F395292

General Info

Members Datasets Scaffolds Average Seq Length
300 179 300 193

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100159885|Ga0075363_1001598852
Length 195
Sequence VSQPSRQEAWEMVQEWVESESLRRHMLAVEVSMRAYAAKFGEDEELWGITGLVHDFDYERFPDLSDTENGHPRTALRELAERGYPQDVIDAVAGHASFLGVPRETPMAKTLFAVDELTGFIGACSLVRPTGIEGMKPKSVAKKLKTPSFAAGVDREEVRLGAAELGVEFSEHVAFLIAALSEHAEELGLEPREQA

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15
Nodule 0
Rhizoplane 10
Rhizosphere 74.67
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10084436 3300002067 Bacteria 910
2 JGI25407J50210_10010617 3300003373 Bacteria 2344
3 JGI25407J50210_10023984 3300003373 Bacteria 1584
4 Ga0070658_10140290 3300005327 Bacteria 2019
5 Ga0070683_100666131 3300005329 Bacteria 996
6 Ga0070680_100149994 3300005336 Bacteria 1957
7 Ga0070682_100004047 3300005337 Bacteria 8147
8 Ga0068868_100041017 3300005338 Bacteria 3605
9 Ga0070660_100001949 3300005339 Bacteria 14232
10 Ga0070689_100065571 3300005340 Bacteria 2828
11 Ga0070689_100255999 3300005340 Bacteria 1446
12 Ga0070687_100010852 3300005343 Bacteria 3962
13 Ga0070692_10001505 3300005345 Bacteria 8522
14 Ga0070668_100044355 3300005347 Bacteria 3412
15 Ga0070675_100262864 3300005354 Bacteria 1513
16 Ga0070674_100034589 3300005356 Bacteria 3376
17 Ga0070674_100256285 3300005356 Bacteria 1376
18 Ga0070673_100017467 3300005364 Bacteria 5103
19 Ga0070667_100265737 3300005367 Bacteria 1537
20 Ga0070710_10074345 3300005437 Bacteria 1967
21 Ga0070701_10123947 3300005438 Bacteria 1460
22 Ga0070711_100048314 3300005439 Bacteria 2908
23 Ga0070705_100222476 3300005440 Bacteria 1308
24 Ga0070694_100426372 3300005444 Bacteria 1043
25 Ga0070708_101065318 3300005445 Unclassified 757
26 Ga0070663_100004769 3300005455 Bacteria 8001
27 Ga0070678_100079339 3300005456 Bacteria 2482
28 Ga0070662_100642546 3300005457 Bacteria 895
29 Ga0070681_10099144 3300005458 Bacteria 2860
30 Ga0070679_100517529 3300005530 Unclassified 1137
31 Ga0070684_100201786 3300005535 Bacteria 1811
32 Ga0068853_100013382 3300005539 Bacteria 6696
33 Ga0070672_100035366 3300005543 Bacteria 3797
34 Ga0070695_100307432 3300005545 Bacteria 1174
35 Ga0070695_100578061 3300005545 Bacteria 879
36 Ga0070704_100005931 3300005549 Bacteria 7159
37 Ga0070704_100091841 3300005549 Bacteria 2265
38 Ga0070704_100128181 3300005549 Bacteria 1962
39 Ga0070704_100254895 3300005549 Bacteria 1443
40 Ga0070664_100034568 3300005564 Bacteria 4240
41 Ga0070664_100781219 3300005564 Bacteria 892
42 Ga0068857_100302000 3300005577 Bacteria 1476
43 Ga0068854_100015455 3300005578 Bacteria 5056
44 Ga0068856_100591480 3300005614 Bacteria 1131
45 Ga0070702_100074619 3300005615 Bacteria 2013
46 Ga0068852_100009283 3300005616 Bacteria 7293
47 Ga0068859_100049805 3300005617 Bacteria 4208
48 Ga0068864_100339675 3300005618 Bacteria 1415
49 Ga0068866_10203648 3300005718 Bacteria 1184
50 Ga0068861_100037043 3300005719 Bacteria 3625
51 Ga0068858_100094558 3300005842 Bacteria 2784
52 Ga0068860_100052875 3300005843 Bacteria 3863
53 Ga0081455_10020866 3300005937 Bacteria 6157
54 Ga0081455_10021029 3300005937 Bacteria 6127
55 Ga0081455_10039757 3300005937 Bacteria 4153
56 Ga0081455_10560019 3300005937 Bacteria 754
57 Ga0081455_10590205 3300005937 Bacteria 726
58 Ga0081538_10000044 3300005981 Bacteria 115394
59 Ga0081538_10000227 3300005981 Bacteria 63237
60 Ga0081538_10000766 3300005981 Bacteria 35083
61 Ga0081540_1002481 3300005983 Bacteria 15029
62 Ga0081540_1028063 3300005983 Bacteria 3171
63 Ga0075365_10001623 3300006038 Bacteria 10380
64 Ga0075365_10017361 3300006038 Bacteria 4401
65 Ga0075365_10103401 3300006038 Bacteria 1952
66 Ga0075365_10117722 3300006038 Bacteria 1830
67 Ga0075365_10202905 3300006038 Bacteria 1389
68 Ga0075368_10124582 3300006042 Bacteria 1069
69 Ga0075363_100002266 3300006048 Bacteria 7795
70 Ga0075363_100055263 3300006048 Bacteria 2126
71 Ga0075363_100159885 3300006048 Bacteria 1275
72 Ga0075363_100400344 3300006048 Bacteria 807
73 Ga0075363_100564949 3300006048 Unclassified 679
74 Ga0075364_10011875 3300006051 Bacteria 5305
75 Ga0075364_10035797 3300006051 Bacteria 3208
76 Ga0075364_10064960 3300006051 Bacteria 2395
77 Ga0075364_10079993 3300006051 Bacteria 2160
78 Ga0075364_10172150 3300006051 Bacteria 1464
79 Ga0075364_10236131 3300006051 Bacteria 1242
80 Ga0075364_10263951 3300006051 Bacteria 1171
81 Ga0075364_10586055 3300006051 Bacteria 762
82 Ga0075367_10103773 3300006178 Bacteria 1740
83 Ga0075367_10162658 3300006178 Bacteria 1388
84 Ga0075367_10373576 3300006178 Bacteria 901
85 Ga0075431_100149253 3300006847 Bacteria 2408
86 Ga0075434_100036511 3300006871 Bacteria 4861
87 Ga0075434_100038871 3300006871 Bacteria 4715
88 Ga0075429_100289166 3300006880 Bacteria 1435
89 Ga0068865_100102670 3300006881 Bacteria 2096
90 Ga0075436_100742572 3300006914 Bacteria 729
91 Ga0097620_100049804 3300006931 Bacteria 4208
92 Ga0111539_10008717 3300009094 Bacteria 12867
93 Ga0111539_10244422 3300009094 Bacteria 2089
94 Ga0105245_10001745 3300009098 Bacteria 19841
95 Ga0105245_10063006 3300009098 Bacteria 3347
96 Ga0114129_10046061 3300009147 Bacteria 6130
97 Ga0114129_10236184 3300009147 Bacteria 2459
98 Ga0114129_10365578 3300009147 Bacteria 1908
99 Ga0105243_10005633 3300009148 Bacteria 9750
100 Ga0105242_10251727 3300009176 Bacteria 1592
101 Ga0105249_10142018 3300009553 Bacteria 2303
102 Ga0105249_10258040 3300009553 Bacteria 1731
103 Ga0105239_10050194 3300010375 Bacteria 4576
104 Ga0105246_10129906 3300011119 Bacteria 1880
105 Ga0105246_10579298 3300011119 Bacteria 966
106 Ga0157372_10659369 3300013307 Bacteria 1218
107 Ga0163163_10089859 3300014325 Bacteria 3084
108 Ga0163163_10558418 3300014325 Bacteria 1207
109 Ga0157380_10412464 3300014326 Bacteria 1285
110 Ga0157377_10140837 3300014745 Bacteria 1482
111 Ga0157379_10455355 3300014968 Bacteria 1182
112 Ga0157379_10877439 3300014968 Bacteria 850
113 Ga0207688_10006201 3300025901 Bacteria 6503
114 Ga0207688_10017441 3300025901 Bacteria 3901
115 Ga0207685_10279724 3300025905 Bacteria 818
116 Ga0207645_10442162 3300025907 Bacteria 877
117 Ga0207643_10048336 3300025908 Bacteria 2409
118 Ga0207705_10108125 3300025909 Bacteria 2052
119 Ga0207663_10333046 3300025916 Bacteria 1144
120 Ga0207660_10145205 3300025917 Bacteria 1818
121 Ga0207662_10239296 3300025918 Bacteria 1188
122 Ga0207657_10004151 3300025919 Bacteria 15358
123 Ga0207664_10428596 3300025929 Bacteria 1179
124 Ga0207690_10009531 3300025932 Bacteria 5767
125 Ga0207706_10009622 3300025933 Bacteria 8870
126 Ga0207709_10007924 3300025935 Bacteria 5886
127 Ga0207709_10451363 3300025935 Bacteria 994
128 Ga0207669_10328131 3300025937 Bacteria 1174
129 Ga0207704_10030160 3300025938 Bacteria 3037
130 Ga0207691_10024601 3300025940 Bacteria 5664
131 Ga0207689_10072254 3300025942 Bacteria 2834
132 Ga0207651_10082879 3300025960 Bacteria 2317
133 Ga0207712_10092981 3300025961 Bacteria 2224
134 Ga0207677_10061041 3300026023 Bacteria 2609
135 Ga0207703_10075012 3300026035 Bacteria 2802
136 Ga0207639_10014004 3300026041 Bacteria 5627
137 Ga0207678_10001442 3300026067 Bacteria 21840
138 Ga0207708_10044071 3300026075 Bacteria 3399
139 Ga0207702_11127491 3300026078 Unclassified 778
140 Ga0207648_10086976 3300026089 Bacteria 2727
141 Ga0207674_10256549 3300026116 Bacteria 1695
142 Ga0207675_100032288 3300026118 Bacteria 4876
143 Ga0207683_10095309 3300026121 Bacteria 2653
144 Ga0207698_10028470 3300026142 Bacteria 3984
145 Ga0207428_10023749 3300027907 Bacteria 5151
146 Ga0268264_10128352 3300028381 Bacteria 2244
147 Ga0307413_10083049 3300031824 Bacteria 2060
148 Ga0307410_10060541 3300031852 Bacteria 2588
149 Ga0307406_10019086 3300031901 Bacteria 4020
150 Ga0307406_10131556 3300031901 Bacteria 1757
151 Ga0307407_10020178 3300031903 Bacteria 3409
152 Ga0307409_100203200 3300031995 Bacteria 1774
153 Ga0307409_100426657 3300031995 Bacteria 1273
154 Ga0307409_100503808 3300031995 Bacteria 1180
155 Ga0307416_100046622 3300032002 Bacteria 3422
156 Ga0307416_100647792 3300032002 Bacteria 1141
157 Ga0307411_10057857 3300032005 Bacteria 2563
158 Ga0307415_100143095 3300032126 Bacteria 1829
159 Ga0316574_0107058 3300035398 Bacteria 1791
160 Ga0316582_0445580 3300036647 Bacteria 892
161 Ga0316584_0059219 3300036712 Bacteria 2868
162 Ga0395899_0115701 3300037312 Bacteria 1924
163 Ga0395900_0006898 3300037418 Bacteria 11786
164 Ga0395898_0003404 3300037466 Bacteria 17816
165 Ga0395898_0129048 3300037466 Bacteria 2422
166 Ga0395898_0321843 3300037466 Bacteria 1475
167 Ga0395898_0323938 3300037466 Bacteria 1470
168 Ga0395905_0003834 3300037471 Bacteria 15880
169 Ga0395905_0216371 3300037471 Bacteria 1794
170 Ga0395905_0730722 3300037471 Bacteria 892
171 Ga0395901_0009771 3300038443 Bacteria 9729
172 Ga0395901_0024008 3300038443 Bacteria 6254
173 Ga0395901_0059197 3300038443 Bacteria 3985
174 Ga0395901_0325690 3300038443 Bacteria 1589
175 Ga0395901_1408635 3300038443 Bacteria 655
176 Ga0451853_2342927 3300041512 Bacteria 1280
177 Ga0466960_0553155 3300044901 Bacteria 679
178 Ga0495603_0125300 3300046455 Bacteria 1497
179 Ga0495641_0051423 3300046461 Bacteria 1881
180 Ga0495594_0113855 3300046499 Bacteria 1526
181 Ga0495596_0084787 3300046500 Bacteria 1230
182 Ga0495647_0190201 3300046681 Bacteria 897
183 Ga0495658_0206902 3300046683 Bacteria 1225
184 Ga0495670_0450926 3300046691 Bacteria 697
185 Ga0495676_0027172 3300047321 Bacteria 4912
186 Ga0495676_0440543 3300047321 Bacteria 860
187 Ga0496100_0509455 3300048903 Bacteria 928
188 Ga0496101_0087512 3300048904 Bacteria 2312
189 Ga0496102_0007062 3300048905 Bacteria 9584
190 Ga0496102_0149898 3300048905 Bacteria 2191
191 Ga0496102_0342923 3300048905 Bacteria 1407
192 Ga0496102_0394848 3300048905 Bacteria 1301
193 Ga0496103_0070414 3300048906 Bacteria 2188
194 Ga0496103_0128138 3300048906 Unclassified 1619
195 Ga0496103_0175241 3300048906 Bacteria 1378
196 Ga0496104_0035620 3300048907 Bacteria 4647
197 Ga0496105_0072608 3300048908 Bacteria 2843
198 Ga0496106_0007762 3300048909 Bacteria 7937
199 Ga0496106_0114655 3300048909 Bacteria 2101
200 Ga0496106_0617319 3300048909 Bacteria 868
201 Ga0496107_0005248 3300048910 Bacteria 8843
202 Ga0496107_0025050 3300048910 Bacteria 4223
203 Ga0496107_0030243 3300048910 Bacteria 3860
204 Ga0496107_0081295 3300048910 Bacteria 2363
205 Ga0496108_0003439 3300048911 Bacteria 12699
206 Ga0496108_0023877 3300048911 Bacteria 5033
207 Ga0496109_0021561 3300048912 Bacteria 5698
208 Ga0496109_0027376 3300048912 Bacteria 5089
209 Ga0496109_0453837 3300048912 Bacteria 1211
210 Ga0496109_0544086 3300048912 Bacteria 1095
211 Ga0496110_0240696 3300048913 Bacteria 1647
212 Ga0496110_0266805 3300048913 Bacteria 1558
213 Ga0496110_0318597 3300048913 Bacteria 1416
214 Ga0496111_0048031 3300048914 Bacteria 3074
215 Ga0496112_0018011 3300048915 Bacteria 6647
216 Ga0496114_0005917 3300048917 Bacteria 9614
217 Ga0501036_0140439 3300049572 Unclassified 2038
218 Ga0501036_0226765 3300049572 Bacteria 1568
219 Ga0501036_0635225 3300049572 Bacteria 884
220 Ga0501039_0168359 3300049575 Bacteria 1723
221 Ga0501040_0027065 3300049576 Bacteria 3859
222 Ga0501040_0469810 3300049576 Unclassified 906
223 Ga0501041_0492105 3300049577 Bacteria 780
224 Ga0501048_0064303 3300049582 Bacteria 2595
225 Ga0501068_0055593 3300049584 Bacteria 2398
226 Ga0501068_0130789 3300049584 Bacteria 1569
227 Ga0501068_0177534 3300049584 Bacteria 1346
228 Ga0501069_0573745 3300049585 Bacteria 676
229 Ga0501070_0007774 3300049586 Bacteria 9088
230 Ga0501070_0076713 3300049586 Bacteria 2766
231 Ga0501070_0178984 3300049586 Bacteria 1745
232 Ga0501071_0106315 3300049587 Bacteria 2072
233 Ga0501071_0584560 3300049587 Unclassified 858
234 Ga0501071_1473047 3300049587 Bacteria 525
235 Ga0501072_0037832 3300049588 Bacteria 3784
236 Ga0501072_0095604 3300049588 Unclassified 2361
237 Ga0501072_0122072 3300049588 Bacteria 2076
238 Ga0501072_0245670 3300049588 Bacteria 1426
239 Ga0501074_0043829 3300049590 Bacteria 3238
240 Ga0501074_0081686 3300049590 Bacteria 2318
241 Ga0501074_0170424 3300049590 Bacteria 1554
242 Ga0501075_0117343 3300049591 Bacteria 2023
243 Ga0501075_0133051 3300049591 Bacteria 1895
244 Ga0501075_0938418 3300049591 Bacteria 658
245 Ga0501076_0097036 3300049592 Bacteria 2374
246 Ga0501076_0471846 3300049592 Bacteria 1034
247 Ga0501077_0083165 3300049593 Bacteria 2028
248 Ga0501079_0027124 3300049741 Bacteria 4391
249 Ga0501079_0289467 3300049741 Bacteria 1281
250 Ga0501080_0014463 3300049742 Bacteria 7268
251 Ga0501081_0011234 3300049743 Bacteria 5857
252 Ga0501083_0100491 3300049744 Bacteria 1907
253 Ga0501045_0039834 3300049824 Bacteria 3419
254 Ga0501045_0534286 3300049824 Bacteria 870
255 nmdc:mga03683_168531_c1 3300050489 Bacteria 994
256 nmdc:mga03n38_26256_c1 3300050490 Bacteria 2403
257 nmdc:mga03n38_40736_c1 3300050490 Bacteria 2020
258 nmdc:mga03n38_507077_c1 3300050490 Bacteria 678
259 nmdc:mga03n38_8627_c1 3300050490 Bacteria 3667
260 nmdc:mga00v17_141668_c1 3300050491 Bacteria 1542
261 nmdc:mga00v17_175230_c1 3300050491 Bacteria 1383
262 nmdc:mga00v17_21582_c1 3300050491 Bacteria 3703
263 nmdc:mga00v17_349726_c1 3300050491 Bacteria 961
264 nmdc:mga00v17_58517_c1 3300050491 Bacteria 2361
265 nmdc:mga00v17_73958_c1 3300050491 Bacteria 2117
266 nmdc:mga00v17_82547_c1 3300050491 Bacteria 2009
267 nmdc:mga00v17_98606_c1 3300050491 Bacteria 1843
268 nmdc:mga0yw44_183650_c1 3300050492 Bacteria 1377
269 nmdc:mga0yw44_2078_c1 3300050492 Bacteria 8360
270 nmdc:mga0yw44_30009_c1 3300050492 Bacteria 3146
271 nmdc:mga0yw44_48072_c1 3300050492 Bacteria 2571
272 nmdc:mga0yw44_90810_c1 3300050492 Bacteria 1930
273 nmdc:mga06z11_125120_c1 3300050494 Bacteria 1438
274 nmdc:mga06z11_213421_c1 3300050494 Bacteria 1125
275 nmdc:mga06z11_355007_c1 3300050494 Bacteria 878
276 nmdc:mga04h51_217993_c1 3300050495 Unclassified 755
277 nmdc:mga04h51_300330_c1 3300050495 Bacteria 654
278 nmdc:mga05p37_109917_c1 3300050507 Bacteria 3391
279 nmdc:mga05p37_115959_c1 3300050507 Bacteria 3292
280 nmdc:mga05p37_157128_c1 3300050507 Bacteria 2778
281 nmdc:mga05p37_284578_c1 3300050507 Bacteria 1970
282 nmdc:mga0qj67_380463_c1 3300050509 Bacteria 1140
283 nmdc:mga0qj67_414480_c1 3300050509 Bacteria 1086
284 nmdc:mga06r32_205483_c1 3300050510 Bacteria 1958
285 nmdc:mga06r32_34753_c1 3300050510 Bacteria 4754
286 nmdc:mga08y16_172142_c1 3300050511 Bacteria 2249
287 nmdc:mga08y16_387809_c1 3300050511 Bacteria 1431
288 nmdc:mga0n895_39417_c1 3300050512 Bacteria 3825
289 nmdc:mga0rr50_131699_c1 3300050513 Bacteria 2003
290 nmdc:mga08x19_850891_c1 3300050514 Bacteria 648
291 nmdc:mga0a205_71341_c1 3300050515 Bacteria 3355
292 Ga0501084_0350422 3300054114 Bacteria 1247
293 Ga0501084_0434802 3300054114 Bacteria 1109
294 Ga0501084_0637344 3300054114 Bacteria 900
295 Ga0501084_0719724 3300054114 Bacteria 841
296 Ga0501082_0062691 3300060353 Bacteria 3201
297 Ga0501082_0310522 3300060353 Bacteria 1373
298 Ga0530510_0091880 3300061734 Bacteria 2215
299 Ga0530510_0152087 3300061734 Bacteria 1709
300 Ga0530510_0266760 3300061734 Bacteria 1277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0573745 Ga0501069_0573745_165_665 161
2 3300049587 Ga0501071_1473047 Ga0501071_1473047_12_512 161
3 3300044901 Ga0466960_0553155 Ga0466960_0553155_160_663 167
4 3300050507 nmdc:mga05p37_284578_c1 nmdc:mga05p37_284578_c1_12_515 167
5 3300050509 nmdc:mga0qj67_380463_c1 nmdc:mga0qj67_380463_c1_11_517 167
6 3300050494 nmdc:mga06z11_213421_c1 nmdc:mga06z11_213421_c1_14_523 168
7 3300031824 Ga0307413_10083049 Ga0307413_100830493 171
8 3300031901 Ga0307406_10019086 Ga0307406_100190861 171
9 3300032002 Ga0307416_100046622 Ga0307416_1000466222 171
10 3300031852 Ga0307410_10060541 Ga0307410_100605414 178
11 3300031903 Ga0307407_10020178 Ga0307407_100201783 178
12 3300031995 Ga0307409_100203200 Ga0307409_1002032002 178
13 3300032005 Ga0307411_10057857 Ga0307411_100578574 178
14 3300032126 Ga0307415_100143095 Ga0307415_1001430952 178
15 3300050490 nmdc:mga03n38_26256_c1 nmdc:mga03n38_26256_c1_600_1154 181
16 3300005549 Ga0070704_100128181 Ga0070704_1001281812 182
17 3300048905 Ga0496102_0394848 Ga0496102_0394848_321_869 182
18 3300048906 Ga0496103_0070414 Ga0496103_0070414_387_935 182
19 3300048910 Ga0496107_0025050 Ga0496107_0025050_3478_4026 182
20 3300048912 Ga0496109_0453837 Ga0496109_0453837_535_1083 182
21 3300048912 Ga0496109_0544086 Ga0496109_0544086_521_1069 182
22 3300048913 Ga0496110_0240696 Ga0496110_0240696_687_1235 182
23 3300048914 Ga0496111_0048031 Ga0496111_0048031_2457_3005 182
24 3300037466 Ga0395898_0323938 Ga0395898_0323938_461_1057 183
25 3300038443 Ga0395901_0009771 Ga0395901_0009771_3335_3931 183
26 3300005937 Ga0081455_10020866 Ga0081455_100208662 186
27 3300050490 nmdc:mga03n38_507077_c1 nmdc:mga03n38_507077_c1_74_664 187
28 3300003373 JGI25407J50210_10023984 JGI25407J50210_100239841 189
29 3300005981 Ga0081538_10000766 Ga0081538_1000076613 189
30 3300005530 Ga0070679_100517529 Ga0070679_1005175292 190
31 3300046455 Ga0495603_0125300 Ga0495603_0125300_704_1276 190
32 3300047321 Ga0495676_0440543 Ga0495676_0440543_44_616 190
33 3300049591 Ga0501075_0938418 Ga0501075_0938418_53_628 191
34 3300003373 JGI25407J50210_10010617 JGI25407J50210_100106172 192
35 3300005340 Ga0070689_100255999 Ga0070689_1002559992 192
36 3300005367 Ga0070667_100265737 Ga0070667_1002657371 192
37 3300005437 Ga0070710_10074345 Ga0070710_100743453 192
38 3300005439 Ga0070711_100048314 Ga0070711_1000483142 192
39 3300005444 Ga0070694_100426372 Ga0070694_1004263722 192
40 3300005445 Ga0070708_101065318 Ga0070708_1010653181 192
41 3300005456 Ga0070678_100079339 Ga0070678_1000793392 192
42 3300005545 Ga0070695_100307432 Ga0070695_1003074322 192
43 3300005549 Ga0070704_100005931 Ga0070704_1000059318 192
44 3300005564 Ga0070664_100781219 Ga0070664_1007812191 192
45 3300005614 Ga0068856_100591480 Ga0068856_1005914802 192
46 3300005618 Ga0068864_100339675 Ga0068864_1003396752 192
47 3300005937 Ga0081455_10039757 Ga0081455_100397572 192
48 3300005937 Ga0081455_10590205 Ga0081455_105902052 192
49 3300005981 Ga0081538_10000044 Ga0081538_1000004411 192
50 3300006048 Ga0075363_100159885 Ga0075363_1001598852 192
51 3300006880 Ga0075429_100289166 Ga0075429_1002891662 192
52 3300009098 Ga0105245_10001745 Ga0105245_1000174510 192
53 3300011119 Ga0105246_10579298 Ga0105246_105792982 192
54 3300013307 Ga0157372_10659369 Ga0157372_106593692 192
55 3300014325 Ga0163163_10558418 Ga0163163_105584182 192
56 3300014968 Ga0157379_10455355 Ga0157379_104553552 192
57 3300025901 Ga0207688_10017441 Ga0207688_100174412 192
58 3300025905 Ga0207685_10279724 Ga0207685_102797241 192
59 3300025916 Ga0207663_10333046 Ga0207663_103330461 192
60 3300025929 Ga0207664_10428596 Ga0207664_104285962 192
61 3300026078 Ga0207702_11127491 Ga0207702_111274911 192
62 3300026121 Ga0207683_10095309 Ga0207683_100953092 192
63 3300046461 Ga0495641_0051423 Ga0495641_0051423_1107_1685 192
64 3300046499 Ga0495594_0113855 Ga0495594_0113855_20_598 192
65 3300046681 Ga0495647_0190201 Ga0495647_0190201_275_853 192
66 3300046683 Ga0495658_0206902 Ga0495658_0206902_85_663 192
67 3300047321 Ga0495676_0027172 Ga0495676_0027172_1439_2017 192
68 3300048904 Ga0496101_0087512 Ga0496101_0087512_1125_1703 192
69 3300048905 Ga0496102_0007062 Ga0496102_0007062_7134_7712 192
70 3300048906 Ga0496103_0128138 Ga0496103_0128138_797_1375 192
71 3300048907 Ga0496104_0035620 Ga0496104_0035620_1139_1717 192
72 3300048908 Ga0496105_0072608 Ga0496105_0072608_360_938 192
73 3300048909 Ga0496106_0007762 Ga0496106_0007762_2215_2793 192
74 3300048910 Ga0496107_0005248 Ga0496107_0005248_6186_6764 192
75 3300048911 Ga0496108_0003439 Ga0496108_0003439_9826_10404 192
76 3300048912 Ga0496109_0027376 Ga0496109_0027376_3845_4423 192
77 3300048913 Ga0496110_0266805 Ga0496110_0266805_353_931 192
78 3300048915 Ga0496112_0018011 Ga0496112_0018011_5703_6281 192
79 3300048917 Ga0496114_0005917 Ga0496114_0005917_7054_7632 192
80 3300050495 nmdc:mga04h51_300330_c1 nmdc:mga04h51_300330_c1_44_622 192
81 3300005356 Ga0070674_100256285 Ga0070674_1002562852 193
82 3300005545 Ga0070695_100578061 Ga0070695_1005780611 193
83 3300005549 Ga0070704_100091841 Ga0070704_1000918412 193
84 3300005549 Ga0070704_100254895 Ga0070704_1002548952 193
85 3300005937 Ga0081455_10021029 Ga0081455_100210294 193
86 3300005937 Ga0081455_10560019 Ga0081455_105600192 193
87 3300005981 Ga0081538_10000227 Ga0081538_1000022745 193
88 3300005983 Ga0081540_1002481 Ga0081540_100248116 193
89 3300005983 Ga0081540_1028063 Ga0081540_10280632 193
90 3300006038 Ga0075365_10001623 Ga0075365_1000162312 193
91 3300006038 Ga0075365_10103401 Ga0075365_101034012 193
92 3300006038 Ga0075365_10202905 Ga0075365_102029052 193
93 3300006042 Ga0075368_10124582 Ga0075368_101245822 193
94 3300006048 Ga0075363_100564949 Ga0075363_1005649491 193
95 3300006051 Ga0075364_10011875 Ga0075364_100118751 193
96 3300006051 Ga0075364_10035797 Ga0075364_100357971 193
97 3300006051 Ga0075364_10064960 Ga0075364_100649602 193
98 3300006051 Ga0075364_10079993 Ga0075364_100799932 193
99 3300006051 Ga0075364_10172150 Ga0075364_101721502 193
100 3300006051 Ga0075364_10586055 Ga0075364_105860552 193
101 3300006178 Ga0075367_10103773 Ga0075367_101037732 193
102 3300006178 Ga0075367_10162658 Ga0075367_101626582 193
103 3300006847 Ga0075431_100149253 Ga0075431_1001492532 193
104 3300006871 Ga0075434_100036511 Ga0075434_1000365115 193
105 3300006871 Ga0075434_100038871 Ga0075434_1000388713 193
106 3300006914 Ga0075436_100742572 Ga0075436_1007425721 193
107 3300009094 Ga0111539_10244422 Ga0111539_102444221 193
108 3300009147 Ga0114129_10046061 Ga0114129_100460613 193
109 3300009147 Ga0114129_10236184 Ga0114129_102361842 193
110 3300009147 Ga0114129_10365578 Ga0114129_103655782 193
111 3300009553 Ga0105249_10142018 Ga0105249_101420182 193
112 3300009553 Ga0105249_10258040 Ga0105249_102580402 193
113 3300014968 Ga0157379_10877439 Ga0157379_108774391 193
114 3300025935 Ga0207709_10451363 Ga0207709_104513631 193
115 3300025937 Ga0207669_10328131 Ga0207669_103281312 193
116 3300025961 Ga0207712_10092981 Ga0207712_100929812 193
117 3300031995 Ga0307409_100426657 Ga0307409_1004266571 193
118 3300037312 Ga0395899_0115701 Ga0395899_0115701_542_1132 193
119 3300037418 Ga0395900_0006898 Ga0395900_0006898_655_1245 193
120 3300037466 Ga0395898_0003404 Ga0395898_0003404_7592_8182 193
121 3300037466 Ga0395898_0129048 Ga0395898_0129048_594_1184 193
122 3300037466 Ga0395898_0321843 Ga0395898_0321843_581_1174 193
123 3300037471 Ga0395905_0003834 Ga0395905_0003834_1754_2344 193
124 3300037471 Ga0395905_0216371 Ga0395905_0216371_830_1420 193
125 3300037471 Ga0395905_0730722 Ga0395905_0730722_134_724 193
126 3300038443 Ga0395901_0024008 Ga0395901_0024008_1981_2571 193
127 3300038443 Ga0395901_0059197 Ga0395901_0059197_2697_3290 193
128 3300038443 Ga0395901_0325690 Ga0395901_0325690_987_1577 193
129 3300038443 Ga0395901_1408635 Ga0395901_1408635_54_638 193
130 3300041512 Ga0451853_2342927 Ga0451853_2342927_329_940 193
131 3300046500 Ga0495596_0084787 Ga0495596_0084787_384_971 193
132 3300046691 Ga0495670_0450926 Ga0495670_0450926_48_638 193
133 3300048905 Ga0496102_0149898 Ga0496102_0149898_137_721 193
134 3300048906 Ga0496103_0175241 Ga0496103_0175241_598_1182 193
135 3300048909 Ga0496106_0617319 Ga0496106_0617319_245_829 193
136 3300048910 Ga0496107_0030243 Ga0496107_0030243_47_631 193
137 3300049572 Ga0501036_0140439 Ga0501036_0140439_1385_1969 193
138 3300049572 Ga0501036_0635225 Ga0501036_0635225_289_873 193
139 3300049576 Ga0501040_0027065 Ga0501040_0027065_1202_1786 193
140 3300049576 Ga0501040_0469810 Ga0501040_0469810_302_886 193
141 3300049577 Ga0501041_0492105 Ga0501041_0492105_75_659 193
142 3300049582 Ga0501048_0064303 Ga0501048_0064303_1533_2117 193
143 3300049584 Ga0501068_0055593 Ga0501068_0055593_558_1142 193
144 3300049584 Ga0501068_0177534 Ga0501068_0177534_542_1126 193
145 3300049587 Ga0501071_0584560 Ga0501071_0584560_170_754 193
146 3300049588 Ga0501072_0095604 Ga0501072_0095604_1746_2330 193
147 3300049588 Ga0501072_0122072 Ga0501072_0122072_830_1414 193
148 3300049588 Ga0501072_0245670 Ga0501072_0245670_91_675 193
149 3300049590 Ga0501074_0081686 Ga0501074_0081686_575_1159 193
150 3300049590 Ga0501074_0170424 Ga0501074_0170424_375_962 193
151 3300049591 Ga0501075_0133051 Ga0501075_0133051_1151_1735 193
152 3300049592 Ga0501076_0097036 Ga0501076_0097036_1272_1856 193
153 3300049593 Ga0501077_0083165 Ga0501077_0083165_120_704 193
154 3300049741 Ga0501079_0027124 Ga0501079_0027124_3429_4013 193
155 3300049743 Ga0501081_0011234 Ga0501081_0011234_2901_3485 193
156 3300049824 Ga0501045_0039834 Ga0501045_0039834_1057_1641 193
157 3300049824 Ga0501045_0534286 Ga0501045_0534286_22_606 193
158 3300050489 nmdc:mga03683_168531_c1 nmdc:mga03683_168531_c1_186_794 193
159 3300050491 nmdc:mga00v17_141668_c1 nmdc:mga00v17_141668_c1_600_1208 193
160 3300050491 nmdc:mga00v17_175230_c1 nmdc:mga00v17_175230_c1_579_1184 193
161 3300050491 nmdc:mga00v17_21582_c1 nmdc:mga00v17_21582_c1_2953_3537 193
162 3300050491 nmdc:mga00v17_73958_c1 nmdc:mga00v17_73958_c1_1270_1893 193
163 3300050491 nmdc:mga00v17_82547_c1 nmdc:mga00v17_82547_c1_298_906 193
164 3300050491 nmdc:mga00v17_98606_c1 nmdc:mga00v17_98606_c1_1186_1794 193
165 3300050492 nmdc:mga0yw44_183650_c1 nmdc:mga0yw44_183650_c1_23_607 193
166 3300050492 nmdc:mga0yw44_30009_c1 nmdc:mga0yw44_30009_c1_143_727 193
167 3300050492 nmdc:mga0yw44_90810_c1 nmdc:mga0yw44_90810_c1_1019_1627 193
168 3300050494 nmdc:mga06z11_125120_c1 nmdc:mga06z11_125120_c1_599_1207 193
169 3300050494 nmdc:mga06z11_355007_c1 nmdc:mga06z11_355007_c1_56_664 193
170 3300050495 nmdc:mga04h51_217993_c1 nmdc:mga04h51_217993_c1_18_626 193
171 3300050507 nmdc:mga05p37_109917_c1 nmdc:mga05p37_109917_c1_652_1239 193
172 3300050507 nmdc:mga05p37_115959_c1 nmdc:mga05p37_115959_c1_2223_2807 193
173 3300050507 nmdc:mga05p37_157128_c1 nmdc:mga05p37_157128_c1_1169_1753 193
174 3300050509 nmdc:mga0qj67_414480_c1 nmdc:mga0qj67_414480_c1_470_1063 193
175 3300050510 nmdc:mga06r32_205483_c1 nmdc:mga06r32_205483_c1_152_739 193
176 3300050510 nmdc:mga06r32_34753_c1 nmdc:mga06r32_34753_c1_3882_4469 193
177 3300050511 nmdc:mga08y16_172142_c1 nmdc:mga08y16_172142_c1_1347_1934 193
178 3300050511 nmdc:mga08y16_387809_c1 nmdc:mga08y16_387809_c1_687_1271 193
179 3300050512 nmdc:mga0n895_39417_c1 nmdc:mga0n895_39417_c1_2161_2748 193
180 3300050513 nmdc:mga0rr50_131699_c1 nmdc:mga0rr50_131699_c1_1255_1839 193
181 3300050514 nmdc:mga08x19_850891_c1 nmdc:mga08x19_850891_c1_53_637 193
182 3300050515 nmdc:mga0a205_71341_c1 nmdc:mga0a205_71341_c1_167_751 193
183 3300054114 Ga0501084_0350422 Ga0501084_0350422_529_1113 193
184 3300054114 Ga0501084_0434802 Ga0501084_0434802_383_967 193
185 3300054114 Ga0501084_0637344 Ga0501084_0637344_207_791 193
186 3300054114 Ga0501084_0719724 Ga0501084_0719724_220_804 193
187 3300060353 Ga0501082_0062691 Ga0501082_0062691_627_1211 193
188 3300061734 Ga0530510_0091880 Ga0530510_0091880_189_770 193
189 3300061734 Ga0530510_0152087 Ga0530510_0152087_1090_1674 193
190 3300061734 Ga0530510_0266760 Ga0530510_0266760_118_702 193
191 3300002067 JGI24735J21928_10084436 JGI24735J21928_100844361 194
192 3300005327 Ga0070658_10140290 Ga0070658_101402902 194
193 3300005329 Ga0070683_100666131 Ga0070683_1006661311 194
194 3300005336 Ga0070680_100149994 Ga0070680_1001499942 194
195 3300005337 Ga0070682_100004047 Ga0070682_1000040476 194
196 3300005338 Ga0068868_100041017 Ga0068868_1000410174 194
197 3300005339 Ga0070660_100001949 Ga0070660_1000019494 194
198 3300005340 Ga0070689_100065571 Ga0070689_1000655713 194
199 3300005343 Ga0070687_100010852 Ga0070687_1000108522 194
200 3300005345 Ga0070692_10001505 Ga0070692_100015055 194
201 3300005347 Ga0070668_100044355 Ga0070668_1000443552 194
202 3300005354 Ga0070675_100262864 Ga0070675_1002628642 194
203 3300005356 Ga0070674_100034589 Ga0070674_1000345891 194
204 3300005364 Ga0070673_100017467 Ga0070673_1000174675 194
205 3300005438 Ga0070701_10123947 Ga0070701_101239472 194
206 3300005440 Ga0070705_100222476 Ga0070705_1002224762 194
207 3300005455 Ga0070663_100004769 Ga0070663_1000047692 194
208 3300005457 Ga0070662_100642546 Ga0070662_1006425461 194
209 3300005458 Ga0070681_10099144 Ga0070681_100991443 194
210 3300005535 Ga0070684_100201786 Ga0070684_1002017862 194
211 3300005539 Ga0068853_100013382 Ga0068853_1000133823 194
212 3300005543 Ga0070672_100035366 Ga0070672_1000353662 194
213 3300005564 Ga0070664_100034568 Ga0070664_1000345685 194
214 3300005577 Ga0068857_100302000 Ga0068857_1003020002 194
215 3300005578 Ga0068854_100015455 Ga0068854_1000154555 194
216 3300005615 Ga0070702_100074619 Ga0070702_1000746192 194
217 3300005616 Ga0068852_100009283 Ga0068852_1000092833 194
218 3300005617 Ga0068859_100049805 Ga0068859_1000498054 194
219 3300005718 Ga0068866_10203648 Ga0068866_102036482 194
220 3300005719 Ga0068861_100037043 Ga0068861_1000370434 194
221 3300005842 Ga0068858_100094558 Ga0068858_1000945583 194
222 3300005843 Ga0068860_100052875 Ga0068860_1000528752 194
223 3300006038 Ga0075365_10017361 Ga0075365_100173612 194
224 3300006038 Ga0075365_10117722 Ga0075365_101177222 194
225 3300006048 Ga0075363_100002266 Ga0075363_1000022667 194
226 3300006048 Ga0075363_100055263 Ga0075363_1000552632 194
227 3300006048 Ga0075363_100400344 Ga0075363_1004003441 194
228 3300006051 Ga0075364_10236131 Ga0075364_102361312 194
229 3300006051 Ga0075364_10263951 Ga0075364_102639512 194
230 3300006178 Ga0075367_10373576 Ga0075367_103735762 194
231 3300006881 Ga0068865_100102670 Ga0068865_1001026702 194
232 3300006931 Ga0097620_100049804 Ga0097620_1000498044 194
233 3300009094 Ga0111539_10008717 Ga0111539_100087179 194
234 3300009098 Ga0105245_10063006 Ga0105245_100630062 194
235 3300009148 Ga0105243_10005633 Ga0105243_100056337 194
236 3300009176 Ga0105242_10251727 Ga0105242_102517272 194
237 3300010375 Ga0105239_10050194 Ga0105239_100501944 194
238 3300011119 Ga0105246_10129906 Ga0105246_101299062 194
239 3300014325 Ga0163163_10089859 Ga0163163_100898592 194
240 3300014326 Ga0157380_10412464 Ga0157380_104124642 194
241 3300014745 Ga0157377_10140837 Ga0157377_101408372 194
242 3300025901 Ga0207688_10006201 Ga0207688_100062013 194
243 3300025907 Ga0207645_10442162 Ga0207645_104421621 194
244 3300025908 Ga0207643_10048336 Ga0207643_100483363 194
245 3300025909 Ga0207705_10108125 Ga0207705_101081252 194
246 3300025917 Ga0207660_10145205 Ga0207660_101452052 194
247 3300025918 Ga0207662_10239296 Ga0207662_102392961 194
248 3300025919 Ga0207657_10004151 Ga0207657_100041515 194
249 3300025932 Ga0207690_10009531 Ga0207690_100095312 194
250 3300025933 Ga0207706_10009622 Ga0207706_100096227 194
251 3300025935 Ga0207709_10007924 Ga0207709_100079246 194
252 3300025938 Ga0207704_10030160 Ga0207704_100301602 194
253 3300025940 Ga0207691_10024601 Ga0207691_100246014 194
254 3300025942 Ga0207689_10072254 Ga0207689_100722543 194
255 3300025960 Ga0207651_10082879 Ga0207651_100828792 194
256 3300026023 Ga0207677_10061041 Ga0207677_100610411 194
257 3300026035 Ga0207703_10075012 Ga0207703_100750122 194
258 3300026041 Ga0207639_10014004 Ga0207639_100140045 194
259 3300026067 Ga0207678_10001442 Ga0207678_1000144223 194
260 3300026075 Ga0207708_10044071 Ga0207708_100440712 194
261 3300026089 Ga0207648_10086976 Ga0207648_100869763 194
262 3300026116 Ga0207674_10256549 Ga0207674_102565492 194
263 3300026118 Ga0207675_100032288 Ga0207675_1000322882 194
264 3300026142 Ga0207698_10028470 Ga0207698_100284703 194
265 3300027907 Ga0207428_10023749 Ga0207428_100237495 194
266 3300028381 Ga0268264_10128352 Ga0268264_101283523 194
267 3300031901 Ga0307406_10131556 Ga0307406_101315562 194
268 3300031995 Ga0307409_100503808 Ga0307409_1005038082 194
269 3300032002 Ga0307416_100647792 Ga0307416_1006477922 194
270 3300035398 Ga0316574_0107058 Ga0316574_0107058_281_871 194
271 3300036647 Ga0316582_0445580 Ga0316582_0445580_199_783 194
272 3300036712 Ga0316584_0059219 Ga0316584_0059219_890_1480 194
273 3300048903 Ga0496100_0509455 Ga0496100_0509455_48_632 194
274 3300048905 Ga0496102_0342923 Ga0496102_0342923_385_969 194
275 3300048909 Ga0496106_0114655 Ga0496106_0114655_627_1211 194
276 3300048910 Ga0496107_0081295 Ga0496107_0081295_622_1206 194
277 3300048911 Ga0496108_0023877 Ga0496108_0023877_2060_2644 194
278 3300048912 Ga0496109_0021561 Ga0496109_0021561_4439_5023 194
279 3300048913 Ga0496110_0318597 Ga0496110_0318597_292_876 194
280 3300049572 Ga0501036_0226765 Ga0501036_0226765_494_1078 194
281 3300049575 Ga0501039_0168359 Ga0501039_0168359_193_777 194
282 3300049584 Ga0501068_0130789 Ga0501068_0130789_107_700 194
283 3300049586 Ga0501070_0007774 Ga0501070_0007774_6439_7038 194
284 3300049586 Ga0501070_0076713 Ga0501070_0076713_1124_1717 194
285 3300049586 Ga0501070_0178984 Ga0501070_0178984_1124_1714 194
286 3300049587 Ga0501071_0106315 Ga0501071_0106315_1066_1656 194
287 3300049588 Ga0501072_0037832 Ga0501072_0037832_1801_2394 194
288 3300049590 Ga0501074_0043829 Ga0501074_0043829_2120_2713 194
289 3300049591 Ga0501075_0117343 Ga0501075_0117343_749_1333 194
290 3300049592 Ga0501076_0471846 Ga0501076_0471846_236_820 194
291 3300049741 Ga0501079_0289467 Ga0501079_0289467_232_816 194
292 3300049742 Ga0501080_0014463 Ga0501080_0014463_2207_2800 194
293 3300049744 Ga0501083_0100491 Ga0501083_0100491_1117_1710 194
294 3300050490 nmdc:mga03n38_40736_c1 nmdc:mga03n38_40736_c1_1008_1598 194
295 3300050490 nmdc:mga03n38_8627_c1 nmdc:mga03n38_8627_c1_648_1232 194
296 3300050491 nmdc:mga00v17_349726_c1 nmdc:mga00v17_349726_c1_329_931 194
297 3300050491 nmdc:mga00v17_58517_c1 nmdc:mga00v17_58517_c1_1226_1810 194
298 3300050492 nmdc:mga0yw44_2078_c1 nmdc:mga0yw44_2078_c1_986_1570 194
299 3300050492 nmdc:mga0yw44_48072_c1 nmdc:mga0yw44_48072_c1_792_1391 194
300 3300060353 Ga0501082_0310522 Ga0501082_0310522_83_667 194

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

22

119

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pq7-assembly1.cif.gz_A-2 crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution 0.6025 7 163
6yvc-assembly4.cif.gz_D crystal structure of the small alarmone hydrolase (sah) of pseudomonas aeruginosa 0.5708 1 184
6yvc-assembly1.cif.gz_A crystal structure of the small alarmone hydrolase (sah) of pseudomonas aeruginosa 0.5625 1 184
4s1c-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain 0.5608 9 184
7p1y-assembly2.cif.gz_CCC-2 a small alarmone hydrolase tdactapo2 mutant - t78n 0.5593 7 184
ID Description Score Start End Superfamily
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7916 9 115 1.10.3210.10
af_Q2G2T1_122_299_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7249 25 116 1.10.3210.10
5ihyB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6504 1 97 1.10.472.50
5ihyB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6342 1 97 1.10.472.50
3dtoA01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6158 1 99 1.10.472.50
ID Description Score Start End GO Terms
AF-A0A538L6I3-F1-model_v4 HDIG domain-containing protein 0.9954 5 187
AF-A0A838PKQ8-F1-model_v4 HDIG domain-containing protein 0.9924 5 188
AF-A0A6J4S6N2-F1-model_v4 Lactate 2-monooxygenase (EC 1.13.12.4) 0.9922 5 187 GO:0010181
GO:0050040
AF-A0A832IMP2-F1-model_v4 HDIG domain-containing protein 0.9918 5 141
AF-A0A7V9GT93-F1-model_v4 HDIG domain-containing protein 0.9907 4 102

Feature Viewer

pLDDT pTM Quality
95.5 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map