10026119 | 3300005345 | Bacteria | 2884 |
| 17 | Ga0070692_10115589 | 3300005345 | Bacteria | 1490 |
| 18 | Ga0070668_100142771 | 3300005347 | Bacteria | 1931 |
| 19 | Ga0070668_100805715 | 3300005347 | Bacteria | 835 |
| 20 | Ga0070675_100168891 | 3300005354 | Bacteria | 1885 |
| 21 | Ga0070675_100912533 | 3300005354 | Bacteria | 805 |
| 22 | Ga0070675_101125987 | 3300005354 | Bacteria | 722 |
| 23 | Ga0070675_101582698 | 3300005354 | Bacteria | 605 |
| 24 | Ga0070674_100080172 | 3300005356 | Bacteria | 2330 |
| 25 | Ga0070674_100157403 | 3300005356 | Bacteria | 1720 |
| 26 | Ga0070673_100236694 | 3300005364 | Bacteria | 1586 |
| 27 | Ga0070688_100215749 | 3300005365 | Bacteria | 1350 |
| 28 | Ga0070688_100361891 | 3300005365 | Bacteria | 1065 |
| 29 | Ga0070688_100531041 | 3300005365 | Bacteria | 892 |
| 30 | Ga0070659_101926300 | 3300005366 | Bacteria | 530 |
| 31 | Ga0070667_101086428 | 3300005367 | Bacteria | 748 |
| 32 | Ga0070713_101870745 | 3300005436 | Bacteria | 582 |
| 33 | Ga0070710_10350395 | 3300005437 | Bacteria | 977 |
| 34 | Ga0070701_10502183 | 3300005438 | Bacteria | 788 |
| 35 | Ga0070701_11051110 | 3300005438 | Bacteria | 571 |
| 36 | Ga0070705_100007758 | 3300005440 | Bacteria | 5298 |
| 37 | Ga0070705_100921927 | 3300005440 | Unclassified | 704 |
| 38 | Ga0070700_100058609 | 3300005441 | Bacteria | 2420 |
| 39 | Ga0070700_100106822 | 3300005441 | Bacteria | 1854 |
| 40 | Ga0070700_100414129 | 3300005441 | Bacteria | 1017 |
| 41 | Ga0070700_100787805 | 3300005441 | Bacteria | 764 |
| 42 | Ga0070694_100656330 | 3300005444 | Bacteria | 849 |
| 43 | Ga0070663_101360361 | 3300005455 | Bacteria | 628 |
| 44 | Ga0070678_100037796 | 3300005456 | Bacteria | 3393 |
| 45 | Ga0070678_100107083 | 3300005456 | Unclassified | 2179 |
| 46 | Ga0070678_100329734 | 3300005456 | Bacteria | 1306 |
| 47 | Ga0070678_102229562 | 3300005456 | Bacteria | 519 |
| 48 | Ga0070662_101002458 | 3300005457 | Bacteria | 715 |
| 49 | Ga0070662_101678359 | 3300005457 | Unclassified | 549 |
| 50 | Ga0068867_100379576 | 3300005459 | Bacteria | 1187 |
| 51 | Ga0068867_101200585 | 3300005459 | Bacteria | 697 |
| 52 | Ga0070685_10160766 | 3300005466 | Bacteria | 1431 |
| 53 | Ga0070685_10235279 | 3300005466 | Unclassified | 1207 |
| 54 | Ga0070685_10919275 | 3300005466 | Bacteria | 652 |
| 55 | Ga0070685_10920939 | 3300005466 | Bacteria | 652 |
| 56 | Ga0068853_100402907 | 3300005539 | Bacteria | 1281 |
| 57 | Ga0070672_100003711 | 3300005543 | Bacteria | 9935 |
| 58 | Ga0070672_100043303 | 3300005543 | Bacteria | 3470 |
| 59 | Ga0070672_101215134 | 3300005543 | Bacteria | 672 |
| 60 | Ga0070686_100027897 | 3300005544 | Bacteria | 3420 |
| 61 | Ga0070686_100247394 | 3300005544 | Bacteria | 1301 |
| 62 | Ga0070686_100331035 | 3300005544 | Bacteria | 1138 |
| 63 | Ga0070696_100048784 | 3300005546 | Bacteria | 2940 |
| 64 | Ga0070665_100007631 | 3300005548 | Bacteria | 10997 |
| 65 | Ga0070665_100132367 | 3300005548 | Bacteria | 2496 |
| 66 | Ga0070704_101615921 | 3300005549 | Unclassified | 598 |
| 67 | Ga0070664_100748832 | 3300005564 | Bacteria | 912 |
| 68 | Ga0070664_100893759 | 3300005564 | Bacteria | 833 |
| 69 | Ga0068857_101456318 | 3300005577 | Unclassified | 667 |
| 70 | Ga0070702_100003604 | 3300005615 | Bacteria | 6958 |
| 71 | Ga0068859_100009079 | 3300005617 | Bacteria | 10043 |
| 72 | Ga0068859_100739363 | 3300005617 | Bacteria | 1073 |
| 73 | Ga0068864_100040826 | 3300005618 | Bacteria | 3968 |
| 74 | Ga0068864_100418115 | 3300005618 | Bacteria | 1277 |
| 75 | Ga0068861_100001242 | 3300005719 | Bacteria | 15887 |
| 76 | Ga0068861_100136226 | 3300005719 | Bacteria | 1998 |
| 77 | Ga0068861_100172070 | 3300005719 | Bacteria | 1796 |
| 78 | Ga0068851_10179712 | 3300005834 | Bacteria | 1171 |
| 79 | Ga0068870_10140218 | 3300005840 | Bacteria | 1414 |
| 80 | Ga0068863_100109281 | 3300005841 | Bacteria | 2632 |
| 81 | Ga0068863_100276248 | 3300005841 | Bacteria | 1627 |
| 82 | Ga0068863_100987061 | 3300005841 | Bacteria | 844 |
| 83 | Ga0068858_100745791 | 3300005842 | Bacteria | 954 |
| 84 | Ga0068860_100005609 | 3300005843 | Bacteria | 12680 |
| 85 | Ga0068860_102447706 | 3300005843 | Bacteria | 542 |
| 86 | Ga0068862_100008641 | 3300005844 | Bacteria | 8424 |
| 87 | Ga0068862_100640097 | 3300005844 | Bacteria | 1025 |
| 88 | Ga0068862_101316591 | 3300005844 | Bacteria | 724 |
| 89 | Ga0068862_101740917 | 3300005844 | Bacteria | 632 |
| 90 | Ga0068862_102368598 | 3300005844 | Bacteria | 543 |
| 91 | Ga0070716_100254952 | 3300006173 | Bacteria | 1197 |
| 92 | Ga0075366_10436735 | 3300006195 | Bacteria | 807 |
| 93 | Ga0097621_100005933 | 3300006237 | Bacteria | 8632 |
| 94 | Ga0097621_100032688 | 3300006237 | Bacteria | 4137 |
| 95 | Ga0097621_100388882 | 3300006237 | Bacteria | 1247 |
| 96 | Ga0068871_100004524 | 3300006358 | Bacteria | 9689 |
| 97 | Ga0068871_100128041 | 3300006358 | Bacteria | 2150 |
| 98 | Ga0068871_100234788 | 3300006358 | Bacteria | 1593 |
| 99 | Ga0068871_100480116 | 3300006358 | Bacteria | 1118 |
| 100 | Ga0068871_100683427 | 3300006358 | Bacteria | 939 |
| 101 | Ga0068865_100050707 | 3300006881 | Bacteria | 2869 |
| 102 | Ga0068865_100605376 | 3300006881 | Bacteria | 926 |
| 103 | Ga0068865_100676855 | 3300006881 | Bacteria | 879 |
| 104 | Ga0068865_101579903 | 3300006881 | Bacteria | 589 |
| 105 | Ga0097620_100009079 | 3300006931 | Bacteria | 10043 |
| 106 | Ga0097620_100739325 | 3300006931 | Bacteria | 1073 |
| 107 | Ga0111539_10407919 | 3300009094 | Unclassified | 1583 |
| 108 | Ga0111539_11907217 | 3300009094 | Bacteria | 689 |
| 109 | Ga0111539_12490940 | 3300009094 | Bacteria | 600 |
| 110 | Ga0105243_10413582 | 3300009148 | Bacteria | 1256 |
| 111 | Ga0105242_11128021 | 3300009176 | Bacteria | 800 |
| 112 | Ga0105248_10491073 | 3300009177 | Bacteria | 1384 |
| 113 | Ga0105248_10491530 | 3300009177 | Bacteria | 1383 |
| 114 | Ga0105238_11576649 | 3300009551 | Bacteria | 686 |
| 115 | Ga0105249_10132918 | 3300009553 | Bacteria | 2377 |
| 116 | Ga0105246_11545569 | 3300011119 | Bacteria | 625 |
| 117 | Ga0163162_11441663 | 3300013306 | Bacteria | 784 |
| 118 | Ga0157372_12894315 | 3300013307 | Bacteria | 550 |
| 119 | Ga0157375_10437696 | 3300013308 | Bacteria | 1473 |
| 120 | Ga0157375_10704723 | 3300013308 | Bacteria | 1163 |
| 121 | Ga0157375_10821068 | 3300013308 | Bacteria | 1078 |
| 122 | Ga0163163_10502169 | 3300014325 | Bacteria | 1275 |
| 123 | Ga0163163_12346832 | 3300014325 | Bacteria | 592 |
| 124 | Ga0163163_12346834 | 3300014325 | Bacteria | 592 |
| 125 | Ga0163163_12801561 | 3300014325 | Bacteria | 544 |
| 126 | Ga0157380_10221148 | 3300014326 | Bacteria | 1694 |
| 127 | Ga0157380_10245792 | 3300014326 | Bacteria | 1616 |
| 128 | Ga0157380_11654684 | 3300014326 | Unclassified | 697 |
| 129 | Ga0157379_10785200 | 3300014968 | Bacteria | 898 |
| 130 | Ga0157376_10055820 | 3300014969 | Bacteria | 3297 |
| 131 | Ga0157376_11448177 | 3300014969 | Bacteria | 719 |
| 132 | Ga0157376_12736120 | 3300014969 | Bacteria | 533 |
| 133 | Ga0207682_10012627 | 3300025893 | Bacteria | 3293 |
| 134 | Ga0207682_10061007 | 3300025893 | Bacteria | 1578 |
| 135 | Ga0207699_10449209 | 3300025906 | Bacteria | 924 |
| 136 | Ga0207645_10454841 | 3300025907 | Bacteria | 864 |
| 137 | Ga0207645_10981924 | 3300025907 | Bacteria | 572 |
| 138 | Ga0207643_10080363 | 3300025908 | Unclassified | 1888 |
| 139 | Ga0207663_10133504 | 3300025916 | Bacteria | 1719 |
| 140 | Ga0207662_10041603 | 3300025918 | Bacteria | 2706 |
| 141 | Ga0207681_10193071 | 3300025923 | Unclassified | 1559 |
| 142 | Ga0207659_10095916 | 3300025926 | Bacteria | 2225 |
| 143 | Ga0207659_10459948 | 3300025926 | Bacteria | 1073 |
| 144 | Ga0207659_10573528 | 3300025926 | Bacteria | 960 |
| 145 | Ga0207659_10702645 | 3300025926 | Bacteria | 866 |
| 146 | Ga0207644_10398345 | 3300025931 | Bacteria | 1125 |
| 147 | Ga0207644_10810879 | 3300025931 | Bacteria | 783 |
| 148 | Ga0207644_11036197 | 3300025931 | Bacteria | 689 |
| 149 | Ga0207690_11511633 | 3300025932 | Bacteria | 561 |
| 150 | Ga0207706_10320674 | 3300025933 | Bacteria | 1349 |
| 151 | Ga0207706_10722982 | 3300025933 | Bacteria | 850 |
| 152 | Ga0207706_10934977 | 3300025933 | Bacteria | 731 |
| 153 | Ga0207670_10455801 | 3300025936 | Unclassified | 1032 |
| 154 | Ga0207669_11754826 | 3300025937 | Bacteria | 530 |
| 155 | Ga0207704_10549693 | 3300025938 | Bacteria | 938 |
| 156 | Ga0207704_11137305 | 3300025938 | Bacteria | 664 |
| 157 | Ga0207704_11468289 | 3300025938 | Bacteria | 585 |
| 158 | Ga0207691_10001665 | 3300025940 | Bacteria | 21983 |
| 159 | Ga0207691_10007309 | 3300025940 | Bacteria | 10660 |
| 160 | Ga0207691_10066199 | 3300025940 | Unclassified | 3269 |
| 161 | Ga0207689_10033585 | 3300025942 | Bacteria | 4262 |
| 162 | Ga0207689_10112614 | 3300025942 | Bacteria | 2236 |
| 163 | Ga0207679_10068377 | 3300025945 | Bacteria | 2668 |
| 164 | Ga0207679_11305484 | 3300025945 | Bacteria | 666 |
| 165 | Ga0207651_10942345 | 3300025960 | Bacteria | 770 |
| 166 | Ga0207651_11133453 | 3300025960 | Unclassified | 701 |
| 167 | Ga0207668_10830246 | 3300025972 | Bacteria | 819 |
| 168 | Ga0207703_10085152 | 3300026035 | Bacteria | 2645 |
| 169 | Ga0207678_10415312 | 3300026067 | Bacteria | 1166 |
| 170 | Ga0207678_11078597 | 3300026067 | Bacteria | 711 |
| 171 | Ga0207708_10040257 | 3300026075 | Bacteria | 3562 |
| 172 | Ga0207708_10102472 | 3300026075 | Bacteria | 2216 |
| 173 | Ga0207708_10196742 | 3300026075 | Unclassified | 1607 |
| 174 | Ga0207708_10270036 | 3300026075 | Bacteria | 1375 |
| 175 | Ga0207708_11448816 | 3300026075 | Bacteria | 603 |
| 176 | Ga0207641_10085193 | 3300026088 | Bacteria | 2753 |
| 177 | Ga0207641_10127093 | 3300026088 | Bacteria | 2284 |
| 178 | Ga0207641_10348200 | 3300026088 | Bacteria | 1411 |
| 179 | Ga0207648_10158460 | 3300026089 | Bacteria | 1999 |
| 180 | Ga0207648_11073091 | 3300026089 | Bacteria | 755 |
| 181 | Ga0207676_10017628 | 3300026095 | Bacteria | 5178 |
| 182 | Ga0207674_11405547 | 3300026116 | Unclassified | 667 |
| 183 | Ga0207675_100002767 | 3300026118 | Bacteria | 17224 |
| 184 | Ga0207675_100079909 | 3300026118 | Bacteria | 3065 |
| 185 | Ga0207675_100104202 | 3300026118 | Bacteria | 2674 |
| 186 | Ga0207675_100326423 | 3300026118 | Bacteria | 1499 |
| 187 | Ga0207683_10080948 | 3300026121 | Bacteria | 2882 |
| 188 | Ga0207683_10587566 | 3300026121 | Bacteria | 1030 |
| 189 | Ga0207683_10613928 | 3300026121 | Bacteria | 1007 |
| 190 | Ga0207698_12417359 | 3300026142 | Bacteria | 536 |
| 191 | Ga0268266_10014542 | 3300028379 | Bacteria | 6764 |
| 192 | Ga0268266_10110426 | 3300028379 | Bacteria | 2436 |
| 193 | Ga0268265_10088447 | 3300028380 | Bacteria | 2468 |
| 194 | Ga0268265_10752729 | 3300028380 | Bacteria | 946 |
| 195 | Ga0307515_10122251 | 3300028794 | Bacteria | 2938 |
| 196 | Ga0307515_10639293 | 3300028794 | Bacteria | 676 |
| 197 | Ga0307513_10016612 | 3300031456 | Bacteria | 8869 |
| 198 | Ga0307513_10031568 | 3300031456 | Bacteria | 5996 |
| 199 | Ga0307513_10119918 | 3300031456 | Bacteria | 2601 |
| 200 | Ga0307513_10227006 | 3300031456 | Bacteria | 1683 |
| 201 | Ga0307509_10013273 | 3300031507 | Bacteria | 9765 |
| 202 | Ga0307509_10318814 | 3300031507 | Bacteria | 1292 |
| 203 | Ga0307408_100019836 | 3300031548 | Bacteria | 4529 |
| 204 | Ga0307408_100688180 | 3300031548 | Bacteria | 918 |
| 205 | Ga0307514_10097228 | 3300031649 | Bacteria | 2125 |
| 206 | Ga0307405_10432972 | 3300031731 | Bacteria | 1038 |
| 207 | Ga0307413_10001086 | 3300031824 | Bacteria | 9945 |
| 208 | Ga0307413_10020736 | 3300031824 | Bacteria | 3503 |
| 209 | Ga0307413_11860002 | 3300031824 | Bacteria | 540 |
| 210 | Ga0307410_10002061 | 3300031852 | Bacteria | 9505 |
| 211 | Ga0307410_10010352 | 3300031852 | Bacteria | 5278 |
| 212 | Ga0307410_10241617 | 3300031852 | Bacteria | 1400 |
| 213 | Ga0307406_11238556 | 3300031901 | Bacteria | 649 |
| 214 | Ga0307407_10013989 | 3300031903 | Bacteria | 3914 |
| 215 | Ga0307407_10109104 | 3300031903 | Bacteria | 1734 |
| 216 | Ga0307412_10522594 | 3300031911 | Bacteria | 992 |
| 217 | Ga0307412_10629038 | 3300031911 | Bacteria | 913 |
| 218 | Ga0307412_11174098 | 3300031911 | Bacteria | 686 |
| 219 | Ga0307412_11559427 | 3300031911 | Unclassified | 602 |
| 220 | Ga0307409_100001337 | 3300031995 | Bacteria | 11970 |
| 221 | Ga0307409_100009658 | 3300031995 | Bacteria | 5944 |
| 222 | Ga0307409_100109024 | 3300031995 | Bacteria | 2317 |
| 223 | Ga0307409_100152512 | 3300031995 | Bacteria | 2008 |
| 224 | Ga0307416_100014569 | 3300032002 | Bacteria | 5396 |
| 225 | Ga0307416_100267768 | 3300032002 | Bacteria | 1675 |
| 226 | Ga0307416_103133033 | 3300032002 | Bacteria | 553 |
| 227 | Ga0307414_10687753 | 3300032004 | Bacteria | 925 |
| 228 | Ga0307411_10004060 | 3300032005 | Bacteria | 6934 |
| 229 | Ga0307411_10010004 | 3300032005 | Bacteria | 5026 |
| 230 | Ga0307415_100027085 | 3300032126 | Bacteria | 3627 |
| 231 | Ga0307415_100236038 | 3300032126 | Bacteria | 1476 |
| 232 | Ga0307415_100455455 | 3300032126 | Bacteria | 1107 |
| 233 | Ga0307415_100726634 | 3300032126 | Bacteria | 899 |
| 234 | Ga0307415_102091823 | 3300032126 | Unclassified | 553 |
| 235 | Ga0373952_0227285 | 3300035092 | Bacteria | 557 |
| 236 | Ga0373954_0356886 | 3300035118 | Unclassified | 722 |
| 237 | Ga0373946_0490969 | 3300035171 | Bacteria | 629 |
| 238 | Ga0373955_0046603 | 3300035172 | Bacteria | 2344 |
| 239 | Ga0373937_0404618 | 3300036401 | Bacteria | 1295 |
| 240 | Ga0451787_581116 | 3300041441 | Bacteria | 1046 |
| 241 | Ga0451789_0387652 | 3300041443 | Bacteria | 2902 |
| 242 | Ga0451791_0357959 | 3300041451 | Bacteria | 3145 |
| 243 | Ga0451793_1516645 | 3300041452 | Bacteria | 1247 |
| 244 | Ga0451797_0281795 | 3300041453 | Bacteria | 783 |
| 245 | Ga0451797_0560866 | 3300041453 | Bacteria | 1357 |
| 246 | Ga0451795_0873199 | 3300041456 | Bacteria | 713 |
| 247 | Ga0451798_0328541 | 3300041458 | Bacteria | 593 |
| 248 | Ga0451802_1481030 | 3300041460 | Bacteria | 1409 |
| 249 | Ga0451802_2032572 | 3300041460 | Bacteria | 2996 |
| 250 | Ga0451804_1179540 | 3300041463 | Bacteria | 834 |
| 251 | Ga0451807_0306025 | 3300041486 | Bacteria | 3928 |
| 252 | Ga0451807_1755513 | 3300041486 | Bacteria | 2267 |
| 253 | Ga0451839_1214721 | 3300041496 | Bacteria | 613 |
| 254 | Ga0451851_0786283 | 3300041507 | Bacteria | 1381 |
| 255 | Ga0451853_1099279 | 3300041512 | Unclassified | 548 |
| 256 | Ga0451853_1469472 | 3300041512 | Bacteria | 1111 |
| 257 | Ga0451853_3461558 | 3300041512 | Bacteria | 653 |
| 258 | Ga0450916_013513 | 3300042530 | Bacteria | 1054 |
| 259 | Ga0495603_0548736 | 3300046455 | Bacteria | 662 |
| 260 | Ga0495590_0029330 | 3300046457 | Bacteria | 1929 |
| 261 | Ga0495591_175326 | 3300046458 | Bacteria | 511 |
| 262 | Ga0495638_0154837 | 3300046460 | Bacteria | 1327 |
| 263 | Ga0495641_0315306 | 3300046461 | Bacteria | 705 |
| 264 | Ga0495616_0010280 | 3300046513 | Bacteria | 5424 |
| 265 | Ga0495632_0124220 | 3300046519 | Unclassified | 1204 |
| 266 | Ga0495632_0234806 | 3300046519 | Bacteria | 826 |
| 267 | Ga0495621_0240454 | 3300046539 | Bacteria | 737 |
| 268 | Ga0495622_0115770 | 3300046557 | Bacteria | 1226 |
| 269 | Ga0495668_0360404 | 3300046616 | Unclassified | 798 |
| 270 | Ga0495668_0607624 | 3300046616 | Bacteria | 604 |
| 271 | Ga0495625_0039896 | 3300046660 | Bacteria | 3427 |
| 272 | Ga0495625_0114597 | 3300046660 | Bacteria | 1840 |
| 273 | Ga0495625_0209501 | 3300046660 | Bacteria | 1282 |
| 274 | Ga0495625_0388394 | 3300046660 | Unclassified | 874 |
| 275 | Ga0495649_0002702 | 3300046694 | Bacteria | 12358 |
| 276 | Ga0495649_0109107 | 3300046694 | Bacteria | 1468 |
| 277 | Ga0495649_0239777 | 3300046694 | Bacteria | 934 |
| 278 | Ga0495589_0604622 | 3300046794 | Bacteria | 500 |
| 279 | Ga0495600_0433490 | 3300046809 | Bacteria | 815 |
| 280 | Ga0495686_0060838 | 3300047472 | Bacteria | 2347 |
| 281 | Ga0496104_0341516 | 3300048907 | Bacteria | 1410 |
| 282 | Ga0496109_0603615 | 3300048912 | Bacteria | 1034 |
| 283 | Ga0496114_0115607 | 3300048917 | Bacteria | 2302 |
| 284 | Ga0496114_0149632 | 3300048917 | Bacteria | 2025 |
| 285 | Ga0501036_0856124 | 3300049572 | Unclassified | 747 |
| 286 | Ga0501040_0761581 | 3300049576 | Bacteria | 700 |
| 287 | Ga0501042_0066177 | 3300049578 | Bacteria | 2583 |
| 288 | Ga0501042_0558990 | 3300049578 | Bacteria | 832 |
| 289 | Ga0501042_0771216 | 3300049578 | Bacteria | 700 |
| 290 | Ga0501048_1138307 | 3300049582 | Bacteria | 561 |
| 291 | Ga0501075_0818534 | 3300049591 | Bacteria | 709 |
| 292 | nmdc:mga0k408_409425_c1 | 3300050493 | Bacteria | 807 |
| 293 | nmdc:mga08y16_677085_c1 | 3300050511 | Bacteria | 1033 |
| 294 | Ga0500651_0625418 | 3300053093 | Bacteria | 582 |
| 295 | Ga0500628_243495 | 3300053129 | Bacteria | 528 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031852 | Ga0307410_10241617 | Ga0307410_102416172 | 97 |
| 2 | 3300031911 | Ga0307412_11174098 | Ga0307412_111740982 | 97 |
| 3 | 3300041456 | Ga0451795_0873199 | Ga0451795_0873199_84_539 | 98 |
| 4 | 3300048917 | Ga0496114_0149632 | Ga0496114_0149632_583_894 | 98 |
| 5 | 3300005548 | Ga0070665_100132367 | Ga0070665_1001323672 | 99 |
| 6 | 3300006358 | Ga0068871_100683427 | Ga0068871_1006834272 | 99 |
| 7 | 3300028379 | Ga0268266_10110426 | Ga0268266_101104262 | 99 |
| 8 | iso_pu_bacteria | 2738541301 | 2738848274 | 99 |
| 9 | iso_pu_bacteria | 2738541304 | 2738864003 | 99 |
| 10 | iso_pu_bacteria | 2738543022 | 2739296521 | 99 |
| 11 | iso_pu_bacteria | 2738543033 | 2739358199 | 99 |
| 12 | iso_pu_bacteria | 2928100450 | 2928101397 | 99 |
| 13 | 3300005564 | Ga0070664_100748832 | Ga0070664_1007488322 | 100 |
| 14 | 3300031456 | Ga0307513_10119918 | Ga0307513_101199183 | 100 |
| 15 | 3300031548 | Ga0307408_100019836 | Ga0307408_1000198363 | 100 |
| 16 | 3300031903 | Ga0307407_10013989 | Ga0307407_100139894 | 100 |
| 17 | 3300031911 | Ga0307412_10629038 | Ga0307412_106290382 | 100 |
| 18 | 3300032002 | Ga0307416_100014569 | Ga0307416_1000145694 | 100 |
| 19 | 3300032126 | Ga0307415_100726634 | Ga0307415_1007266342 | 100 |
| 20 | 3300041496 | Ga0451839_1214721 | Ga0451839_1214721_166_483 | 100 |
| 21 | 3300046460 | Ga0495638_0154837 | Ga0495638_0154837_429_752 | 100 |
| 22 | 3300046513 | Ga0495616_0010280 | Ga0495616_0010280_87_410 | 100 |
| 23 | 3300046519 | Ga0495632_0234806 | Ga0495632_0234806_240_563 | 100 |
| 24 | 3300046660 | Ga0495625_0209501 | Ga0495625_0209501_277_600 | 100 |
| 25 | 3300049578 | Ga0501042_0066177 | Ga0501042_0066177_1182_1505 | 100 |
| 26 | 3300049582 | Ga0501048_1138307 | Ga0501048_1138307_191_514 | 100 |
| 27 | 3300049591 | Ga0501075_0818534 | Ga0501075_0818534_15_338 | 100 |
| 28 | 3300006237 | Ga0097621_100005933 | Ga0097621_1000059332 | 101 |
| 29 | 3300006358 | Ga0068871_100004524 | Ga0068871_1000045246 | 101 |
| 30 | 3300011119 | Ga0105246_11545569 | Ga0105246_115455692 | 101 |
| 31 | 3300025933 | Ga0207706_10320674 | Ga0207706_103206742 | 101 |
| 32 | 3300041443 | Ga0451789_0387652 | Ga0451789_0387652_2416_2733 | 101 |
| 33 | 3300041460 | Ga0451802_2032572 | Ga0451802_2032572_1905_2222 | 101 |
| 34 | 3300005330 | Ga0070690_100164459 | Ga0070690_1001644592 | 102 |
| 35 | 3300005334 | Ga0068869_100707300 | Ga0068869_1007073002 | 102 |
| 36 | 3300005337 | Ga0070682_100032513 | Ga0070682_1000325133 | 102 |
| 37 | 3300005340 | Ga0070689_100004511 | Ga0070689_10000451111 | 102 |
| 38 | 3300005340 | Ga0070689_100784565 | Ga0070689_1007845652 | 102 |
| 39 | 3300005340 | Ga0070689_101285523 | Ga0070689_1012855231 | 102 |
| 40 | 3300005343 | Ga0070687_100502357 | Ga0070687_1005023572 | 102 |
| 41 | 3300005345 | Ga0070692_10026119 | Ga0070692_100261193 | 102 |
| 42 | 3300005345 | Ga0070692_10115589 | Ga0070692_101155892 | 102 |
| 43 | 3300005354 | Ga0070675_100912533 | Ga0070675_1009125332 | 102 |
| 44 | 3300005354 | Ga0070675_101125987 | Ga0070675_1011259872 | 102 |
| 45 | 3300005365 | Ga0070688_100215749 | Ga0070688_1002157492 | 102 |
| 46 | 3300005365 | Ga0070688_100531041 | Ga0070688_1005310412 | 102 |
| 47 | 3300005366 | Ga0070659_101926300 | Ga0070659_1019263002 | 102 |
| 48 | 3300005436 | Ga0070713_101870745 | Ga0070713_1018707452 | 102 |
| 49 | 3300005437 | Ga0070710_10350395 | Ga0070710_103503952 | 102 |
| 50 | 3300005438 | Ga0070701_10502183 | Ga0070701_105021832 | 102 |
| 51 | 3300005438 | Ga0070701_11051110 | Ga0070701_110511101 | 102 |
| 52 | 3300005440 | Ga0070705_100007758 | Ga0070705_1000077586 | 102 |
| 53 | 3300005440 | Ga0070705_100921927 | Ga0070705_1009219272 | 102 |
| 54 | 3300005441 | Ga0070700_100058609 | Ga0070700_1000586092 | 102 |
| 55 | 3300005441 | Ga0070700_100106822 | Ga0070700_1001068223 | 102 |
| 56 | 3300005441 | Ga0070700_100787805 | Ga0070700_1007878052 | 102 |
| 57 | 3300005444 | Ga0070694_100656330 | Ga0070694_1006563302 | 102 |
| 58 | 3300005457 | Ga0070662_101002458 | Ga0070662_1010024581 | 102 |
| 59 | 3300005459 | Ga0068867_100379576 | Ga0068867_1003795762 | 102 |
| 60 | 3300005466 | Ga0070685_10919275 | Ga0070685_109192752 | 102 |
| 61 | 3300005544 | Ga0070686_100027897 | Ga0070686_1000278973 | 102 |
| 62 | 3300005544 | Ga0070686_100331035 | Ga0070686_1003310352 | 102 |
| 63 | 3300005546 | Ga0070696_100048784 | Ga0070696_1000487843 | 102 |
| 64 | 3300005548 | Ga0070665_100007631 | Ga0070665_1000076314 | 102 |
| 65 | 3300005564 | Ga0070664_100893759 | Ga0070664_1008937592 | 102 |
| 66 | 3300005577 | Ga0068857_101456318 | Ga0068857_1014563181 | 102 |
| 67 | 3300005615 | Ga0070702_100003604 | Ga0070702_1000036042 | 102 |
| 68 | 3300005617 | Ga0068859_100009079 | Ga0068859_1000090797 | 102 |
| 69 | 3300005618 | Ga0068864_100040826 | Ga0068864_1000408264 | 102 |
| 70 | 3300005719 | Ga0068861_100001242 | Ga0068861_1000012423 | 102 |
| 71 | 3300005719 | Ga0068861_100172070 | Ga0068861_1001720702 | 102 |
| 72 | 3300005834 | Ga0068851_10179712 | Ga0068851_101797122 | 102 |
| 73 | 3300005841 | Ga0068863_100109281 | Ga0068863_1001092813 | 102 |
| 74 | 3300005842 | Ga0068858_100745791 | Ga0068858_1007457912 | 102 |
| 75 | 3300005843 | Ga0068860_100005609 | Ga0068860_1000056094 | 102 |
| 76 | 3300005843 | Ga0068860_102447706 | Ga0068860_1024477062 | 102 |
| 77 | 3300005844 | Ga0068862_100008641 | Ga0068862_1000086412 | 102 |
| 78 | 3300005844 | Ga0068862_102368598 | Ga0068862_1023685982 | 102 |
| 79 | 3300006173 | Ga0070716_100254952 | Ga0070716_1002549522 | 102 |
| 80 | 3300006195 | Ga0075366_10436735 | Ga0075366_104367351 | 102 |
| 81 | 3300006237 | Ga0097621_100032688 | Ga0097621_1000326884 | 102 |
| 82 | 3300006358 | Ga0068871_100234788 | Ga0068871_1002347882 | 102 |
| 83 | 3300006881 | Ga0068865_100676855 | Ga0068865_1006768552 | 102 |
| 84 | 3300006881 | Ga0068865_101579903 | Ga0068865_1015799032 | 102 |
| 85 | 3300006931 | Ga0097620_100009079 | Ga0097620_1000090797 | 102 |
| 86 | 3300009094 | Ga0111539_11907217 | Ga0111539_119072172 | 102 |
| 87 | 3300009177 | Ga0105248_10491530 | Ga0105248_104915302 | 102 |
| 88 | 3300009551 | Ga0105238_11576649 | Ga0105238_115766492 | 102 |
| 89 | 3300009553 | Ga0105249_10132918 | Ga0105249_101329182 | 102 |
| 90 | 3300013307 | Ga0157372_12894315 | Ga0157372_128943152 | 102 |
| 91 | 3300014326 | Ga0157380_10245792 | Ga0157380_102457922 | 102 |
| 92 | 3300014969 | Ga0157376_10055820 | Ga0157376_100558202 | 102 |
| 93 | 3300025906 | Ga0207699_10449209 | Ga0207699_104492091 | 102 |
| 94 | 3300025907 | Ga0207645_10981924 | Ga0207645_109819241 | 102 |
| 95 | 3300025916 | Ga0207663_10133504 | Ga0207663_101335042 | 102 |
| 96 | 3300025918 | Ga0207662_10041603 | Ga0207662_100416032 | 102 |
| 97 | 3300025926 | Ga0207659_10573528 | Ga0207659_105735282 | 102 |
| 98 | 3300025926 | Ga0207659_10702645 | Ga0207659_107026452 | 102 |
| 99 | 3300025932 | Ga0207690_11511633 | Ga0207690_115116331 | 102 |
| 100 | 3300025933 | Ga0207706_10934977 | Ga0207706_109349772 | 102 |
| 101 | 3300025938 | Ga0207704_10549693 | Ga0207704_105496932 | 102 |
| 102 | 3300025938 | Ga0207704_11468289 | Ga0207704_114682892 | 102 |
| 103 | 3300026035 | Ga0207703_10085152 | Ga0207703_100851522 | 102 |
| 104 | 3300026075 | Ga0207708_10040257 | Ga0207708_100402574 | 102 |
| 105 | 3300026075 | Ga0207708_10102472 | Ga0207708_101024723 | 102 |
| 106 | 3300026075 | Ga0207708_10270036 | Ga0207708_102700363 | 102 |
| 107 | 3300026088 | Ga0207641_10127093 | Ga0207641_101270933 | 102 |
| 108 | 3300026089 | Ga0207648_11073091 | Ga0207648_110730912 | 102 |
| 109 | 3300026095 | Ga0207676_10017628 | Ga0207676_100176283 | 102 |
| 110 | 3300026116 | Ga0207674_11405547 | Ga0207674_114055472 | 102 |
| 111 | 3300026118 | Ga0207675_100002767 | Ga0207675_1000027675 | 102 |
| 112 | 3300026118 | Ga0207675_100104202 | Ga0207675_1001042022 | 102 |
| 113 | 3300026118 | Ga0207675_100326423 | Ga0207675_1003264231 | 102 |
| 114 | 3300026142 | Ga0207698_12417359 | Ga0207698_124173592 | 102 |
| 115 | 3300028379 | Ga0268266_10014542 | Ga0268266_100145422 | 102 |
| 116 | 3300028794 | Ga0307515_10122251 | Ga0307515_101222512 | 102 |
| 117 | 3300031731 | Ga0307405_10432972 | Ga0307405_104329721 | 102 |
| 118 | 3300031824 | Ga0307413_10001086 | Ga0307413_1000108612 | 102 |
| 119 | 3300031824 | Ga0307413_10020736 | Ga0307413_100207362 | 102 |
| 120 | 3300031852 | Ga0307410_10002061 | Ga0307410_1000206112 | 102 |
| 121 | 3300031852 | Ga0307410_10010352 | Ga0307410_100103526 | 102 |
| 122 | 3300031901 | Ga0307406_11238556 | Ga0307406_112385562 | 102 |
| 123 | 3300031903 | Ga0307407_10109104 | Ga0307407_101091042 | 102 |
| 124 | 3300031911 | Ga0307412_10522594 | Ga0307412_105225942 | 102 |
| 125 | 3300031995 | Ga0307409_100001337 | Ga0307409_1000013372 | 102 |
| 126 | 3300031995 | Ga0307409_100109024 | Ga0307409_1001090243 | 102 |
| 127 | 3300031995 | Ga0307409_100152512 | Ga0307409_1001525122 | 102 |
| 128 | 3300032002 | Ga0307416_100267768 | Ga0307416_1002677682 | 102 |
| 129 | 3300032002 | Ga0307416_103133033 | Ga0307416_1031330331 | 102 |
| 130 | 3300032004 | Ga0307414_10687753 | Ga0307414_106877532 | 102 |
| 131 | 3300032005 | Ga0307411_10004060 | Ga0307411_100040602 | 102 |
| 132 | 3300032005 | Ga0307411_10010004 | Ga0307411_100100044 | 102 |
| 133 | 3300032126 | Ga0307415_100027085 | Ga0307415_1000270854 | 102 |
| 134 | 3300032126 | Ga0307415_100236038 | Ga0307415_1002360382 | 102 |
| 135 | 3300032126 | Ga0307415_100455455 | Ga0307415_1004554552 | 102 |
| 136 | 3300035092 | Ga0373952_0227285 | Ga0373952_0227285_97_420 | 102 |
| 137 | 3300035118 | Ga0373954_0356886 | Ga0373954_0356886_332_688 | 102 |
| 138 | 3300035172 | Ga0373955_0046603 | Ga0373955_0046603_1724_2080 | 102 |
| 139 | 3300036401 | Ga0373937_0404618 | Ga0373937_0404618_35_391 | 102 |
| 140 | 3300041441 | Ga0451787_581116 | Ga0451787_581116_387_710 | 102 |
| 141 | 3300041451 | Ga0451791_0357959 | Ga0451791_0357959_2410_2733 | 102 |
| 142 | 3300041452 | Ga0451793_1516645 | Ga0451793_1516645_546_869 | 102 |
| 143 | 3300041453 | Ga0451797_0281795 | Ga0451797_0281795_389_703 | 102 |
| 144 | 3300041453 | Ga0451797_0560866 | Ga0451797_0560866_813_1136 | 102 |
| 145 | 3300041460 | Ga0451802_1481030 | Ga0451802_1481030_912_1235 | 102 |
| 146 | 3300041486 | Ga0451807_0306025 | Ga0451807_0306025_3461_3772 | 102 |
| 147 | 3300041486 | Ga0451807_1755513 | Ga0451807_1755513_1861_2184 | 102 |
| 148 | 3300041507 | Ga0451851_0786283 | Ga0451851_0786283_475_798 | 102 |
| 149 | 3300041512 | Ga0451853_1469472 | Ga0451853_1469472_106_429 | 102 |
| 150 | 3300041512 | Ga0451853_3461558 | Ga0451853_3461558_15_332 | 102 |
| 151 | 3300042530 | Ga0450916_013513 | Ga0450916_013513_463_786 | 102 |
| 152 | 3300046519 | Ga0495632_0124220 | Ga0495632_0124220_50_367 | 102 |
| 153 | 3300046809 | Ga0495600_0433490 | Ga0495600_0433490_147_503 | 102 |
| 154 | 3300048907 | Ga0496104_0341516 | Ga0496104_0341516_656_973 | 102 |
| 155 | 3300048917 | Ga0496114_0115607 | Ga0496114_0115607_1965_2282 | 102 |
| 156 | 3300049576 | Ga0501040_0761581 | Ga0501040_0761581_86_397 | 102 |
| 157 | 3300049578 | Ga0501042_0558990 | Ga0501042_0558990_11_322 | 102 |
| 158 | 3300049578 | Ga0501042_0771216 | Ga0501042_0771216_319_630 | 102 |
| 159 | 3300050493 | nmdc:mga0k408_409425_c1 | nmdc:mga0k408_409425_c1_53_370 | 102 |
| 160 | 3300005334 | Ga0068869_100196199 | Ga0068869_1001961993 | 103 |
| 161 | 3300005334 | Ga0068869_100424949 | Ga0068869_1004249492 | 103 |
| 162 | 3300005466 | Ga0070685_10160766 | Ga0070685_101607663 | 103 |
| 163 | 3300005543 | Ga0070672_100003711 | Ga0070672_1000037119 | 103 |
| 164 | 3300005617 | Ga0068859_100739363 | Ga0068859_1007393632 | 103 |
| 165 | 3300005841 | Ga0068863_100276248 | Ga0068863_1002762482 | 103 |
| 166 | 3300005844 | Ga0068862_101316591 | Ga0068862_1013165911 | 103 |
| 167 | 3300005844 | Ga0068862_101740917 | Ga0068862_1017409172 | 103 |
| 168 | 3300006237 | Ga0097621_100388882 | Ga0097621_1003888822 | 103 |
| 169 | 3300006358 | Ga0068871_100480116 | Ga0068871_1004801162 | 103 |
| 170 | 3300006881 | Ga0068865_100050707 | Ga0068865_1000507072 | 103 |
| 171 | 3300006931 | Ga0097620_100739325 | Ga0097620_1007393252 | 103 |
| 172 | 3300009176 | Ga0105242_11128021 | Ga0105242_111280212 | 103 |
| 173 | 3300013308 | Ga0157375_10704723 | Ga0157375_107047231 | 103 |
| 174 | 3300013308 | Ga0157375_10821068 | Ga0157375_108210681 | 103 |
| 175 | 3300014969 | Ga0157376_12736120 | Ga0157376_127361201 | 103 |
| 176 | 3300025931 | Ga0207644_10810879 | Ga0207644_108108791 | 103 |
| 177 | 3300025937 | Ga0207669_11754826 | Ga0207669_117548262 | 103 |
| 178 | 3300025940 | Ga0207691_10007309 | Ga0207691_1000730911 | 103 |
| 179 | 3300025942 | Ga0207689_10112614 | Ga0207689_101126143 | 103 |
| 180 | 3300025945 | Ga0207679_10068377 | Ga0207679_100683774 | 103 |
| 181 | 3300026075 | Ga0207708_11448816 | Ga0207708_114488162 | 103 |
| 182 | 3300026088 | Ga0207641_10348200 | Ga0207641_103482002 | 103 |
| 183 | 3300026121 | Ga0207683_10587566 | Ga0207683_105875662 | 103 |
| 184 | 3300028380 | Ga0268265_10752729 | Ga0268265_107527292 | 103 |
| 185 | 3300031456 | Ga0307513_10031568 | Ga0307513_100315683 | 103 |
| 186 | 3300031507 | Ga0307509_10013273 | Ga0307509_100132737 | 103 |
| 187 | 3300031507 | Ga0307509_10318814 | Ga0307509_103188142 | 103 |
| 188 | 3300031548 | Ga0307408_100688180 | Ga0307408_1006881802 | 103 |
| 189 | 3300031824 | Ga0307413_11860002 | Ga0307413_118600022 | 103 |
| 190 | 3300031995 | Ga0307409_100009658 | Ga0307409_1000096583 | 103 |
| 191 | 3300046455 | Ga0495603_0548736 | Ga0495603_0548736_83_409 | 103 |
| 192 | 3300046457 | Ga0495590_0029330 | Ga0495590_0029330_710_1033 | 103 |
| 193 | 3300046616 | Ga0495668_0360404 | Ga0495668_0360404_418_741 | 103 |
| 194 | 3300046660 | Ga0495625_0388394 | Ga0495625_0388394_42_365 | 103 |
| 195 | 3300046694 | Ga0495649_0109107 | Ga0495649_0109107_292_615 | 103 |
| 196 | 3300046694 | Ga0495649_0239777 | Ga0495649_0239777_555_875 | 103 |
| 197 | 3300047472 | Ga0495686_0060838 | Ga0495686_0060838_855_1181 | 103 |
| 198 | 3300049572 | Ga0501036_0856124 | Ga0501036_0856124_406_720 | 103 |
| 199 | 3300014326 | Ga0157380_11654684 | Ga0157380_116546842 | 104 |
| 200 | 3300032126 | Ga0307415_102091823 | Ga0307415_1020918231 | 104 |
| 201 | 3300053093 | Ga0500651_0625418 | Ga0500651_0625418_124_462 | 104 |
| 202 | 3300005328 | Ga0070676_10383824 | Ga0070676_103838241 | 105 |
| 203 | 3300005328 | Ga0070676_10745562 | Ga0070676_107455622 | 105 |
| 204 | 3300005333 | Ga0070677_10015312 | Ga0070677_100153122 | 105 |
| 205 | 3300005334 | Ga0068869_100672771 | Ga0068869_1006727712 | 105 |
| 206 | 3300005337 | Ga0070682_100623713 | Ga0070682_1006237132 | 105 |
| 207 | 3300005340 | Ga0070689_100863908 | Ga0070689_1008639081 | 105 |
| 208 | 3300005347 | Ga0070668_100142771 | Ga0070668_1001427712 | 105 |
| 209 | 3300005347 | Ga0070668_100805715 | Ga0070668_1008057152 | 105 |
| 210 | 3300005354 | Ga0070675_100168891 | Ga0070675_1001688912 | 105 |
| 211 | 3300005354 | Ga0070675_101582698 | Ga0070675_1015826982 | 105 |
| 212 | 3300005356 | Ga0070674_100080172 | Ga0070674_1000801722 | 105 |
| 213 | 3300005356 | Ga0070674_100157403 | Ga0070674_1001574032 | 105 |
| 214 | 3300005364 | Ga0070673_100236694 | Ga0070673_1002366941 | 105 |
| 215 | 3300005365 | Ga0070688_100361891 | Ga0070688_1003618912 | 105 |
| 216 | 3300005367 | Ga0070667_101086428 | Ga0070667_1010864281 | 105 |
| 217 | 3300005441 | Ga0070700_100414129 | Ga0070700_1004141292 | 105 |
| 218 | 3300005455 | Ga0070663_101360361 | Ga0070663_1013603611 | 105 |
| 219 | 3300005456 | Ga0070678_100037796 | Ga0070678_1000377962 | 105 |
| 220 | 3300005456 | Ga0070678_100107083 | Ga0070678_1001070833 | 105 |
| 221 | 3300005456 | Ga0070678_100329734 | Ga0070678_1003297342 | 105 |
| 222 | 3300005456 | Ga0070678_102229562 | Ga0070678_1022295621 | 105 |
| 223 | 3300005457 | Ga0070662_101678359 | Ga0070662_1016783592 | 105 |
| 224 | 3300005459 | Ga0068867_101200585 | Ga0068867_1012005852 | 105 |
| 225 | 3300005466 | Ga0070685_10235279 | Ga0070685_102352792 | 105 |
| 226 | 3300005466 | Ga0070685_10920939 | Ga0070685_109209392 | 105 |
| 227 | 3300005539 | Ga0068853_100402907 | Ga0068853_1004029072 | 105 |
| 228 | 3300005543 | Ga0070672_100043303 | Ga0070672_1000433032 | 105 |
| 229 | 3300005543 | Ga0070672_101215134 | Ga0070672_1012151342 | 105 |
| 230 | 3300005544 | Ga0070686_100247394 | Ga0070686_1002473942 | 105 |
| 231 | 3300005549 | Ga0070704_101615921 | Ga0070704_1016159211 | 105 |
| 232 | 3300005618 | Ga0068864_100418115 | Ga0068864_1004181152 | 105 |
| 233 | 3300005719 | Ga0068861_100136226 | Ga0068861_1001362262 | 105 |
| 234 | 3300005840 | Ga0068870_10140218 | Ga0068870_101402182 | 105 |
| 235 | 3300005841 | Ga0068863_100987061 | Ga0068863_1009870612 | 105 |
| 236 | 3300005844 | Ga0068862_100640097 | Ga0068862_1006400972 | 105 |
| 237 | 3300006358 | Ga0068871_100128041 | Ga0068871_1001280412 | 105 |
| 238 | 3300006881 | Ga0068865_100605376 | Ga0068865_1006053762 | 105 |
| 239 | 3300009094 | Ga0111539_10407919 | Ga0111539_104079192 | 105 |
| 240 | 3300009094 | Ga0111539_12490940 | Ga0111539_124909402 | 105 |
| 241 | 3300009148 | Ga0105243_10413582 | Ga0105243_104135821 | 105 |
| 242 | 3300009177 | Ga0105248_10491073 | Ga0105248_104910732 | 105 |
| 243 | 3300013306 | Ga0163162_11441663 | Ga0163162_114416632 | 105 |
| 244 | 3300013308 | Ga0157375_10437696 | Ga0157375_104376962 | 105 |
| 245 | 3300014325 | Ga0163163_10502169 | Ga0163163_105021692 | 105 |
| 246 | 3300014325 | Ga0163163_12346832 | Ga0163163_123468322 | 105 |
| 247 | 3300014325 | Ga0163163_12346834 | Ga0163163_123468342 | 105 |
| 248 | 3300014325 | Ga0163163_12801561 | Ga0163163_128015612 | 105 |
| 249 | 3300014326 | Ga0157380_10221148 | Ga0157380_102211482 | 105 |
| 250 | 3300014968 | Ga0157379_10785200 | Ga0157379_107852002 | 105 |
| 251 | 3300014969 | Ga0157376_11448177 | Ga0157376_114481771 | 105 |
| 252 | 3300025893 | Ga0207682_10012627 | Ga0207682_100126273 | 105 |
| 253 | 3300025893 | Ga0207682_10061007 | Ga0207682_100610072 | 105 |
| 254 | 3300025907 | Ga0207645_10454841 | Ga0207645_104548412 | 105 |
| 255 | 3300025908 | Ga0207643_10080363 | Ga0207643_100803632 | 105 |
| 256 | 3300025923 | Ga0207681_10193071 | Ga0207681_101930712 | 105 |
| 257 | 3300025926 | Ga0207659_10095916 | Ga0207659_100959162 | 105 |
| 258 | 3300025926 | Ga0207659_10459948 | Ga0207659_104599482 | 105 |
| 259 | 3300025931 | Ga0207644_10398345 | Ga0207644_103983452 | 105 |
| 260 | 3300025931 | Ga0207644_11036197 | Ga0207644_110361972 | 105 |
| 261 | 3300025933 | Ga0207706_10722982 | Ga0207706_107229822 | 105 |
| 262 | 3300025936 | Ga0207670_10455801 | Ga0207670_104558012 | 105 |
| 263 | 3300025938 | Ga0207704_11137305 | Ga0207704_111373051 | 105 |
| 264 | 3300025940 | Ga0207691_10001665 | Ga0207691_1000166512 | 105 |
| 265 | 3300025940 | Ga0207691_10066199 | Ga0207691_100661994 | 105 |
| 266 | 3300025942 | Ga0207689_10033585 | Ga0207689_100335853 | 105 |
| 267 | 3300025945 | Ga0207679_11305484 | Ga0207679_113054842 | 105 |
| 268 | 3300025960 | Ga0207651_10942345 | Ga0207651_109423452 | 105 |
| 269 | 3300025960 | Ga0207651_11133453 | Ga0207651_111334532 | 105 |
| 270 | 3300025972 | Ga0207668_10830246 | Ga0207668_108302462 | 105 |
| 271 | 3300026067 | Ga0207678_10415312 | Ga0207678_104153122 | 105 |
| 272 | 3300026067 | Ga0207678_11078597 | Ga0207678_110785971 | 105 |
| 273 | 3300026075 | Ga0207708_10196742 | Ga0207708_101967422 | 105 |
| 274 | 3300026088 | Ga0207641_10085193 | Ga0207641_100851932 | 105 |
| 275 | 3300026089 | Ga0207648_10158460 | Ga0207648_101584602 | 105 |
| 276 | 3300026118 | Ga0207675_100079909 | Ga0207675_1000799092 | 105 |
| 277 | 3300026121 | Ga0207683_10080948 | Ga0207683_100809482 | 105 |
| 278 | 3300026121 | Ga0207683_10613928 | Ga0207683_106139282 | 105 |
| 279 | 3300028380 | Ga0268265_10088447 | Ga0268265_100884472 | 105 |
| 280 | 3300028794 | Ga0307515_10639293 | Ga0307515_106392932 | 105 |
| 281 | 3300031456 | Ga0307513_10016612 | Ga0307513_1001661211 | 105 |
| 282 | 3300031456 | Ga0307513_10227006 | Ga0307513_102270062 | 105 |
| 283 | 3300031649 | Ga0307514_10097228 | Ga0307514_100972283 | 105 |
| 284 | 3300031911 | Ga0307412_11559427 | Ga0307412_115594272 | 105 |
| 285 | 3300035171 | Ga0373946_0490969 | Ga0373946_0490969_298_615 | 105 |
| 286 | 3300041458 | Ga0451798_0328541 | Ga0451798_0328541_33_380 | 105 |
| 287 | 3300041463 | Ga0451804_1179540 | Ga0451804_1179540_200_529 | 105 |
| 288 | 3300041512 | Ga0451853_1099279 | Ga0451853_1099279_18_347 | 105 |
| 289 | 3300046458 | Ga0495591_175326 | Ga0495591_175326_107_439 | 105 |
| 290 | 3300046461 | Ga0495641_0315306 | Ga0495641_0315306_342_683 | 105 |
| 291 | 3300046539 | Ga0495621_0240454 | Ga0495621_0240454_249_566 | 105 |
| 292 | 3300046557 | Ga0495622_0115770 | Ga0495622_0115770_807_1133 | 105 |
| 293 | 3300046616 | Ga0495668_0607624 | Ga0495668_0607624_163_489 | 105 |
| 294 | 3300046660 | Ga0495625_0039896 | Ga0495625_0039896_3018_3347 | 105 |
| 295 | 3300046660 | Ga0495625_0114597 | Ga0495625_0114597_140_481 | 105 |
| 296 | 3300046694 | Ga0495649_0002702 | Ga0495649_0002702_7650_7976 | 105 |
| 297 | 3300046794 | Ga0495589_0604622 | Ga0495589_0604622_112_438 | 105 |
| 298 | 3300048912 | Ga0496109_0603615 | Ga0496109_0603615_666_983 | 105 |
| 299 | 3300050511 | nmdc:mga08y16_677085_c1 | nmdc:mga08y16_677085_c1_229_558 | 105 |
| 300 | 3300053129 | Ga0500628_243495 | Ga0500628_243495_44_361 | 105 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k3s-assembly3.cif.gz_C | crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. | 0.9079 | 6 | 89 |
| 3k3s-assembly3.cif.gz_C | crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. | 0.8883 | 6 | 89 |
| 5wfd-assembly1.cif.gz_B | humanized mutant of the chaetomium thermophilum polycomb repressive complex 2 bound to the inhibitor gsk126 | 0.8876 | 19 | 32 |
| 6u7l-assembly2.cif.gz_C | 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. | 0.8869 | 6 | 86 |
| 6u7l-assembly1.cif.gz_B | 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. | 0.879 | 9 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39829_14_92_2.30.130.110 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.8854 | 9 | 87 | 2.30.130.110 |
| 3k3sD01 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.879 | 9 | 89 | 2.30.130.110 |
| af_P39829_14_92_2.30.130.110 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.8648 | 9 | 87 | 2.30.130.110 |
| 3k3sD01 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; | 0.8504 | 9 | 89 | 2.30.130.110 |
| 4l36B00 | Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 | 0.6966 | 16 | 51 | 1.10.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P8SIV8-F1-model_v4 | Altronate hydrolase | 0.9298 | 7 | 82 |
GO:0016787
GO:0016829 GO:0019698 |
| AF-A0A2D8UDK6-F1-model_v4 | Altronate hydrolase | 0.9285 | 8 | 81 |
GO:0016787
GO:0016829 GO:0019698 |
| AF-A0A2A2W7A1-F1-model_v4 | SAF domain-containing protein | 0.9275 | 6 | 87 |
GO:0016829
GO:0019698 |
| AF-A0A832IK75-F1-model_v4 | Altronate dehydratase | 0.9262 | 7 | 89 |
GO:0016829
GO:0019698 |
| AF-A0A382FL72-F1-model_v4 | SAF domain-containing protein | 0.9256 | 9 | 82 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar