F395397

General Info

Members Datasets Scaffolds Average Seq Length
300 162 295 107

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10449209|Ga0207699_104492091
Length 122
Sequence MPIFAASITLASTGAGYWALVVQRLIPPLLLLHPDDNILVARRDIAAGEQVQLDGEDFVIPAAVELGHKLARRALAADTRVLKYGAPIGSMKTAVARGEHVHLHNLRSDYIPSTTRGGSEGH

Samples

Sample ID Description Type Environment
1 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
2 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
3 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
4 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
5 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
123 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
128 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
133 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
162 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 5.67
Rhizosphere 87
Stem 0
Stem Tuber 0
Unclassified 6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10383824 3300005328 Unclassified 973
2 Ga0070676_10745562 3300005328 Bacteria 718
3 Ga0070690_100164459 3300005330 Bacteria 1523
4 Ga0070677_10015312 3300005333 Bacteria 2715
5 Ga0068869_100196199 3300005334 Bacteria 1590
6 Ga0068869_100424949 3300005334 Bacteria 1097
7 Ga0068869_100672771 3300005334 Bacteria 881
8 Ga0068869_100707300 3300005334 Bacteria 860
9 Ga0070682_100032513 3300005337 Bacteria 3164
10 Ga0070682_100623713 3300005337 Bacteria 855
11 Ga0070689_100004511 3300005340 Bacteria 9430
12 Ga0070689_100784565 3300005340 Bacteria 837
13 Ga0070689_100863908 3300005340 Bacteria 799
14 Ga0070689_101285523 3300005340 Bacteria 659
15 Ga0070687_100502357 3300005343 Bacteria 816
16 Ga0070692_10026119 3300005345 Bacteria 2884
17 Ga0070692_10115589 3300005345 Bacteria 1490
18 Ga0070668_100142771 3300005347 Bacteria 1931
19 Ga0070668_100805715 3300005347 Bacteria 835
20 Ga0070675_100168891 3300005354 Bacteria 1885
21 Ga0070675_100912533 3300005354 Bacteria 805
22 Ga0070675_101125987 3300005354 Bacteria 722
23 Ga0070675_101582698 3300005354 Bacteria 605
24 Ga0070674_100080172 3300005356 Bacteria 2330
25 Ga0070674_100157403 3300005356 Bacteria 1720
26 Ga0070673_100236694 3300005364 Bacteria 1586
27 Ga0070688_100215749 3300005365 Bacteria 1350
28 Ga0070688_100361891 3300005365 Bacteria 1065
29 Ga0070688_100531041 3300005365 Bacteria 892
30 Ga0070659_101926300 3300005366 Bacteria 530
31 Ga0070667_101086428 3300005367 Bacteria 748
32 Ga0070713_101870745 3300005436 Bacteria 582
33 Ga0070710_10350395 3300005437 Bacteria 977
34 Ga0070701_10502183 3300005438 Bacteria 788
35 Ga0070701_11051110 3300005438 Bacteria 571
36 Ga0070705_100007758 3300005440 Bacteria 5298
37 Ga0070705_100921927 3300005440 Unclassified 704
38 Ga0070700_100058609 3300005441 Bacteria 2420
39 Ga0070700_100106822 3300005441 Bacteria 1854
40 Ga0070700_100414129 3300005441 Bacteria 1017
41 Ga0070700_100787805 3300005441 Bacteria 764
42 Ga0070694_100656330 3300005444 Bacteria 849
43 Ga0070663_101360361 3300005455 Bacteria 628
44 Ga0070678_100037796 3300005456 Bacteria 3393
45 Ga0070678_100107083 3300005456 Unclassified 2179
46 Ga0070678_100329734 3300005456 Bacteria 1306
47 Ga0070678_102229562 3300005456 Bacteria 519
48 Ga0070662_101002458 3300005457 Bacteria 715
49 Ga0070662_101678359 3300005457 Unclassified 549
50 Ga0068867_100379576 3300005459 Bacteria 1187
51 Ga0068867_101200585 3300005459 Bacteria 697
52 Ga0070685_10160766 3300005466 Bacteria 1431
53 Ga0070685_10235279 3300005466 Unclassified 1207
54 Ga0070685_10919275 3300005466 Bacteria 652
55 Ga0070685_10920939 3300005466 Bacteria 652
56 Ga0068853_100402907 3300005539 Bacteria 1281
57 Ga0070672_100003711 3300005543 Bacteria 9935
58 Ga0070672_100043303 3300005543 Bacteria 3470
59 Ga0070672_101215134 3300005543 Bacteria 672
60 Ga0070686_100027897 3300005544 Bacteria 3420
61 Ga0070686_100247394 3300005544 Bacteria 1301
62 Ga0070686_100331035 3300005544 Bacteria 1138
63 Ga0070696_100048784 3300005546 Bacteria 2940
64 Ga0070665_100007631 3300005548 Bacteria 10997
65 Ga0070665_100132367 3300005548 Bacteria 2496
66 Ga0070704_101615921 3300005549 Unclassified 598
67 Ga0070664_100748832 3300005564 Bacteria 912
68 Ga0070664_100893759 3300005564 Bacteria 833
69 Ga0068857_101456318 3300005577 Unclassified 667
70 Ga0070702_100003604 3300005615 Bacteria 6958
71 Ga0068859_100009079 3300005617 Bacteria 10043
72 Ga0068859_100739363 3300005617 Bacteria 1073
73 Ga0068864_100040826 3300005618 Bacteria 3968
74 Ga0068864_100418115 3300005618 Bacteria 1277
75 Ga0068861_100001242 3300005719 Bacteria 15887
76 Ga0068861_100136226 3300005719 Bacteria 1998
77 Ga0068861_100172070 3300005719 Bacteria 1796
78 Ga0068851_10179712 3300005834 Bacteria 1171
79 Ga0068870_10140218 3300005840 Bacteria 1414
80 Ga0068863_100109281 3300005841 Bacteria 2632
81 Ga0068863_100276248 3300005841 Bacteria 1627
82 Ga0068863_100987061 3300005841 Bacteria 844
83 Ga0068858_100745791 3300005842 Bacteria 954
84 Ga0068860_100005609 3300005843 Bacteria 12680
85 Ga0068860_102447706 3300005843 Bacteria 542
86 Ga0068862_100008641 3300005844 Bacteria 8424
87 Ga0068862_100640097 3300005844 Bacteria 1025
88 Ga0068862_101316591 3300005844 Bacteria 724
89 Ga0068862_101740917 3300005844 Bacteria 632
90 Ga0068862_102368598 3300005844 Bacteria 543
91 Ga0070716_100254952 3300006173 Bacteria 1197
92 Ga0075366_10436735 3300006195 Bacteria 807
93 Ga0097621_100005933 3300006237 Bacteria 8632
94 Ga0097621_100032688 3300006237 Bacteria 4137
95 Ga0097621_100388882 3300006237 Bacteria 1247
96 Ga0068871_100004524 3300006358 Bacteria 9689
97 Ga0068871_100128041 3300006358 Bacteria 2150
98 Ga0068871_100234788 3300006358 Bacteria 1593
99 Ga0068871_100480116 3300006358 Bacteria 1118
100 Ga0068871_100683427 3300006358 Bacteria 939
101 Ga0068865_100050707 3300006881 Bacteria 2869
102 Ga0068865_100605376 3300006881 Bacteria 926
103 Ga0068865_100676855 3300006881 Bacteria 879
104 Ga0068865_101579903 3300006881 Bacteria 589
105 Ga0097620_100009079 3300006931 Bacteria 10043
106 Ga0097620_100739325 3300006931 Bacteria 1073
107 Ga0111539_10407919 3300009094 Unclassified 1583
108 Ga0111539_11907217 3300009094 Bacteria 689
109 Ga0111539_12490940 3300009094 Bacteria 600
110 Ga0105243_10413582 3300009148 Bacteria 1256
111 Ga0105242_11128021 3300009176 Bacteria 800
112 Ga0105248_10491073 3300009177 Bacteria 1384
113 Ga0105248_10491530 3300009177 Bacteria 1383
114 Ga0105238_11576649 3300009551 Bacteria 686
115 Ga0105249_10132918 3300009553 Bacteria 2377
116 Ga0105246_11545569 3300011119 Bacteria 625
117 Ga0163162_11441663 3300013306 Bacteria 784
118 Ga0157372_12894315 3300013307 Bacteria 550
119 Ga0157375_10437696 3300013308 Bacteria 1473
120 Ga0157375_10704723 3300013308 Bacteria 1163
121 Ga0157375_10821068 3300013308 Bacteria 1078
122 Ga0163163_10502169 3300014325 Bacteria 1275
123 Ga0163163_12346832 3300014325 Bacteria 592
124 Ga0163163_12346834 3300014325 Bacteria 592
125 Ga0163163_12801561 3300014325 Bacteria 544
126 Ga0157380_10221148 3300014326 Bacteria 1694
127 Ga0157380_10245792 3300014326 Bacteria 1616
128 Ga0157380_11654684 3300014326 Unclassified 697
129 Ga0157379_10785200 3300014968 Bacteria 898
130 Ga0157376_10055820 3300014969 Bacteria 3297
131 Ga0157376_11448177 3300014969 Bacteria 719
132 Ga0157376_12736120 3300014969 Bacteria 533
133 Ga0207682_10012627 3300025893 Bacteria 3293
134 Ga0207682_10061007 3300025893 Bacteria 1578
135 Ga0207699_10449209 3300025906 Bacteria 924
136 Ga0207645_10454841 3300025907 Bacteria 864
137 Ga0207645_10981924 3300025907 Bacteria 572
138 Ga0207643_10080363 3300025908 Unclassified 1888
139 Ga0207663_10133504 3300025916 Bacteria 1719
140 Ga0207662_10041603 3300025918 Bacteria 2706
141 Ga0207681_10193071 3300025923 Unclassified 1559
142 Ga0207659_10095916 3300025926 Bacteria 2225
143 Ga0207659_10459948 3300025926 Bacteria 1073
144 Ga0207659_10573528 3300025926 Bacteria 960
145 Ga0207659_10702645 3300025926 Bacteria 866
146 Ga0207644_10398345 3300025931 Bacteria 1125
147 Ga0207644_10810879 3300025931 Bacteria 783
148 Ga0207644_11036197 3300025931 Bacteria 689
149 Ga0207690_11511633 3300025932 Bacteria 561
150 Ga0207706_10320674 3300025933 Bacteria 1349
151 Ga0207706_10722982 3300025933 Bacteria 850
152 Ga0207706_10934977 3300025933 Bacteria 731
153 Ga0207670_10455801 3300025936 Unclassified 1032
154 Ga0207669_11754826 3300025937 Bacteria 530
155 Ga0207704_10549693 3300025938 Bacteria 938
156 Ga0207704_11137305 3300025938 Bacteria 664
157 Ga0207704_11468289 3300025938 Bacteria 585
158 Ga0207691_10001665 3300025940 Bacteria 21983
159 Ga0207691_10007309 3300025940 Bacteria 10660
160 Ga0207691_10066199 3300025940 Unclassified 3269
161 Ga0207689_10033585 3300025942 Bacteria 4262
162 Ga0207689_10112614 3300025942 Bacteria 2236
163 Ga0207679_10068377 3300025945 Bacteria 2668
164 Ga0207679_11305484 3300025945 Bacteria 666
165 Ga0207651_10942345 3300025960 Bacteria 770
166 Ga0207651_11133453 3300025960 Unclassified 701
167 Ga0207668_10830246 3300025972 Bacteria 819
168 Ga0207703_10085152 3300026035 Bacteria 2645
169 Ga0207678_10415312 3300026067 Bacteria 1166
170 Ga0207678_11078597 3300026067 Bacteria 711
171 Ga0207708_10040257 3300026075 Bacteria 3562
172 Ga0207708_10102472 3300026075 Bacteria 2216
173 Ga0207708_10196742 3300026075 Unclassified 1607
174 Ga0207708_10270036 3300026075 Bacteria 1375
175 Ga0207708_11448816 3300026075 Bacteria 603
176 Ga0207641_10085193 3300026088 Bacteria 2753
177 Ga0207641_10127093 3300026088 Bacteria 2284
178 Ga0207641_10348200 3300026088 Bacteria 1411
179 Ga0207648_10158460 3300026089 Bacteria 1999
180 Ga0207648_11073091 3300026089 Bacteria 755
181 Ga0207676_10017628 3300026095 Bacteria 5178
182 Ga0207674_11405547 3300026116 Unclassified 667
183 Ga0207675_100002767 3300026118 Bacteria 17224
184 Ga0207675_100079909 3300026118 Bacteria 3065
185 Ga0207675_100104202 3300026118 Bacteria 2674
186 Ga0207675_100326423 3300026118 Bacteria 1499
187 Ga0207683_10080948 3300026121 Bacteria 2882
188 Ga0207683_10587566 3300026121 Bacteria 1030
189 Ga0207683_10613928 3300026121 Bacteria 1007
190 Ga0207698_12417359 3300026142 Bacteria 536
191 Ga0268266_10014542 3300028379 Bacteria 6764
192 Ga0268266_10110426 3300028379 Bacteria 2436
193 Ga0268265_10088447 3300028380 Bacteria 2468
194 Ga0268265_10752729 3300028380 Bacteria 946
195 Ga0307515_10122251 3300028794 Bacteria 2938
196 Ga0307515_10639293 3300028794 Bacteria 676
197 Ga0307513_10016612 3300031456 Bacteria 8869
198 Ga0307513_10031568 3300031456 Bacteria 5996
199 Ga0307513_10119918 3300031456 Bacteria 2601
200 Ga0307513_10227006 3300031456 Bacteria 1683
201 Ga0307509_10013273 3300031507 Bacteria 9765
202 Ga0307509_10318814 3300031507 Bacteria 1292
203 Ga0307408_100019836 3300031548 Bacteria 4529
204 Ga0307408_100688180 3300031548 Bacteria 918
205 Ga0307514_10097228 3300031649 Bacteria 2125
206 Ga0307405_10432972 3300031731 Bacteria 1038
207 Ga0307413_10001086 3300031824 Bacteria 9945
208 Ga0307413_10020736 3300031824 Bacteria 3503
209 Ga0307413_11860002 3300031824 Bacteria 540
210 Ga0307410_10002061 3300031852 Bacteria 9505
211 Ga0307410_10010352 3300031852 Bacteria 5278
212 Ga0307410_10241617 3300031852 Bacteria 1400
213 Ga0307406_11238556 3300031901 Bacteria 649
214 Ga0307407_10013989 3300031903 Bacteria 3914
215 Ga0307407_10109104 3300031903 Bacteria 1734
216 Ga0307412_10522594 3300031911 Bacteria 992
217 Ga0307412_10629038 3300031911 Bacteria 913
218 Ga0307412_11174098 3300031911 Bacteria 686
219 Ga0307412_11559427 3300031911 Unclassified 602
220 Ga0307409_100001337 3300031995 Bacteria 11970
221 Ga0307409_100009658 3300031995 Bacteria 5944
222 Ga0307409_100109024 3300031995 Bacteria 2317
223 Ga0307409_100152512 3300031995 Bacteria 2008
224 Ga0307416_100014569 3300032002 Bacteria 5396
225 Ga0307416_100267768 3300032002 Bacteria 1675
226 Ga0307416_103133033 3300032002 Bacteria 553
227 Ga0307414_10687753 3300032004 Bacteria 925
228 Ga0307411_10004060 3300032005 Bacteria 6934
229 Ga0307411_10010004 3300032005 Bacteria 5026
230 Ga0307415_100027085 3300032126 Bacteria 3627
231 Ga0307415_100236038 3300032126 Bacteria 1476
232 Ga0307415_100455455 3300032126 Bacteria 1107
233 Ga0307415_100726634 3300032126 Bacteria 899
234 Ga0307415_102091823 3300032126 Unclassified 553
235 Ga0373952_0227285 3300035092 Bacteria 557
236 Ga0373954_0356886 3300035118 Unclassified 722
237 Ga0373946_0490969 3300035171 Bacteria 629
238 Ga0373955_0046603 3300035172 Bacteria 2344
239 Ga0373937_0404618 3300036401 Bacteria 1295
240 Ga0451787_581116 3300041441 Bacteria 1046
241 Ga0451789_0387652 3300041443 Bacteria 2902
242 Ga0451791_0357959 3300041451 Bacteria 3145
243 Ga0451793_1516645 3300041452 Bacteria 1247
244 Ga0451797_0281795 3300041453 Bacteria 783
245 Ga0451797_0560866 3300041453 Bacteria 1357
246 Ga0451795_0873199 3300041456 Bacteria 713
247 Ga0451798_0328541 3300041458 Bacteria 593
248 Ga0451802_1481030 3300041460 Bacteria 1409
249 Ga0451802_2032572 3300041460 Bacteria 2996
250 Ga0451804_1179540 3300041463 Bacteria 834
251 Ga0451807_0306025 3300041486 Bacteria 3928
252 Ga0451807_1755513 3300041486 Bacteria 2267
253 Ga0451839_1214721 3300041496 Bacteria 613
254 Ga0451851_0786283 3300041507 Bacteria 1381
255 Ga0451853_1099279 3300041512 Unclassified 548
256 Ga0451853_1469472 3300041512 Bacteria 1111
257 Ga0451853_3461558 3300041512 Bacteria 653
258 Ga0450916_013513 3300042530 Bacteria 1054
259 Ga0495603_0548736 3300046455 Bacteria 662
260 Ga0495590_0029330 3300046457 Bacteria 1929
261 Ga0495591_175326 3300046458 Bacteria 511
262 Ga0495638_0154837 3300046460 Bacteria 1327
263 Ga0495641_0315306 3300046461 Bacteria 705
264 Ga0495616_0010280 3300046513 Bacteria 5424
265 Ga0495632_0124220 3300046519 Unclassified 1204
266 Ga0495632_0234806 3300046519 Bacteria 826
267 Ga0495621_0240454 3300046539 Bacteria 737
268 Ga0495622_0115770 3300046557 Bacteria 1226
269 Ga0495668_0360404 3300046616 Unclassified 798
270 Ga0495668_0607624 3300046616 Bacteria 604
271 Ga0495625_0039896 3300046660 Bacteria 3427
272 Ga0495625_0114597 3300046660 Bacteria 1840
273 Ga0495625_0209501 3300046660 Bacteria 1282
274 Ga0495625_0388394 3300046660 Unclassified 874
275 Ga0495649_0002702 3300046694 Bacteria 12358
276 Ga0495649_0109107 3300046694 Bacteria 1468
277 Ga0495649_0239777 3300046694 Bacteria 934
278 Ga0495589_0604622 3300046794 Bacteria 500
279 Ga0495600_0433490 3300046809 Bacteria 815
280 Ga0495686_0060838 3300047472 Bacteria 2347
281 Ga0496104_0341516 3300048907 Bacteria 1410
282 Ga0496109_0603615 3300048912 Bacteria 1034
283 Ga0496114_0115607 3300048917 Bacteria 2302
284 Ga0496114_0149632 3300048917 Bacteria 2025
285 Ga0501036_0856124 3300049572 Unclassified 747
286 Ga0501040_0761581 3300049576 Bacteria 700
287 Ga0501042_0066177 3300049578 Bacteria 2583
288 Ga0501042_0558990 3300049578 Bacteria 832
289 Ga0501042_0771216 3300049578 Bacteria 700
290 Ga0501048_1138307 3300049582 Bacteria 561
291 Ga0501075_0818534 3300049591 Bacteria 709
292 nmdc:mga0k408_409425_c1 3300050493 Bacteria 807
293 nmdc:mga08y16_677085_c1 3300050511 Bacteria 1033
294 Ga0500651_0625418 3300053093 Bacteria 582
295 Ga0500628_243495 3300053129 Bacteria 528

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031852 Ga0307410_10241617 Ga0307410_102416172 97
2 3300031911 Ga0307412_11174098 Ga0307412_111740982 97
3 3300041456 Ga0451795_0873199 Ga0451795_0873199_84_539 98
4 3300048917 Ga0496114_0149632 Ga0496114_0149632_583_894 98
5 3300005548 Ga0070665_100132367 Ga0070665_1001323672 99
6 3300006358 Ga0068871_100683427 Ga0068871_1006834272 99
7 3300028379 Ga0268266_10110426 Ga0268266_101104262 99
8 iso_pu_bacteria 2738541301 2738848274 99
9 iso_pu_bacteria 2738541304 2738864003 99
10 iso_pu_bacteria 2738543022 2739296521 99
11 iso_pu_bacteria 2738543033 2739358199 99
12 iso_pu_bacteria 2928100450 2928101397 99
13 3300005564 Ga0070664_100748832 Ga0070664_1007488322 100
14 3300031456 Ga0307513_10119918 Ga0307513_101199183 100
15 3300031548 Ga0307408_100019836 Ga0307408_1000198363 100
16 3300031903 Ga0307407_10013989 Ga0307407_100139894 100
17 3300031911 Ga0307412_10629038 Ga0307412_106290382 100
18 3300032002 Ga0307416_100014569 Ga0307416_1000145694 100
19 3300032126 Ga0307415_100726634 Ga0307415_1007266342 100
20 3300041496 Ga0451839_1214721 Ga0451839_1214721_166_483 100
21 3300046460 Ga0495638_0154837 Ga0495638_0154837_429_752 100
22 3300046513 Ga0495616_0010280 Ga0495616_0010280_87_410 100
23 3300046519 Ga0495632_0234806 Ga0495632_0234806_240_563 100
24 3300046660 Ga0495625_0209501 Ga0495625_0209501_277_600 100
25 3300049578 Ga0501042_0066177 Ga0501042_0066177_1182_1505 100
26 3300049582 Ga0501048_1138307 Ga0501048_1138307_191_514 100
27 3300049591 Ga0501075_0818534 Ga0501075_0818534_15_338 100
28 3300006237 Ga0097621_100005933 Ga0097621_1000059332 101
29 3300006358 Ga0068871_100004524 Ga0068871_1000045246 101
30 3300011119 Ga0105246_11545569 Ga0105246_115455692 101
31 3300025933 Ga0207706_10320674 Ga0207706_103206742 101
32 3300041443 Ga0451789_0387652 Ga0451789_0387652_2416_2733 101
33 3300041460 Ga0451802_2032572 Ga0451802_2032572_1905_2222 101
34 3300005330 Ga0070690_100164459 Ga0070690_1001644592 102
35 3300005334 Ga0068869_100707300 Ga0068869_1007073002 102
36 3300005337 Ga0070682_100032513 Ga0070682_1000325133 102
37 3300005340 Ga0070689_100004511 Ga0070689_10000451111 102
38 3300005340 Ga0070689_100784565 Ga0070689_1007845652 102
39 3300005340 Ga0070689_101285523 Ga0070689_1012855231 102
40 3300005343 Ga0070687_100502357 Ga0070687_1005023572 102
41 3300005345 Ga0070692_10026119 Ga0070692_100261193 102
42 3300005345 Ga0070692_10115589 Ga0070692_101155892 102
43 3300005354 Ga0070675_100912533 Ga0070675_1009125332 102
44 3300005354 Ga0070675_101125987 Ga0070675_1011259872 102
45 3300005365 Ga0070688_100215749 Ga0070688_1002157492 102
46 3300005365 Ga0070688_100531041 Ga0070688_1005310412 102
47 3300005366 Ga0070659_101926300 Ga0070659_1019263002 102
48 3300005436 Ga0070713_101870745 Ga0070713_1018707452 102
49 3300005437 Ga0070710_10350395 Ga0070710_103503952 102
50 3300005438 Ga0070701_10502183 Ga0070701_105021832 102
51 3300005438 Ga0070701_11051110 Ga0070701_110511101 102
52 3300005440 Ga0070705_100007758 Ga0070705_1000077586 102
53 3300005440 Ga0070705_100921927 Ga0070705_1009219272 102
54 3300005441 Ga0070700_100058609 Ga0070700_1000586092 102
55 3300005441 Ga0070700_100106822 Ga0070700_1001068223 102
56 3300005441 Ga0070700_100787805 Ga0070700_1007878052 102
57 3300005444 Ga0070694_100656330 Ga0070694_1006563302 102
58 3300005457 Ga0070662_101002458 Ga0070662_1010024581 102
59 3300005459 Ga0068867_100379576 Ga0068867_1003795762 102
60 3300005466 Ga0070685_10919275 Ga0070685_109192752 102
61 3300005544 Ga0070686_100027897 Ga0070686_1000278973 102
62 3300005544 Ga0070686_100331035 Ga0070686_1003310352 102
63 3300005546 Ga0070696_100048784 Ga0070696_1000487843 102
64 3300005548 Ga0070665_100007631 Ga0070665_1000076314 102
65 3300005564 Ga0070664_100893759 Ga0070664_1008937592 102
66 3300005577 Ga0068857_101456318 Ga0068857_1014563181 102
67 3300005615 Ga0070702_100003604 Ga0070702_1000036042 102
68 3300005617 Ga0068859_100009079 Ga0068859_1000090797 102
69 3300005618 Ga0068864_100040826 Ga0068864_1000408264 102
70 3300005719 Ga0068861_100001242 Ga0068861_1000012423 102
71 3300005719 Ga0068861_100172070 Ga0068861_1001720702 102
72 3300005834 Ga0068851_10179712 Ga0068851_101797122 102
73 3300005841 Ga0068863_100109281 Ga0068863_1001092813 102
74 3300005842 Ga0068858_100745791 Ga0068858_1007457912 102
75 3300005843 Ga0068860_100005609 Ga0068860_1000056094 102
76 3300005843 Ga0068860_102447706 Ga0068860_1024477062 102
77 3300005844 Ga0068862_100008641 Ga0068862_1000086412 102
78 3300005844 Ga0068862_102368598 Ga0068862_1023685982 102
79 3300006173 Ga0070716_100254952 Ga0070716_1002549522 102
80 3300006195 Ga0075366_10436735 Ga0075366_104367351 102
81 3300006237 Ga0097621_100032688 Ga0097621_1000326884 102
82 3300006358 Ga0068871_100234788 Ga0068871_1002347882 102
83 3300006881 Ga0068865_100676855 Ga0068865_1006768552 102
84 3300006881 Ga0068865_101579903 Ga0068865_1015799032 102
85 3300006931 Ga0097620_100009079 Ga0097620_1000090797 102
86 3300009094 Ga0111539_11907217 Ga0111539_119072172 102
87 3300009177 Ga0105248_10491530 Ga0105248_104915302 102
88 3300009551 Ga0105238_11576649 Ga0105238_115766492 102
89 3300009553 Ga0105249_10132918 Ga0105249_101329182 102
90 3300013307 Ga0157372_12894315 Ga0157372_128943152 102
91 3300014326 Ga0157380_10245792 Ga0157380_102457922 102
92 3300014969 Ga0157376_10055820 Ga0157376_100558202 102
93 3300025906 Ga0207699_10449209 Ga0207699_104492091 102
94 3300025907 Ga0207645_10981924 Ga0207645_109819241 102
95 3300025916 Ga0207663_10133504 Ga0207663_101335042 102
96 3300025918 Ga0207662_10041603 Ga0207662_100416032 102
97 3300025926 Ga0207659_10573528 Ga0207659_105735282 102
98 3300025926 Ga0207659_10702645 Ga0207659_107026452 102
99 3300025932 Ga0207690_11511633 Ga0207690_115116331 102
100 3300025933 Ga0207706_10934977 Ga0207706_109349772 102
101 3300025938 Ga0207704_10549693 Ga0207704_105496932 102
102 3300025938 Ga0207704_11468289 Ga0207704_114682892 102
103 3300026035 Ga0207703_10085152 Ga0207703_100851522 102
104 3300026075 Ga0207708_10040257 Ga0207708_100402574 102
105 3300026075 Ga0207708_10102472 Ga0207708_101024723 102
106 3300026075 Ga0207708_10270036 Ga0207708_102700363 102
107 3300026088 Ga0207641_10127093 Ga0207641_101270933 102
108 3300026089 Ga0207648_11073091 Ga0207648_110730912 102
109 3300026095 Ga0207676_10017628 Ga0207676_100176283 102
110 3300026116 Ga0207674_11405547 Ga0207674_114055472 102
111 3300026118 Ga0207675_100002767 Ga0207675_1000027675 102
112 3300026118 Ga0207675_100104202 Ga0207675_1001042022 102
113 3300026118 Ga0207675_100326423 Ga0207675_1003264231 102
114 3300026142 Ga0207698_12417359 Ga0207698_124173592 102
115 3300028379 Ga0268266_10014542 Ga0268266_100145422 102
116 3300028794 Ga0307515_10122251 Ga0307515_101222512 102
117 3300031731 Ga0307405_10432972 Ga0307405_104329721 102
118 3300031824 Ga0307413_10001086 Ga0307413_1000108612 102
119 3300031824 Ga0307413_10020736 Ga0307413_100207362 102
120 3300031852 Ga0307410_10002061 Ga0307410_1000206112 102
121 3300031852 Ga0307410_10010352 Ga0307410_100103526 102
122 3300031901 Ga0307406_11238556 Ga0307406_112385562 102
123 3300031903 Ga0307407_10109104 Ga0307407_101091042 102
124 3300031911 Ga0307412_10522594 Ga0307412_105225942 102
125 3300031995 Ga0307409_100001337 Ga0307409_1000013372 102
126 3300031995 Ga0307409_100109024 Ga0307409_1001090243 102
127 3300031995 Ga0307409_100152512 Ga0307409_1001525122 102
128 3300032002 Ga0307416_100267768 Ga0307416_1002677682 102
129 3300032002 Ga0307416_103133033 Ga0307416_1031330331 102
130 3300032004 Ga0307414_10687753 Ga0307414_106877532 102
131 3300032005 Ga0307411_10004060 Ga0307411_100040602 102
132 3300032005 Ga0307411_10010004 Ga0307411_100100044 102
133 3300032126 Ga0307415_100027085 Ga0307415_1000270854 102
134 3300032126 Ga0307415_100236038 Ga0307415_1002360382 102
135 3300032126 Ga0307415_100455455 Ga0307415_1004554552 102
136 3300035092 Ga0373952_0227285 Ga0373952_0227285_97_420 102
137 3300035118 Ga0373954_0356886 Ga0373954_0356886_332_688 102
138 3300035172 Ga0373955_0046603 Ga0373955_0046603_1724_2080 102
139 3300036401 Ga0373937_0404618 Ga0373937_0404618_35_391 102
140 3300041441 Ga0451787_581116 Ga0451787_581116_387_710 102
141 3300041451 Ga0451791_0357959 Ga0451791_0357959_2410_2733 102
142 3300041452 Ga0451793_1516645 Ga0451793_1516645_546_869 102
143 3300041453 Ga0451797_0281795 Ga0451797_0281795_389_703 102
144 3300041453 Ga0451797_0560866 Ga0451797_0560866_813_1136 102
145 3300041460 Ga0451802_1481030 Ga0451802_1481030_912_1235 102
146 3300041486 Ga0451807_0306025 Ga0451807_0306025_3461_3772 102
147 3300041486 Ga0451807_1755513 Ga0451807_1755513_1861_2184 102
148 3300041507 Ga0451851_0786283 Ga0451851_0786283_475_798 102
149 3300041512 Ga0451853_1469472 Ga0451853_1469472_106_429 102
150 3300041512 Ga0451853_3461558 Ga0451853_3461558_15_332 102
151 3300042530 Ga0450916_013513 Ga0450916_013513_463_786 102
152 3300046519 Ga0495632_0124220 Ga0495632_0124220_50_367 102
153 3300046809 Ga0495600_0433490 Ga0495600_0433490_147_503 102
154 3300048907 Ga0496104_0341516 Ga0496104_0341516_656_973 102
155 3300048917 Ga0496114_0115607 Ga0496114_0115607_1965_2282 102
156 3300049576 Ga0501040_0761581 Ga0501040_0761581_86_397 102
157 3300049578 Ga0501042_0558990 Ga0501042_0558990_11_322 102
158 3300049578 Ga0501042_0771216 Ga0501042_0771216_319_630 102
159 3300050493 nmdc:mga0k408_409425_c1 nmdc:mga0k408_409425_c1_53_370 102
160 3300005334 Ga0068869_100196199 Ga0068869_1001961993 103
161 3300005334 Ga0068869_100424949 Ga0068869_1004249492 103
162 3300005466 Ga0070685_10160766 Ga0070685_101607663 103
163 3300005543 Ga0070672_100003711 Ga0070672_1000037119 103
164 3300005617 Ga0068859_100739363 Ga0068859_1007393632 103
165 3300005841 Ga0068863_100276248 Ga0068863_1002762482 103
166 3300005844 Ga0068862_101316591 Ga0068862_1013165911 103
167 3300005844 Ga0068862_101740917 Ga0068862_1017409172 103
168 3300006237 Ga0097621_100388882 Ga0097621_1003888822 103
169 3300006358 Ga0068871_100480116 Ga0068871_1004801162 103
170 3300006881 Ga0068865_100050707 Ga0068865_1000507072 103
171 3300006931 Ga0097620_100739325 Ga0097620_1007393252 103
172 3300009176 Ga0105242_11128021 Ga0105242_111280212 103
173 3300013308 Ga0157375_10704723 Ga0157375_107047231 103
174 3300013308 Ga0157375_10821068 Ga0157375_108210681 103
175 3300014969 Ga0157376_12736120 Ga0157376_127361201 103
176 3300025931 Ga0207644_10810879 Ga0207644_108108791 103
177 3300025937 Ga0207669_11754826 Ga0207669_117548262 103
178 3300025940 Ga0207691_10007309 Ga0207691_1000730911 103
179 3300025942 Ga0207689_10112614 Ga0207689_101126143 103
180 3300025945 Ga0207679_10068377 Ga0207679_100683774 103
181 3300026075 Ga0207708_11448816 Ga0207708_114488162 103
182 3300026088 Ga0207641_10348200 Ga0207641_103482002 103
183 3300026121 Ga0207683_10587566 Ga0207683_105875662 103
184 3300028380 Ga0268265_10752729 Ga0268265_107527292 103
185 3300031456 Ga0307513_10031568 Ga0307513_100315683 103
186 3300031507 Ga0307509_10013273 Ga0307509_100132737 103
187 3300031507 Ga0307509_10318814 Ga0307509_103188142 103
188 3300031548 Ga0307408_100688180 Ga0307408_1006881802 103
189 3300031824 Ga0307413_11860002 Ga0307413_118600022 103
190 3300031995 Ga0307409_100009658 Ga0307409_1000096583 103
191 3300046455 Ga0495603_0548736 Ga0495603_0548736_83_409 103
192 3300046457 Ga0495590_0029330 Ga0495590_0029330_710_1033 103
193 3300046616 Ga0495668_0360404 Ga0495668_0360404_418_741 103
194 3300046660 Ga0495625_0388394 Ga0495625_0388394_42_365 103
195 3300046694 Ga0495649_0109107 Ga0495649_0109107_292_615 103
196 3300046694 Ga0495649_0239777 Ga0495649_0239777_555_875 103
197 3300047472 Ga0495686_0060838 Ga0495686_0060838_855_1181 103
198 3300049572 Ga0501036_0856124 Ga0501036_0856124_406_720 103
199 3300014326 Ga0157380_11654684 Ga0157380_116546842 104
200 3300032126 Ga0307415_102091823 Ga0307415_1020918231 104
201 3300053093 Ga0500651_0625418 Ga0500651_0625418_124_462 104
202 3300005328 Ga0070676_10383824 Ga0070676_103838241 105
203 3300005328 Ga0070676_10745562 Ga0070676_107455622 105
204 3300005333 Ga0070677_10015312 Ga0070677_100153122 105
205 3300005334 Ga0068869_100672771 Ga0068869_1006727712 105
206 3300005337 Ga0070682_100623713 Ga0070682_1006237132 105
207 3300005340 Ga0070689_100863908 Ga0070689_1008639081 105
208 3300005347 Ga0070668_100142771 Ga0070668_1001427712 105
209 3300005347 Ga0070668_100805715 Ga0070668_1008057152 105
210 3300005354 Ga0070675_100168891 Ga0070675_1001688912 105
211 3300005354 Ga0070675_101582698 Ga0070675_1015826982 105
212 3300005356 Ga0070674_100080172 Ga0070674_1000801722 105
213 3300005356 Ga0070674_100157403 Ga0070674_1001574032 105
214 3300005364 Ga0070673_100236694 Ga0070673_1002366941 105
215 3300005365 Ga0070688_100361891 Ga0070688_1003618912 105
216 3300005367 Ga0070667_101086428 Ga0070667_1010864281 105
217 3300005441 Ga0070700_100414129 Ga0070700_1004141292 105
218 3300005455 Ga0070663_101360361 Ga0070663_1013603611 105
219 3300005456 Ga0070678_100037796 Ga0070678_1000377962 105
220 3300005456 Ga0070678_100107083 Ga0070678_1001070833 105
221 3300005456 Ga0070678_100329734 Ga0070678_1003297342 105
222 3300005456 Ga0070678_102229562 Ga0070678_1022295621 105
223 3300005457 Ga0070662_101678359 Ga0070662_1016783592 105
224 3300005459 Ga0068867_101200585 Ga0068867_1012005852 105
225 3300005466 Ga0070685_10235279 Ga0070685_102352792 105
226 3300005466 Ga0070685_10920939 Ga0070685_109209392 105
227 3300005539 Ga0068853_100402907 Ga0068853_1004029072 105
228 3300005543 Ga0070672_100043303 Ga0070672_1000433032 105
229 3300005543 Ga0070672_101215134 Ga0070672_1012151342 105
230 3300005544 Ga0070686_100247394 Ga0070686_1002473942 105
231 3300005549 Ga0070704_101615921 Ga0070704_1016159211 105
232 3300005618 Ga0068864_100418115 Ga0068864_1004181152 105
233 3300005719 Ga0068861_100136226 Ga0068861_1001362262 105
234 3300005840 Ga0068870_10140218 Ga0068870_101402182 105
235 3300005841 Ga0068863_100987061 Ga0068863_1009870612 105
236 3300005844 Ga0068862_100640097 Ga0068862_1006400972 105
237 3300006358 Ga0068871_100128041 Ga0068871_1001280412 105
238 3300006881 Ga0068865_100605376 Ga0068865_1006053762 105
239 3300009094 Ga0111539_10407919 Ga0111539_104079192 105
240 3300009094 Ga0111539_12490940 Ga0111539_124909402 105
241 3300009148 Ga0105243_10413582 Ga0105243_104135821 105
242 3300009177 Ga0105248_10491073 Ga0105248_104910732 105
243 3300013306 Ga0163162_11441663 Ga0163162_114416632 105
244 3300013308 Ga0157375_10437696 Ga0157375_104376962 105
245 3300014325 Ga0163163_10502169 Ga0163163_105021692 105
246 3300014325 Ga0163163_12346832 Ga0163163_123468322 105
247 3300014325 Ga0163163_12346834 Ga0163163_123468342 105
248 3300014325 Ga0163163_12801561 Ga0163163_128015612 105
249 3300014326 Ga0157380_10221148 Ga0157380_102211482 105
250 3300014968 Ga0157379_10785200 Ga0157379_107852002 105
251 3300014969 Ga0157376_11448177 Ga0157376_114481771 105
252 3300025893 Ga0207682_10012627 Ga0207682_100126273 105
253 3300025893 Ga0207682_10061007 Ga0207682_100610072 105
254 3300025907 Ga0207645_10454841 Ga0207645_104548412 105
255 3300025908 Ga0207643_10080363 Ga0207643_100803632 105
256 3300025923 Ga0207681_10193071 Ga0207681_101930712 105
257 3300025926 Ga0207659_10095916 Ga0207659_100959162 105
258 3300025926 Ga0207659_10459948 Ga0207659_104599482 105
259 3300025931 Ga0207644_10398345 Ga0207644_103983452 105
260 3300025931 Ga0207644_11036197 Ga0207644_110361972 105
261 3300025933 Ga0207706_10722982 Ga0207706_107229822 105
262 3300025936 Ga0207670_10455801 Ga0207670_104558012 105
263 3300025938 Ga0207704_11137305 Ga0207704_111373051 105
264 3300025940 Ga0207691_10001665 Ga0207691_1000166512 105
265 3300025940 Ga0207691_10066199 Ga0207691_100661994 105
266 3300025942 Ga0207689_10033585 Ga0207689_100335853 105
267 3300025945 Ga0207679_11305484 Ga0207679_113054842 105
268 3300025960 Ga0207651_10942345 Ga0207651_109423452 105
269 3300025960 Ga0207651_11133453 Ga0207651_111334532 105
270 3300025972 Ga0207668_10830246 Ga0207668_108302462 105
271 3300026067 Ga0207678_10415312 Ga0207678_104153122 105
272 3300026067 Ga0207678_11078597 Ga0207678_110785971 105
273 3300026075 Ga0207708_10196742 Ga0207708_101967422 105
274 3300026088 Ga0207641_10085193 Ga0207641_100851932 105
275 3300026089 Ga0207648_10158460 Ga0207648_101584602 105
276 3300026118 Ga0207675_100079909 Ga0207675_1000799092 105
277 3300026121 Ga0207683_10080948 Ga0207683_100809482 105
278 3300026121 Ga0207683_10613928 Ga0207683_106139282 105
279 3300028380 Ga0268265_10088447 Ga0268265_100884472 105
280 3300028794 Ga0307515_10639293 Ga0307515_106392932 105
281 3300031456 Ga0307513_10016612 Ga0307513_1001661211 105
282 3300031456 Ga0307513_10227006 Ga0307513_102270062 105
283 3300031649 Ga0307514_10097228 Ga0307514_100972283 105
284 3300031911 Ga0307412_11559427 Ga0307412_115594272 105
285 3300035171 Ga0373946_0490969 Ga0373946_0490969_298_615 105
286 3300041458 Ga0451798_0328541 Ga0451798_0328541_33_380 105
287 3300041463 Ga0451804_1179540 Ga0451804_1179540_200_529 105
288 3300041512 Ga0451853_1099279 Ga0451853_1099279_18_347 105
289 3300046458 Ga0495591_175326 Ga0495591_175326_107_439 105
290 3300046461 Ga0495641_0315306 Ga0495641_0315306_342_683 105
291 3300046539 Ga0495621_0240454 Ga0495621_0240454_249_566 105
292 3300046557 Ga0495622_0115770 Ga0495622_0115770_807_1133 105
293 3300046616 Ga0495668_0607624 Ga0495668_0607624_163_489 105
294 3300046660 Ga0495625_0039896 Ga0495625_0039896_3018_3347 105
295 3300046660 Ga0495625_0114597 Ga0495625_0114597_140_481 105
296 3300046694 Ga0495649_0002702 Ga0495649_0002702_7650_7976 105
297 3300046794 Ga0495589_0604622 Ga0495589_0604622_112_438 105
298 3300048912 Ga0496109_0603615 Ga0496109_0603615_666_983 105
299 3300050511 nmdc:mga08y16_677085_c1 nmdc:mga08y16_677085_c1_229_558 105
300 3300053129 Ga0500628_243495 Ga0500628_243495_44_361 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08666

SAF

SAF domain

36

107

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.9079 6 89
3k3s-assembly3.cif.gz_C crystal structure of altronate hydrolase (fragment 1-84) from shigella flexneri. 0.8883 6 89
5wfd-assembly1.cif.gz_B humanized mutant of the chaetomium thermophilum polycomb repressive complex 2 bound to the inhibitor gsk126 0.8876 19 32
6u7l-assembly2.cif.gz_C 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.8869 6 86
6u7l-assembly1.cif.gz_B 2.75 angstrom crystal structure of galactarate dehydratase from escherichia coli. 0.879 9 92
ID Description Score Start End Superfamily
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8854 9 87 2.30.130.110
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.879 9 89 2.30.130.110
af_P39829_14_92_2.30.130.110 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8648 9 87 2.30.130.110
3k3sD01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4; 0.8504 9 89 2.30.130.110
4l36B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.6966 16 51 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A4P8SIV8-F1-model_v4 Altronate hydrolase 0.9298 7 82 GO:0016787
GO:0016829
GO:0019698
AF-A0A2D8UDK6-F1-model_v4 Altronate hydrolase 0.9285 8 81 GO:0016787
GO:0016829
GO:0019698
AF-A0A2A2W7A1-F1-model_v4 SAF domain-containing protein 0.9275 6 87 GO:0016829
GO:0019698
AF-A0A832IK75-F1-model_v4 Altronate dehydratase 0.9262 7 89 GO:0016829
GO:0019698
AF-A0A382FL72-F1-model_v4 SAF domain-containing protein 0.9256 9 82

Feature Viewer

pLDDT pTM Quality
79.26 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map