F395292
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 179 | 300 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300006048|Ga0075363_100159885|Ga0075363_1001598852 |
| Length | 195 |
| Sequence | VSQPSRQEAWEMVQEWVESESLRRHMLAVEVSMRAYAAKFGEDEELWGITGLVHDFDYERFPDLSDTENGHPRTALRELAERGYPQDVIDAVAGHASFLGVPRETPMAKTLFAVDELTGFIGACSLVRPTGIEGMKPKSVAKKLKTPSFAAGVDREEVRLGAAELGVEFSEHVAFLIAALSEHAEELGLEPREQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 113 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 114 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 133 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 144 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 164 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 168 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 169 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15 |
| Nodule | 0 |
| Rhizoplane | 10 |
| Rhizosphere | 74.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10084436 | 3300002067 | Bacteria | 910 |
| 2 | JGI25407J50210_10010617 | 3300003373 | Bacteria | 2344 |
| 3 | JGI25407J50210_10023984 | 3300003373 | Bacteria | 1584 |
| 4 | Ga0070658_10140290 | 3300005327 | Bacteria | 2019 |
| 5 | Ga0070683_100666131 | 3300005329 | Bacteria | 996 |
| 6 | Ga0070680_100149994 | 3300005336 | Bacteria | 1957 |
| 7 | Ga0070682_100004047 | 3300005337 | Bacteria | 8147 |
| 8 | Ga0068868_100041017 | 3300005338 | Bacteria | 3605 |
| 9 | Ga0070660_100001949 | 3300005339 | Bacteria | 14232 |
| 10 | Ga0070689_100065571 | 3300005340 | Bacteria | 2828 |
| 11 | Ga0070689_100255999 | 3300005340 | Bacteria | 1446 |
| 12 | Ga0070687_100010852 | 3300005343 | Bacteria | 3962 |
| 13 | Ga0070692_10001505 | 3300005345 | Bacteria | 8522 |
| 14 | Ga0070668_100044355 | 3300005347 | Bacteria | 3412 |
| 15 | Ga0070675_100262864 | 3300005354 | Bacteria | 1513 |
| 16 | Ga0070674_100034589 | 3300005356 | Bacteria | 3376 |
| 17 | Ga0070674_100256285 | 3300005356 | Bacteria | 1376 |
| 18 | Ga0070673_100017467 | 3300005364 | Bacteria | 5103 |
| 19 | Ga0070667_100265737 | 3300005367 | Bacteria | 1537 |
| 20 | Ga0070710_10074345 | 3300005437 | Bacteria | 1967 |
| 21 | Ga0070701_10123947 | 3300005438 | Bacteria | 1460 |
| 22 | Ga0070711_100048314 | 3300005439 | Bacteria | 2908 |
| 23 | Ga0070705_100222476 | 3300005440 | Bacteria | 1308 |
| 24 | Ga0070694_100426372 | 3300005444 | Bacteria | 1043 |
| 25 | Ga0070708_101065318 | 3300005445 | Unclassified | 757 |
| 26 | Ga0070663_100004769 | 3300005455 | Bacteria | 8001 |
| 27 | Ga0070678_100079339 | 3300005456 | Bacteria | 2482 |
| 28 | Ga0070662_100642546 | 3300005457 | Bacteria | 895 |
| 29 | Ga0070681_10099144 | 3300005458 | Bacteria | 2860 |
| 30 | Ga0070679_100517529 | 3300005530 | Unclassified | 1137 |
| 31 | Ga0070684_100201786 | 3300005535 | Bacteria | 1811 |
| 32 | Ga0068853_100013382 | 3300005539 | Bacteria | 6696 |
| 33 | Ga0070672_100035366 | 3300005543 | Bacteria | 3797 |
| 34 | Ga0070695_100307432 | 3300005545 | Bacteria | 1174 |
| 35 | Ga0070695_100578061 | 3300005545 | Bacteria | 879 |
| 36 | Ga0070704_100005931 | 3300005549 | Bacteria | 7159 |
| 37 | Ga0070704_100091841 | 3300005549 | Bacteria | 2265 |
| 38 | Ga0070704_100128181 | 3300005549 | Bacteria | 1962 |
| 39 | Ga0070704_100254895 | 3300005549 | Bacteria | 1443 |
| 40 | Ga0070664_100034568 | 3300005564 | Bacteria | 4240 |
| 41 | Ga0070664_100781219 | 3300005564 | Bacteria | 892 |
| 42 | Ga0068857_100302000 | 3300005577 | Bacteria | 1476 |
| 43 | Ga0068854_100015455 | 3300005578 | Bacteria | 5056 |
| 44 | Ga0068856_100591480 | 3300005614 | Bacteria | 1131 |
| 45 | Ga0070702_100074619 | 3300005615 | Bacteria | 2013 |
| 46 | Ga0068852_100009283 | 3300005616 | Bacteria | 7293 |
| 47 | Ga0068859_100049805 | 3300005617 | Bacteria | 4208 |
| 48 | Ga0068864_100339675 | 3300005618 | Bacteria | 1415 |
| 49 | Ga0068866_10203648 | 3300005718 | Bacteria | 1184 |
| 50 | Ga0068861_100037043 | 3300005719 | Bacteria | 3625 |
| 51 | Ga0068858_100094558 | 3300005842 | Bacteria | 2784 |
| 52 | Ga0068860_100052875 | 3300005843 | Bacteria | 3863 |
| 53 | Ga0081455_10020866 | 3300005937 | Bacteria | 6157 |
| 54 | Ga0081455_10021029 | 3300005937 | Bacteria | 6127 |
| 55 | Ga0081455_10039757 | 3300005937 | Bacteria | 4153 |
| 56 | Ga0081455_10560019 | 3300005937 | Bacteria | 754 |
| 57 | Ga0081455_10590205 | 3300005937 | Bacteria | 726 |
| 58 | Ga0081538_10000044 | 3300005981 | Bacteria | 115394 |
| 59 | Ga0081538_10000227 | 3300005981 | Bacteria | 63237 |
| 60 | Ga0081538_10000766 | 3300005981 | Bacteria | 35083 |
| 61 | Ga0081540_1002481 | 3300005983 | Bacteria | 15029 |
| 62 | Ga0081540_1028063 | 3300005983 | Bacteria | 3171 |
| 63 | Ga0075365_10001623 | 3300006038 | Bacteria | 10380 |
| 64 | Ga0075365_10017361 | 3300006038 | Bacteria | 4401 |
| 65 | Ga0075365_10103401 | 3300006038 | Bacteria | 1952 |
| 66 | Ga0075365_10117722 | 3300006038 | Bacteria | 1830 |
| 67 | Ga0075365_10202905 | 3300006038 | Bacteria | 1389 |
| 68 | Ga0075368_10124582 | 3300006042 | Bacteria | 1069 |
| 69 | Ga0075363_100002266 | 3300006048 | Bacteria | 7795 |
| 70 | Ga0075363_100055263 | 3300006048 | Bacteria | 2126 |
| 71 | Ga0075363_100159885 | 3300006048 | Bacteria | 1275 |
| 72 | Ga0075363_100400344 | 3300006048 | Bacteria | 807 |
| 73 | Ga0075363_100564949 | 3300006048 | Unclassified | 679 |
| 74 | Ga0075364_10011875 | 3300006051 | Bacteria | 5305 |
| 75 | Ga0075364_10035797 | 3300006051 | Bacteria | 3208 |
| 76 | Ga0075364_10064960 | 3300006051 | Bacteria | 2395 |
| 77 | Ga0075364_10079993 | 3300006051 | Bacteria | 2160 |
| 78 | Ga0075364_10172150 | 3300006051 | Bacteria | 1464 |
| 79 | Ga0075364_10236131 | 3300006051 | Bacteria | 1242 |
| 80 | Ga0075364_10263951 | 3300006051 | Bacteria | 1171 |
| 81 | Ga0075364_10586055 | 3300006051 | Bacteria | 762 |
| 82 | Ga0075367_10103773 | 3300006178 | Bacteria | 1740 |
| 83 | Ga0075367_10162658 | 3300006178 | Bacteria | 1388 |
| 84 | Ga0075367_10373576 | 3300006178 | Bacteria | 901 |
| 85 | Ga0075431_100149253 | 3300006847 | Bacteria | 2408 |
| 86 | Ga0075434_100036511 | 3300006871 | Bacteria | 4861 |
| 87 | Ga0075434_100038871 | 3300006871 | Bacteria | 4715 |
| 88 | Ga0075429_100289166 | 3300006880 | Bacteria | 1435 |
| 89 | Ga0068865_100102670 | 3300006881 | Bacteria | 2096 |
| 90 | Ga0075436_100742572 | 3300006914 | Bacteria | 729 |
| 91 | Ga0097620_100049804 | 3300006931 | Bacteria | 4208 |
| 92 | Ga0111539_10008717 | 3300009094 | Bacteria | 12867 |
| 93 | Ga0111539_10244422 | 3300009094 | Bacteria | 2089 |
| 94 | Ga0105245_10001745 | 3300009098 | Bacteria | 19841 |
| 95 | Ga0105245_10063006 | 3300009098 | Bacteria | 3347 |
| 96 | Ga0114129_10046061 | 3300009147 | Bacteria | 6130 |
| 97 | Ga0114129_10236184 | 3300009147 | Bacteria | 2459 |
| 98 | Ga0114129_10365578 | 3300009147 | Bacteria | 1908 |
| 99 | Ga0105243_10005633 | 3300009148 | Bacteria | 9750 |
| 100 | Ga0105242_10251727 | 3300009176 | Bacteria | 1592 |
| 101 | Ga0105249_10142018 | 3300009553 | Bacteria | 2303 |
| 102 | Ga0105249_10258040 | 3300009553 | Bacteria | 1731 |
| 103 | Ga0105239_10050194 | 3300010375 | Bacteria | 4576 |
| 104 | Ga0105246_10129906 | 3300011119 | Bacteria | 1880 |
| 105 | Ga0105246_10579298 | 3300011119 | Bacteria | 966 |
| 106 | Ga0157372_10659369 | 3300013307 | Bacteria | 1218 |
| 107 | Ga0163163_10089859 | 3300014325 | Bacteria | 3084 |
| 108 | Ga0163163_10558418 | 3300014325 | Bacteria | 1207 |
| 109 | Ga0157380_10412464 | 3300014326 | Bacteria | 1285 |
| 110 | Ga0157377_10140837 | 3300014745 | Bacteria | 1482 |
| 111 | Ga0157379_10455355 | 3300014968 | Bacteria | 1182 |
| 112 | Ga0157379_10877439 | 3300014968 | Bacteria | 850 |
| 113 | Ga0207688_10006201 | 3300025901 | Bacteria | 6503 |
| 114 | Ga0207688_10017441 | 3300025901 | Bacteria | 3901 |
| 115 | Ga0207685_10279724 | 3300025905 | Bacteria | 818 |
| 116 | Ga0207645_10442162 | 3300025907 | Bacteria | 877 |
| 117 | Ga0207643_10048336 | 3300025908 | Bacteria | 2409 |
| 118 | Ga0207705_10108125 | 3300025909 | Bacteria | 2052 |
| 119 | Ga0207663_10333046 | 3300025916 | Bacteria | 1144 |
| 120 | Ga0207660_10145205 | 3300025917 | Bacteria | 1818 |
| 121 | Ga0207662_10239296 | 3300025918 | Bacteria | 1188 |
| 122 | Ga0207657_10004151 | 3300025919 | Bacteria | 15358 |
| 123 | Ga0207664_10428596 | 3300025929 | Bacteria | 1179 |
| 124 | Ga0207690_10009531 | 3300025932 | Bacteria | 5767 |
| 125 | Ga0207706_10009622 | 3300025933 | Bacteria | 8870 |
| 126 | Ga0207709_10007924 | 3300025935 | Bacteria | 5886 |
| 127 | Ga0207709_10451363 | 3300025935 | Bacteria | 994 |
| 128 | Ga0207669_10328131 | 3300025937 | Bacteria | 1174 |
| 129 | Ga0207704_10030160 | 3300025938 | Bacteria | 3037 |
| 130 | Ga0207691_10024601 | 3300025940 | Bacteria | 5664 |
| 131 | Ga0207689_10072254 | 3300025942 | Bacteria | 2834 |
| 132 | Ga0207651_10082879 | 3300025960 | Bacteria | 2317 |
| 133 | Ga0207712_10092981 | 3300025961 | Bacteria | 2224 |
| 134 | Ga0207677_10061041 | 3300026023 | Bacteria | 2609 |
| 135 | Ga0207703_10075012 | 3300026035 | Bacteria | 2802 |
| 136 | Ga0207639_10014004 | 3300026041 | Bacteria | 5627 |
| 137 | Ga0207678_10001442 | 3300026067 | Bacteria | 21840 |
| 138 | Ga0207708_10044071 | 3300026075 | Bacteria | 3399 |
| 139 | Ga0207702_11127491 | 3300026078 | Unclassified | 778 |
| 140 | Ga0207648_10086976 | 3300026089 | Bacteria | 2727 |
| 141 | Ga0207674_10256549 | 3300026116 | Bacteria | 1695 |
| 142 | Ga0207675_100032288 | 3300026118 | Bacteria | 4876 |
| 143 | Ga0207683_10095309 | 3300026121 | Bacteria | 2653 |
| 144 | Ga0207698_10028470 | 3300026142 | Bacteria | 3984 |
| 145 | Ga0207428_10023749 | 3300027907 | Bacteria | 5151 |
| 146 | Ga0268264_10128352 | 3300028381 | Bacteria | 2244 |
| 147 | Ga0307413_10083049 | 3300031824 | Bacteria | 2060 |
| 148 | Ga0307410_10060541 | 3300031852 | Bacteria | 2588 |
| 149 | Ga0307406_10019086 | 3300031901 | Bacteria | 4020 |
| 150 | Ga0307406_10131556 | 3300031901 | Bacteria | 1757 |
| 151 | Ga0307407_10020178 | 3300031903 | Bacteria | 3409 |
| 152 | Ga0307409_100203200 | 3300031995 | Bacteria | 1774 |
| 153 | Ga0307409_100426657 | 3300031995 | Bacteria | 1273 |
| 154 | Ga0307409_100503808 | 3300031995 | Bacteria | 1180 |
| 155 | Ga0307416_100046622 | 3300032002 | Bacteria | 3422 |
| 156 | Ga0307416_100647792 | 3300032002 | Bacteria | 1141 |
| 157 | Ga0307411_10057857 | 3300032005 | Bacteria | 2563 |
| 158 | Ga0307415_100143095 | 3300032126 | Bacteria | 1829 |
| 159 | Ga0316574_0107058 | 3300035398 | Bacteria | 1791 |
| 160 | Ga0316582_0445580 | 3300036647 | Bacteria | 892 |
| 161 | Ga0316584_0059219 | 3300036712 | Bacteria | 2868 |
| 162 | Ga0395899_0115701 | 3300037312 | Bacteria | 1924 |
| 163 | Ga0395900_0006898 | 3300037418 | Bacteria | 11786 |
| 164 | Ga0395898_0003404 | 3300037466 | Bacteria | 17816 |
| 165 | Ga0395898_0129048 | 3300037466 | Bacteria | 2422 |
| 166 | Ga0395898_0321843 | 3300037466 | Bacteria | 1475 |
| 167 | Ga0395898_0323938 | 3300037466 | Bacteria | 1470 |
| 168 | Ga0395905_0003834 | 3300037471 | Bacteria | 15880 |
| 169 | Ga0395905_0216371 | 3300037471 | Bacteria | 1794 |
| 170 | Ga0395905_0730722 | 3300037471 | Bacteria | 892 |
| 171 | Ga0395901_0009771 | 3300038443 | Bacteria | 9729 |
| 172 | Ga0395901_0024008 | 3300038443 | Bacteria | 6254 |
| 173 | Ga0395901_0059197 | 3300038443 | Bacteria | 3985 |
| 174 | Ga0395901_0325690 | 3300038443 | Bacteria | 1589 |
| 175 | Ga0395901_1408635 | 3300038443 | Bacteria | 655 |
| 176 | Ga0451853_2342927 | 3300041512 | Bacteria | 1280 |
| 177 | Ga0466960_0553155 | 3300044901 | Bacteria | 679 |
| 178 | Ga0495603_0125300 | 3300046455 | Bacteria | 1497 |
| 179 | Ga0495641_0051423 | 3300046461 | Bacteria | 1881 |
| 180 | Ga0495594_0113855 | 3300046499 | Bacteria | 1526 |
| 181 | Ga0495596_0084787 | 3300046500 | Bacteria | 1230 |
| 182 | Ga0495647_0190201 | 3300046681 | Bacteria | 897 |
| 183 | Ga0495658_0206902 | 3300046683 | Bacteria | 1225 |
| 184 | Ga0495670_0450926 | 3300046691 | Bacteria | 697 |
| 185 | Ga0495676_0027172 | 3300047321 | Bacteria | 4912 |
| 186 | Ga0495676_0440543 | 3300047321 | Bacteria | 860 |
| 187 | Ga0496100_0509455 | 3300048903 | Bacteria | 928 |
| 188 | Ga0496101_0087512 | 3300048904 | Bacteria | 2312 |
| 189 | Ga0496102_0007062 | 3300048905 | Bacteria | 9584 |
| 190 | Ga0496102_0149898 | 3300048905 | Bacteria | 2191 |
| 191 | Ga0496102_0342923 | 3300048905 | Bacteria | 1407 |
| 192 | Ga0496102_0394848 | 3300048905 | Bacteria | 1301 |
| 193 | Ga0496103_0070414 | 3300048906 | Bacteria | 2188 |
| 194 | Ga0496103_0128138 | 3300048906 | Unclassified | 1619 |
| 195 | Ga0496103_0175241 | 3300048906 | Bacteria | 1378 |
| 196 | Ga0496104_0035620 | 3300048907 | Bacteria | 4647 |
| 197 | Ga0496105_0072608 | 3300048908 | Bacteria | 2843 |
| 198 | Ga0496106_0007762 | 3300048909 | Bacteria | 7937 |
| 199 | Ga0496106_0114655 | 3300048909 | Bacteria | 2101 |
| 200 | Ga0496106_0617319 | 3300048909 | Bacteria | 868 |
| 201 | Ga0496107_0005248 | 3300048910 | Bacteria | 8843 |
| 202 | Ga0496107_0025050 | 3300048910 | Bacteria | 4223 |
| 203 | Ga0496107_0030243 | 3300048910 | Bacteria | 3860 |
| 204 | Ga0496107_0081295 | 3300048910 | Bacteria | 2363 |
| 205 | Ga0496108_0003439 | 3300048911 | Bacteria | 12699 |
| 206 | Ga0496108_0023877 | 3300048911 | Bacteria | 5033 |
| 207 | Ga0496109_0021561 | 3300048912 | Bacteria | 5698 |
| 208 | Ga0496109_0027376 | 3300048912 | Bacteria | 5089 |
| 209 | Ga0496109_0453837 | 3300048912 | Bacteria | 1211 |
| 210 | Ga0496109_0544086 | 3300048912 | Bacteria | 1095 |
| 211 | Ga0496110_0240696 | 3300048913 | Bacteria | 1647 |
| 212 | Ga0496110_0266805 | 3300048913 | Bacteria | 1558 |
| 213 | Ga0496110_0318597 | 3300048913 | Bacteria | 1416 |
| 214 | Ga0496111_0048031 | 3300048914 | Bacteria | 3074 |
| 215 | Ga0496112_0018011 | 3300048915 | Bacteria | 6647 |
| 216 | Ga0496114_0005917 | 3300048917 | Bacteria | 9614 |
| 217 | Ga0501036_0140439 | 3300049572 | Unclassified | 2038 |
| 218 | Ga0501036_0226765 | 3300049572 | Bacteria | 1568 |
| 219 | Ga0501036_0635225 | 3300049572 | Bacteria | 884 |
| 220 | Ga0501039_0168359 | 3300049575 | Bacteria | 1723 |
| 221 | Ga0501040_0027065 | 3300049576 | Bacteria | 3859 |
| 222 | Ga0501040_0469810 | 3300049576 | Unclassified | 906 |
| 223 | Ga0501041_0492105 | 3300049577 | Bacteria | 780 |
| 224 | Ga0501048_0064303 | 3300049582 | Bacteria | 2595 |
| 225 | Ga0501068_0055593 | 3300049584 | Bacteria | 2398 |
| 226 | Ga0501068_0130789 | 3300049584 | Bacteria | 1569 |
| 227 | Ga0501068_0177534 | 3300049584 | Bacteria | 1346 |
| 228 | Ga0501069_0573745 | 3300049585 | Bacteria | 676 |
| 229 | Ga0501070_0007774 | 3300049586 | Bacteria | 9088 |
| 230 | Ga0501070_0076713 | 3300049586 | Bacteria | 2766 |
| 231 | Ga0501070_0178984 | 3300049586 | Bacteria | 1745 |
| 232 | Ga0501071_0106315 | 3300049587 | Bacteria | 2072 |
| 233 | Ga0501071_0584560 | 3300049587 | Unclassified | 858 |
| 234 | Ga0501071_1473047 | 3300049587 | Bacteria | 525 |
| 235 | Ga0501072_0037832 | 3300049588 | Bacteria | 3784 |
| 236 | Ga0501072_0095604 | 3300049588 | Unclassified | 2361 |
| 237 | Ga0501072_0122072 | 3300049588 | Bacteria | 2076 |
| 238 | Ga0501072_0245670 | 3300049588 | Bacteria | 1426 |
| 239 | Ga0501074_0043829 | 3300049590 | Bacteria | 3238 |
| 240 | Ga0501074_0081686 | 3300049590 | Bacteria | 2318 |
| 241 | Ga0501074_0170424 | 3300049590 | Bacteria | 1554 |
| 242 | Ga0501075_0117343 | 3300049591 | Bacteria | 2023 |
| 243 | Ga0501075_0133051 | 3300049591 | Bacteria | 1895 |
| 244 | Ga0501075_0938418 | 3300049591 | Bacteria | 658 |
| 245 | Ga0501076_0097036 | 3300049592 | Bacteria | 2374 |
| 246 | Ga0501076_0471846 | 3300049592 | Bacteria | 1034 |
| 247 | Ga0501077_0083165 | 3300049593 | Bacteria | 2028 |
| 248 | Ga0501079_0027124 | 3300049741 | Bacteria | 4391 |
| 249 | Ga0501079_0289467 | 3300049741 | Bacteria | 1281 |
| 250 | Ga0501080_0014463 | 3300049742 | Bacteria | 7268 |
| 251 | Ga0501081_0011234 | 3300049743 | Bacteria | 5857 |
| 252 | Ga0501083_0100491 | 3300049744 | Bacteria | 1907 |
| 253 | Ga0501045_0039834 | 3300049824 | Bacteria | 3419 |
| 254 | Ga0501045_0534286 | 3300049824 | Bacteria | 870 |
| 255 | nmdc:mga03683_168531_c1 | 3300050489 | Bacteria | 994 |
| 256 | nmdc:mga03n38_26256_c1 | 3300050490 | Bacteria | 2403 |
| 257 | nmdc:mga03n38_40736_c1 | 3300050490 | Bacteria | 2020 |
| 258 | nmdc:mga03n38_507077_c1 | 3300050490 | Bacteria | 678 |
| 259 | nmdc:mga03n38_8627_c1 | 3300050490 | Bacteria | 3667 |
| 260 | nmdc:mga00v17_141668_c1 | 3300050491 | Bacteria | 1542 |
| 261 | nmdc:mga00v17_175230_c1 | 3300050491 | Bacteria | 1383 |
| 262 | nmdc:mga00v17_21582_c1 | 3300050491 | Bacteria | 3703 |
| 263 | nmdc:mga00v17_349726_c1 | 3300050491 | Bacteria | 961 |
| 264 | nmdc:mga00v17_58517_c1 | 3300050491 | Bacteria | 2361 |
| 265 | nmdc:mga00v17_73958_c1 | 3300050491 | Bacteria | 2117 |
| 266 | nmdc:mga00v17_82547_c1 | 3300050491 | Bacteria | 2009 |
| 267 | nmdc:mga00v17_98606_c1 | 3300050491 | Bacteria | 1843 |
| 268 | nmdc:mga0yw44_183650_c1 | 3300050492 | Bacteria | 1377 |
| 269 | nmdc:mga0yw44_2078_c1 | 3300050492 | Bacteria | 8360 |
| 270 | nmdc:mga0yw44_30009_c1 | 3300050492 | Bacteria | 3146 |
| 271 | nmdc:mga0yw44_48072_c1 | 3300050492 | Bacteria | 2571 |
| 272 | nmdc:mga0yw44_90810_c1 | 3300050492 | Bacteria | 1930 |
| 273 | nmdc:mga06z11_125120_c1 | 3300050494 | Bacteria | 1438 |
| 274 | nmdc:mga06z11_213421_c1 | 3300050494 | Bacteria | 1125 |
| 275 | nmdc:mga06z11_355007_c1 | 3300050494 | Bacteria | 878 |
| 276 | nmdc:mga04h51_217993_c1 | 3300050495 | Unclassified | 755 |
| 277 | nmdc:mga04h51_300330_c1 | 3300050495 | Bacteria | 654 |
| 278 | nmdc:mga05p37_109917_c1 | 3300050507 | Bacteria | 3391 |
| 279 | nmdc:mga05p37_115959_c1 | 3300050507 | Bacteria | 3292 |
| 280 | nmdc:mga05p37_157128_c1 | 3300050507 | Bacteria | 2778 |
| 281 | nmdc:mga05p37_284578_c1 | 3300050507 | Bacteria | 1970 |
| 282 | nmdc:mga0qj67_380463_c1 | 3300050509 | Bacteria | 1140 |
| 283 | nmdc:mga0qj67_414480_c1 | 3300050509 | Bacteria | 1086 |
| 284 | nmdc:mga06r32_205483_c1 | 3300050510 | Bacteria | 1958 |
| 285 | nmdc:mga06r32_34753_c1 | 3300050510 | Bacteria | 4754 |
| 286 | nmdc:mga08y16_172142_c1 | 3300050511 | Bacteria | 2249 |
| 287 | nmdc:mga08y16_387809_c1 | 3300050511 | Bacteria | 1431 |
| 288 | nmdc:mga0n895_39417_c1 | 3300050512 | Bacteria | 3825 |
| 289 | nmdc:mga0rr50_131699_c1 | 3300050513 | Bacteria | 2003 |
| 290 | nmdc:mga08x19_850891_c1 | 3300050514 | Bacteria | 648 |
| 291 | nmdc:mga0a205_71341_c1 | 3300050515 | Bacteria | 3355 |
| 292 | Ga0501084_0350422 | 3300054114 | Bacteria | 1247 |
| 293 | Ga0501084_0434802 | 3300054114 | Bacteria | 1109 |
| 294 | Ga0501084_0637344 | 3300054114 | Bacteria | 900 |
| 295 | Ga0501084_0719724 | 3300054114 | Bacteria | 841 |
| 296 | Ga0501082_0062691 | 3300060353 | Bacteria | 3201 |
| 297 | Ga0501082_0310522 | 3300060353 | Bacteria | 1373 |
| 298 | Ga0530510_0091880 | 3300061734 | Bacteria | 2215 |
| 299 | Ga0530510_0152087 | 3300061734 | Bacteria | 1709 |
| 300 | Ga0530510_0266760 | 3300061734 | Bacteria | 1277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0573745 | Ga0501069_0573745_165_665 | 161 |
| 2 | 3300049587 | Ga0501071_1473047 | Ga0501071_1473047_12_512 | 161 |
| 3 | 3300044901 | Ga0466960_0553155 | Ga0466960_0553155_160_663 | 167 |
| 4 | 3300050507 | nmdc:mga05p37_284578_c1 | nmdc:mga05p37_284578_c1_12_515 | 167 |
| 5 | 3300050509 | nmdc:mga0qj67_380463_c1 | nmdc:mga0qj67_380463_c1_11_517 | 167 |
| 6 | 3300050494 | nmdc:mga06z11_213421_c1 | nmdc:mga06z11_213421_c1_14_523 | 168 |
| 7 | 3300031824 | Ga0307413_10083049 | Ga0307413_100830493 | 171 |
| 8 | 3300031901 | Ga0307406_10019086 | Ga0307406_100190861 | 171 |
| 9 | 3300032002 | Ga0307416_100046622 | Ga0307416_1000466222 | 171 |
| 10 | 3300031852 | Ga0307410_10060541 | Ga0307410_100605414 | 178 |
| 11 | 3300031903 | Ga0307407_10020178 | Ga0307407_100201783 | 178 |
| 12 | 3300031995 | Ga0307409_100203200 | Ga0307409_1002032002 | 178 |
| 13 | 3300032005 | Ga0307411_10057857 | Ga0307411_100578574 | 178 |
| 14 | 3300032126 | Ga0307415_100143095 | Ga0307415_1001430952 | 178 |
| 15 | 3300050490 | nmdc:mga03n38_26256_c1 | nmdc:mga03n38_26256_c1_600_1154 | 181 |
| 16 | 3300005549 | Ga0070704_100128181 | Ga0070704_1001281812 | 182 |
| 17 | 3300048905 | Ga0496102_0394848 | Ga0496102_0394848_321_869 | 182 |
| 18 | 3300048906 | Ga0496103_0070414 | Ga0496103_0070414_387_935 | 182 |
| 19 | 3300048910 | Ga0496107_0025050 | Ga0496107_0025050_3478_4026 | 182 |
| 20 | 3300048912 | Ga0496109_0453837 | Ga0496109_0453837_535_1083 | 182 |
| 21 | 3300048912 | Ga0496109_0544086 | Ga0496109_0544086_521_1069 | 182 |
| 22 | 3300048913 | Ga0496110_0240696 | Ga0496110_0240696_687_1235 | 182 |
| 23 | 3300048914 | Ga0496111_0048031 | Ga0496111_0048031_2457_3005 | 182 |
| 24 | 3300037466 | Ga0395898_0323938 | Ga0395898_0323938_461_1057 | 183 |
| 25 | 3300038443 | Ga0395901_0009771 | Ga0395901_0009771_3335_3931 | 183 |
| 26 | 3300005937 | Ga0081455_10020866 | Ga0081455_100208662 | 186 |
| 27 | 3300050490 | nmdc:mga03n38_507077_c1 | nmdc:mga03n38_507077_c1_74_664 | 187 |
| 28 | 3300003373 | JGI25407J50210_10023984 | JGI25407J50210_100239841 | 189 |
| 29 | 3300005981 | Ga0081538_10000766 | Ga0081538_1000076613 | 189 |
| 30 | 3300005530 | Ga0070679_100517529 | Ga0070679_1005175292 | 190 |
| 31 | 3300046455 | Ga0495603_0125300 | Ga0495603_0125300_704_1276 | 190 |
| 32 | 3300047321 | Ga0495676_0440543 | Ga0495676_0440543_44_616 | 190 |
| 33 | 3300049591 | Ga0501075_0938418 | Ga0501075_0938418_53_628 | 191 |
| 34 | 3300003373 | JGI25407J50210_10010617 | JGI25407J50210_100106172 | 192 |
| 35 | 3300005340 | Ga0070689_100255999 | Ga0070689_1002559992 | 192 |
| 36 | 3300005367 | Ga0070667_100265737 | Ga0070667_1002657371 | 192 |
| 37 | 3300005437 | Ga0070710_10074345 | Ga0070710_100743453 | 192 |
| 38 | 3300005439 | Ga0070711_100048314 | Ga0070711_1000483142 | 192 |
| 39 | 3300005444 | Ga0070694_100426372 | Ga0070694_1004263722 | 192 |
| 40 | 3300005445 | Ga0070708_101065318 | Ga0070708_1010653181 | 192 |
| 41 | 3300005456 | Ga0070678_100079339 | Ga0070678_1000793392 | 192 |
| 42 | 3300005545 | Ga0070695_100307432 | Ga0070695_1003074322 | 192 |
| 43 | 3300005549 | Ga0070704_100005931 | Ga0070704_1000059318 | 192 |
| 44 | 3300005564 | Ga0070664_100781219 | Ga0070664_1007812191 | 192 |
| 45 | 3300005614 | Ga0068856_100591480 | Ga0068856_1005914802 | 192 |
| 46 | 3300005618 | Ga0068864_100339675 | Ga0068864_1003396752 | 192 |
| 47 | 3300005937 | Ga0081455_10039757 | Ga0081455_100397572 | 192 |
| 48 | 3300005937 | Ga0081455_10590205 | Ga0081455_105902052 | 192 |
| 49 | 3300005981 | Ga0081538_10000044 | Ga0081538_1000004411 | 192 |
| 50 | 3300006048 | Ga0075363_100159885 | Ga0075363_1001598852 | 192 |
| 51 | 3300006880 | Ga0075429_100289166 | Ga0075429_1002891662 | 192 |
| 52 | 3300009098 | Ga0105245_10001745 | Ga0105245_1000174510 | 192 |
| 53 | 3300011119 | Ga0105246_10579298 | Ga0105246_105792982 | 192 |
| 54 | 3300013307 | Ga0157372_10659369 | Ga0157372_106593692 | 192 |
| 55 | 3300014325 | Ga0163163_10558418 | Ga0163163_105584182 | 192 |
| 56 | 3300014968 | Ga0157379_10455355 | Ga0157379_104553552 | 192 |
| 57 | 3300025901 | Ga0207688_10017441 | Ga0207688_100174412 | 192 |
| 58 | 3300025905 | Ga0207685_10279724 | Ga0207685_102797241 | 192 |
| 59 | 3300025916 | Ga0207663_10333046 | Ga0207663_103330461 | 192 |
| 60 | 3300025929 | Ga0207664_10428596 | Ga0207664_104285962 | 192 |
| 61 | 3300026078 | Ga0207702_11127491 | Ga0207702_111274911 | 192 |
| 62 | 3300026121 | Ga0207683_10095309 | Ga0207683_100953092 | 192 |
| 63 | 3300046461 | Ga0495641_0051423 | Ga0495641_0051423_1107_1685 | 192 |
| 64 | 3300046499 | Ga0495594_0113855 | Ga0495594_0113855_20_598 | 192 |
| 65 | 3300046681 | Ga0495647_0190201 | Ga0495647_0190201_275_853 | 192 |
| 66 | 3300046683 | Ga0495658_0206902 | Ga0495658_0206902_85_663 | 192 |
| 67 | 3300047321 | Ga0495676_0027172 | Ga0495676_0027172_1439_2017 | 192 |
| 68 | 3300048904 | Ga0496101_0087512 | Ga0496101_0087512_1125_1703 | 192 |
| 69 | 3300048905 | Ga0496102_0007062 | Ga0496102_0007062_7134_7712 | 192 |
| 70 | 3300048906 | Ga0496103_0128138 | Ga0496103_0128138_797_1375 | 192 |
| 71 | 3300048907 | Ga0496104_0035620 | Ga0496104_0035620_1139_1717 | 192 |
| 72 | 3300048908 | Ga0496105_0072608 | Ga0496105_0072608_360_938 | 192 |
| 73 | 3300048909 | Ga0496106_0007762 | Ga0496106_0007762_2215_2793 | 192 |
| 74 | 3300048910 | Ga0496107_0005248 | Ga0496107_0005248_6186_6764 | 192 |
| 75 | 3300048911 | Ga0496108_0003439 | Ga0496108_0003439_9826_10404 | 192 |
| 76 | 3300048912 | Ga0496109_0027376 | Ga0496109_0027376_3845_4423 | 192 |
| 77 | 3300048913 | Ga0496110_0266805 | Ga0496110_0266805_353_931 | 192 |
| 78 | 3300048915 | Ga0496112_0018011 | Ga0496112_0018011_5703_6281 | 192 |
| 79 | 3300048917 | Ga0496114_0005917 | Ga0496114_0005917_7054_7632 | 192 |
| 80 | 3300050495 | nmdc:mga04h51_300330_c1 | nmdc:mga04h51_300330_c1_44_622 | 192 |
| 81 | 3300005356 | Ga0070674_100256285 | Ga0070674_1002562852 | 193 |
| 82 | 3300005545 | Ga0070695_100578061 | Ga0070695_1005780611 | 193 |
| 83 | 3300005549 | Ga0070704_100091841 | Ga0070704_1000918412 | 193 |
| 84 | 3300005549 | Ga0070704_100254895 | Ga0070704_1002548952 | 193 |
| 85 | 3300005937 | Ga0081455_10021029 | Ga0081455_100210294 | 193 |
| 86 | 3300005937 | Ga0081455_10560019 | Ga0081455_105600192 | 193 |
| 87 | 3300005981 | Ga0081538_10000227 | Ga0081538_1000022745 | 193 |
| 88 | 3300005983 | Ga0081540_1002481 | Ga0081540_100248116 | 193 |
| 89 | 3300005983 | Ga0081540_1028063 | Ga0081540_10280632 | 193 |
| 90 | 3300006038 | Ga0075365_10001623 | Ga0075365_1000162312 | 193 |
| 91 | 3300006038 | Ga0075365_10103401 | Ga0075365_101034012 | 193 |
| 92 | 3300006038 | Ga0075365_10202905 | Ga0075365_102029052 | 193 |
| 93 | 3300006042 | Ga0075368_10124582 | Ga0075368_101245822 | 193 |
| 94 | 3300006048 | Ga0075363_100564949 | Ga0075363_1005649491 | 193 |
| 95 | 3300006051 | Ga0075364_10011875 | Ga0075364_100118751 | 193 |
| 96 | 3300006051 | Ga0075364_10035797 | Ga0075364_100357971 | 193 |
| 97 | 3300006051 | Ga0075364_10064960 | Ga0075364_100649602 | 193 |
| 98 | 3300006051 | Ga0075364_10079993 | Ga0075364_100799932 | 193 |
| 99 | 3300006051 | Ga0075364_10172150 | Ga0075364_101721502 | 193 |
| 100 | 3300006051 | Ga0075364_10586055 | Ga0075364_105860552 | 193 |
| 101 | 3300006178 | Ga0075367_10103773 | Ga0075367_101037732 | 193 |
| 102 | 3300006178 | Ga0075367_10162658 | Ga0075367_101626582 | 193 |
| 103 | 3300006847 | Ga0075431_100149253 | Ga0075431_1001492532 | 193 |
| 104 | 3300006871 | Ga0075434_100036511 | Ga0075434_1000365115 | 193 |
| 105 | 3300006871 | Ga0075434_100038871 | Ga0075434_1000388713 | 193 |
| 106 | 3300006914 | Ga0075436_100742572 | Ga0075436_1007425721 | 193 |
| 107 | 3300009094 | Ga0111539_10244422 | Ga0111539_102444221 | 193 |
| 108 | 3300009147 | Ga0114129_10046061 | Ga0114129_100460613 | 193 |
| 109 | 3300009147 | Ga0114129_10236184 | Ga0114129_102361842 | 193 |
| 110 | 3300009147 | Ga0114129_10365578 | Ga0114129_103655782 | 193 |
| 111 | 3300009553 | Ga0105249_10142018 | Ga0105249_101420182 | 193 |
| 112 | 3300009553 | Ga0105249_10258040 | Ga0105249_102580402 | 193 |
| 113 | 3300014968 | Ga0157379_10877439 | Ga0157379_108774391 | 193 |
| 114 | 3300025935 | Ga0207709_10451363 | Ga0207709_104513631 | 193 |
| 115 | 3300025937 | Ga0207669_10328131 | Ga0207669_103281312 | 193 |
| 116 | 3300025961 | Ga0207712_10092981 | Ga0207712_100929812 | 193 |
| 117 | 3300031995 | Ga0307409_100426657 | Ga0307409_1004266571 | 193 |
| 118 | 3300037312 | Ga0395899_0115701 | Ga0395899_0115701_542_1132 | 193 |
| 119 | 3300037418 | Ga0395900_0006898 | Ga0395900_0006898_655_1245 | 193 |
| 120 | 3300037466 | Ga0395898_0003404 | Ga0395898_0003404_7592_8182 | 193 |
| 121 | 3300037466 | Ga0395898_0129048 | Ga0395898_0129048_594_1184 | 193 |
| 122 | 3300037466 | Ga0395898_0321843 | Ga0395898_0321843_581_1174 | 193 |
| 123 | 3300037471 | Ga0395905_0003834 | Ga0395905_0003834_1754_2344 | 193 |
| 124 | 3300037471 | Ga0395905_0216371 | Ga0395905_0216371_830_1420 | 193 |
| 125 | 3300037471 | Ga0395905_0730722 | Ga0395905_0730722_134_724 | 193 |
| 126 | 3300038443 | Ga0395901_0024008 | Ga0395901_0024008_1981_2571 | 193 |
| 127 | 3300038443 | Ga0395901_0059197 | Ga0395901_0059197_2697_3290 | 193 |
| 128 | 3300038443 | Ga0395901_0325690 | Ga0395901_0325690_987_1577 | 193 |
| 129 | 3300038443 | Ga0395901_1408635 | Ga0395901_1408635_54_638 | 193 |
| 130 | 3300041512 | Ga0451853_2342927 | Ga0451853_2342927_329_940 | 193 |
| 131 | 3300046500 | Ga0495596_0084787 | Ga0495596_0084787_384_971 | 193 |
| 132 | 3300046691 | Ga0495670_0450926 | Ga0495670_0450926_48_638 | 193 |
| 133 | 3300048905 | Ga0496102_0149898 | Ga0496102_0149898_137_721 | 193 |
| 134 | 3300048906 | Ga0496103_0175241 | Ga0496103_0175241_598_1182 | 193 |
| 135 | 3300048909 | Ga0496106_0617319 | Ga0496106_0617319_245_829 | 193 |
| 136 | 3300048910 | Ga0496107_0030243 | Ga0496107_0030243_47_631 | 193 |
| 137 | 3300049572 | Ga0501036_0140439 | Ga0501036_0140439_1385_1969 | 193 |
| 138 | 3300049572 | Ga0501036_0635225 | Ga0501036_0635225_289_873 | 193 |
| 139 | 3300049576 | Ga0501040_0027065 | Ga0501040_0027065_1202_1786 | 193 |
| 140 | 3300049576 | Ga0501040_0469810 | Ga0501040_0469810_302_886 | 193 |
| 141 | 3300049577 | Ga0501041_0492105 | Ga0501041_0492105_75_659 | 193 |
| 142 | 3300049582 | Ga0501048_0064303 | Ga0501048_0064303_1533_2117 | 193 |
| 143 | 3300049584 | Ga0501068_0055593 | Ga0501068_0055593_558_1142 | 193 |
| 144 | 3300049584 | Ga0501068_0177534 | Ga0501068_0177534_542_1126 | 193 |
| 145 | 3300049587 | Ga0501071_0584560 | Ga0501071_0584560_170_754 | 193 |
| 146 | 3300049588 | Ga0501072_0095604 | Ga0501072_0095604_1746_2330 | 193 |
| 147 | 3300049588 | Ga0501072_0122072 | Ga0501072_0122072_830_1414 | 193 |
| 148 | 3300049588 | Ga0501072_0245670 | Ga0501072_0245670_91_675 | 193 |
| 149 | 3300049590 | Ga0501074_0081686 | Ga0501074_0081686_575_1159 | 193 |
| 150 | 3300049590 | Ga0501074_0170424 | Ga0501074_0170424_375_962 | 193 |
| 151 | 3300049591 | Ga0501075_0133051 | Ga0501075_0133051_1151_1735 | 193 |
| 152 | 3300049592 | Ga0501076_0097036 | Ga0501076_0097036_1272_1856 | 193 |
| 153 | 3300049593 | Ga0501077_0083165 | Ga0501077_0083165_120_704 | 193 |
| 154 | 3300049741 | Ga0501079_0027124 | Ga0501079_0027124_3429_4013 | 193 |
| 155 | 3300049743 | Ga0501081_0011234 | Ga0501081_0011234_2901_3485 | 193 |
| 156 | 3300049824 | Ga0501045_0039834 | Ga0501045_0039834_1057_1641 | 193 |
| 157 | 3300049824 | Ga0501045_0534286 | Ga0501045_0534286_22_606 | 193 |
| 158 | 3300050489 | nmdc:mga03683_168531_c1 | nmdc:mga03683_168531_c1_186_794 | 193 |
| 159 | 3300050491 | nmdc:mga00v17_141668_c1 | nmdc:mga00v17_141668_c1_600_1208 | 193 |
| 160 | 3300050491 | nmdc:mga00v17_175230_c1 | nmdc:mga00v17_175230_c1_579_1184 | 193 |
| 161 | 3300050491 | nmdc:mga00v17_21582_c1 | nmdc:mga00v17_21582_c1_2953_3537 | 193 |
| 162 | 3300050491 | nmdc:mga00v17_73958_c1 | nmdc:mga00v17_73958_c1_1270_1893 | 193 |
| 163 | 3300050491 | nmdc:mga00v17_82547_c1 | nmdc:mga00v17_82547_c1_298_906 | 193 |
| 164 | 3300050491 | nmdc:mga00v17_98606_c1 | nmdc:mga00v17_98606_c1_1186_1794 | 193 |
| 165 | 3300050492 | nmdc:mga0yw44_183650_c1 | nmdc:mga0yw44_183650_c1_23_607 | 193 |
| 166 | 3300050492 | nmdc:mga0yw44_30009_c1 | nmdc:mga0yw44_30009_c1_143_727 | 193 |
| 167 | 3300050492 | nmdc:mga0yw44_90810_c1 | nmdc:mga0yw44_90810_c1_1019_1627 | 193 |
| 168 | 3300050494 | nmdc:mga06z11_125120_c1 | nmdc:mga06z11_125120_c1_599_1207 | 193 |
| 169 | 3300050494 | nmdc:mga06z11_355007_c1 | nmdc:mga06z11_355007_c1_56_664 | 193 |
| 170 | 3300050495 | nmdc:mga04h51_217993_c1 | nmdc:mga04h51_217993_c1_18_626 | 193 |
| 171 | 3300050507 | nmdc:mga05p37_109917_c1 | nmdc:mga05p37_109917_c1_652_1239 | 193 |
| 172 | 3300050507 | nmdc:mga05p37_115959_c1 | nmdc:mga05p37_115959_c1_2223_2807 | 193 |
| 173 | 3300050507 | nmdc:mga05p37_157128_c1 | nmdc:mga05p37_157128_c1_1169_1753 | 193 |
| 174 | 3300050509 | nmdc:mga0qj67_414480_c1 | nmdc:mga0qj67_414480_c1_470_1063 | 193 |
| 175 | 3300050510 | nmdc:mga06r32_205483_c1 | nmdc:mga06r32_205483_c1_152_739 | 193 |
| 176 | 3300050510 | nmdc:mga06r32_34753_c1 | nmdc:mga06r32_34753_c1_3882_4469 | 193 |
| 177 | 3300050511 | nmdc:mga08y16_172142_c1 | nmdc:mga08y16_172142_c1_1347_1934 | 193 |
| 178 | 3300050511 | nmdc:mga08y16_387809_c1 | nmdc:mga08y16_387809_c1_687_1271 | 193 |
| 179 | 3300050512 | nmdc:mga0n895_39417_c1 | nmdc:mga0n895_39417_c1_2161_2748 | 193 |
| 180 | 3300050513 | nmdc:mga0rr50_131699_c1 | nmdc:mga0rr50_131699_c1_1255_1839 | 193 |
| 181 | 3300050514 | nmdc:mga08x19_850891_c1 | nmdc:mga08x19_850891_c1_53_637 | 193 |
| 182 | 3300050515 | nmdc:mga0a205_71341_c1 | nmdc:mga0a205_71341_c1_167_751 | 193 |
| 183 | 3300054114 | Ga0501084_0350422 | Ga0501084_0350422_529_1113 | 193 |
| 184 | 3300054114 | Ga0501084_0434802 | Ga0501084_0434802_383_967 | 193 |
| 185 | 3300054114 | Ga0501084_0637344 | Ga0501084_0637344_207_791 | 193 |
| 186 | 3300054114 | Ga0501084_0719724 | Ga0501084_0719724_220_804 | 193 |
| 187 | 3300060353 | Ga0501082_0062691 | Ga0501082_0062691_627_1211 | 193 |
| 188 | 3300061734 | Ga0530510_0091880 | Ga0530510_0091880_189_770 | 193 |
| 189 | 3300061734 | Ga0530510_0152087 | Ga0530510_0152087_1090_1674 | 193 |
| 190 | 3300061734 | Ga0530510_0266760 | Ga0530510_0266760_118_702 | 193 |
| 191 | 3300002067 | JGI24735J21928_10084436 | JGI24735J21928_100844361 | 194 |
| 192 | 3300005327 | Ga0070658_10140290 | Ga0070658_101402902 | 194 |
| 193 | 3300005329 | Ga0070683_100666131 | Ga0070683_1006661311 | 194 |
| 194 | 3300005336 | Ga0070680_100149994 | Ga0070680_1001499942 | 194 |
| 195 | 3300005337 | Ga0070682_100004047 | Ga0070682_1000040476 | 194 |
| 196 | 3300005338 | Ga0068868_100041017 | Ga0068868_1000410174 | 194 |
| 197 | 3300005339 | Ga0070660_100001949 | Ga0070660_1000019494 | 194 |
| 198 | 3300005340 | Ga0070689_100065571 | Ga0070689_1000655713 | 194 |
| 199 | 3300005343 | Ga0070687_100010852 | Ga0070687_1000108522 | 194 |
| 200 | 3300005345 | Ga0070692_10001505 | Ga0070692_100015055 | 194 |
| 201 | 3300005347 | Ga0070668_100044355 | Ga0070668_1000443552 | 194 |
| 202 | 3300005354 | Ga0070675_100262864 | Ga0070675_1002628642 | 194 |
| 203 | 3300005356 | Ga0070674_100034589 | Ga0070674_1000345891 | 194 |
| 204 | 3300005364 | Ga0070673_100017467 | Ga0070673_1000174675 | 194 |
| 205 | 3300005438 | Ga0070701_10123947 | Ga0070701_101239472 | 194 |
| 206 | 3300005440 | Ga0070705_100222476 | Ga0070705_1002224762 | 194 |
| 207 | 3300005455 | Ga0070663_100004769 | Ga0070663_1000047692 | 194 |
| 208 | 3300005457 | Ga0070662_100642546 | Ga0070662_1006425461 | 194 |
| 209 | 3300005458 | Ga0070681_10099144 | Ga0070681_100991443 | 194 |
| 210 | 3300005535 | Ga0070684_100201786 | Ga0070684_1002017862 | 194 |
| 211 | 3300005539 | Ga0068853_100013382 | Ga0068853_1000133823 | 194 |
| 212 | 3300005543 | Ga0070672_100035366 | Ga0070672_1000353662 | 194 |
| 213 | 3300005564 | Ga0070664_100034568 | Ga0070664_1000345685 | 194 |
| 214 | 3300005577 | Ga0068857_100302000 | Ga0068857_1003020002 | 194 |
| 215 | 3300005578 | Ga0068854_100015455 | Ga0068854_1000154555 | 194 |
| 216 | 3300005615 | Ga0070702_100074619 | Ga0070702_1000746192 | 194 |
| 217 | 3300005616 | Ga0068852_100009283 | Ga0068852_1000092833 | 194 |
| 218 | 3300005617 | Ga0068859_100049805 | Ga0068859_1000498054 | 194 |
| 219 | 3300005718 | Ga0068866_10203648 | Ga0068866_102036482 | 194 |
| 220 | 3300005719 | Ga0068861_100037043 | Ga0068861_1000370434 | 194 |
| 221 | 3300005842 | Ga0068858_100094558 | Ga0068858_1000945583 | 194 |
| 222 | 3300005843 | Ga0068860_100052875 | Ga0068860_1000528752 | 194 |
| 223 | 3300006038 | Ga0075365_10017361 | Ga0075365_100173612 | 194 |
| 224 | 3300006038 | Ga0075365_10117722 | Ga0075365_101177222 | 194 |
| 225 | 3300006048 | Ga0075363_100002266 | Ga0075363_1000022667 | 194 |
| 226 | 3300006048 | Ga0075363_100055263 | Ga0075363_1000552632 | 194 |
| 227 | 3300006048 | Ga0075363_100400344 | Ga0075363_1004003441 | 194 |
| 228 | 3300006051 | Ga0075364_10236131 | Ga0075364_102361312 | 194 |
| 229 | 3300006051 | Ga0075364_10263951 | Ga0075364_102639512 | 194 |
| 230 | 3300006178 | Ga0075367_10373576 | Ga0075367_103735762 | 194 |
| 231 | 3300006881 | Ga0068865_100102670 | Ga0068865_1001026702 | 194 |
| 232 | 3300006931 | Ga0097620_100049804 | Ga0097620_1000498044 | 194 |
| 233 | 3300009094 | Ga0111539_10008717 | Ga0111539_100087179 | 194 |
| 234 | 3300009098 | Ga0105245_10063006 | Ga0105245_100630062 | 194 |
| 235 | 3300009148 | Ga0105243_10005633 | Ga0105243_100056337 | 194 |
| 236 | 3300009176 | Ga0105242_10251727 | Ga0105242_102517272 | 194 |
| 237 | 3300010375 | Ga0105239_10050194 | Ga0105239_100501944 | 194 |
| 238 | 3300011119 | Ga0105246_10129906 | Ga0105246_101299062 | 194 |
| 239 | 3300014325 | Ga0163163_10089859 | Ga0163163_100898592 | 194 |
| 240 | 3300014326 | Ga0157380_10412464 | Ga0157380_104124642 | 194 |
| 241 | 3300014745 | Ga0157377_10140837 | Ga0157377_101408372 | 194 |
| 242 | 3300025901 | Ga0207688_10006201 | Ga0207688_100062013 | 194 |
| 243 | 3300025907 | Ga0207645_10442162 | Ga0207645_104421621 | 194 |
| 244 | 3300025908 | Ga0207643_10048336 | Ga0207643_100483363 | 194 |
| 245 | 3300025909 | Ga0207705_10108125 | Ga0207705_101081252 | 194 |
| 246 | 3300025917 | Ga0207660_10145205 | Ga0207660_101452052 | 194 |
| 247 | 3300025918 | Ga0207662_10239296 | Ga0207662_102392961 | 194 |
| 248 | 3300025919 | Ga0207657_10004151 | Ga0207657_100041515 | 194 |
| 249 | 3300025932 | Ga0207690_10009531 | Ga0207690_100095312 | 194 |
| 250 | 3300025933 | Ga0207706_10009622 | Ga0207706_100096227 | 194 |
| 251 | 3300025935 | Ga0207709_10007924 | Ga0207709_100079246 | 194 |
| 252 | 3300025938 | Ga0207704_10030160 | Ga0207704_100301602 | 194 |
| 253 | 3300025940 | Ga0207691_10024601 | Ga0207691_100246014 | 194 |
| 254 | 3300025942 | Ga0207689_10072254 | Ga0207689_100722543 | 194 |
| 255 | 3300025960 | Ga0207651_10082879 | Ga0207651_100828792 | 194 |
| 256 | 3300026023 | Ga0207677_10061041 | Ga0207677_100610411 | 194 |
| 257 | 3300026035 | Ga0207703_10075012 | Ga0207703_100750122 | 194 |
| 258 | 3300026041 | Ga0207639_10014004 | Ga0207639_100140045 | 194 |
| 259 | 3300026067 | Ga0207678_10001442 | Ga0207678_1000144223 | 194 |
| 260 | 3300026075 | Ga0207708_10044071 | Ga0207708_100440712 | 194 |
| 261 | 3300026089 | Ga0207648_10086976 | Ga0207648_100869763 | 194 |
| 262 | 3300026116 | Ga0207674_10256549 | Ga0207674_102565492 | 194 |
| 263 | 3300026118 | Ga0207675_100032288 | Ga0207675_1000322882 | 194 |
| 264 | 3300026142 | Ga0207698_10028470 | Ga0207698_100284703 | 194 |
| 265 | 3300027907 | Ga0207428_10023749 | Ga0207428_100237495 | 194 |
| 266 | 3300028381 | Ga0268264_10128352 | Ga0268264_101283523 | 194 |
| 267 | 3300031901 | Ga0307406_10131556 | Ga0307406_101315562 | 194 |
| 268 | 3300031995 | Ga0307409_100503808 | Ga0307409_1005038082 | 194 |
| 269 | 3300032002 | Ga0307416_100647792 | Ga0307416_1006477922 | 194 |
| 270 | 3300035398 | Ga0316574_0107058 | Ga0316574_0107058_281_871 | 194 |
| 271 | 3300036647 | Ga0316582_0445580 | Ga0316582_0445580_199_783 | 194 |
| 272 | 3300036712 | Ga0316584_0059219 | Ga0316584_0059219_890_1480 | 194 |
| 273 | 3300048903 | Ga0496100_0509455 | Ga0496100_0509455_48_632 | 194 |
| 274 | 3300048905 | Ga0496102_0342923 | Ga0496102_0342923_385_969 | 194 |
| 275 | 3300048909 | Ga0496106_0114655 | Ga0496106_0114655_627_1211 | 194 |
| 276 | 3300048910 | Ga0496107_0081295 | Ga0496107_0081295_622_1206 | 194 |
| 277 | 3300048911 | Ga0496108_0023877 | Ga0496108_0023877_2060_2644 | 194 |
| 278 | 3300048912 | Ga0496109_0021561 | Ga0496109_0021561_4439_5023 | 194 |
| 279 | 3300048913 | Ga0496110_0318597 | Ga0496110_0318597_292_876 | 194 |
| 280 | 3300049572 | Ga0501036_0226765 | Ga0501036_0226765_494_1078 | 194 |
| 281 | 3300049575 | Ga0501039_0168359 | Ga0501039_0168359_193_777 | 194 |
| 282 | 3300049584 | Ga0501068_0130789 | Ga0501068_0130789_107_700 | 194 |
| 283 | 3300049586 | Ga0501070_0007774 | Ga0501070_0007774_6439_7038 | 194 |
| 284 | 3300049586 | Ga0501070_0076713 | Ga0501070_0076713_1124_1717 | 194 |
| 285 | 3300049586 | Ga0501070_0178984 | Ga0501070_0178984_1124_1714 | 194 |
| 286 | 3300049587 | Ga0501071_0106315 | Ga0501071_0106315_1066_1656 | 194 |
| 287 | 3300049588 | Ga0501072_0037832 | Ga0501072_0037832_1801_2394 | 194 |
| 288 | 3300049590 | Ga0501074_0043829 | Ga0501074_0043829_2120_2713 | 194 |
| 289 | 3300049591 | Ga0501075_0117343 | Ga0501075_0117343_749_1333 | 194 |
| 290 | 3300049592 | Ga0501076_0471846 | Ga0501076_0471846_236_820 | 194 |
| 291 | 3300049741 | Ga0501079_0289467 | Ga0501079_0289467_232_816 | 194 |
| 292 | 3300049742 | Ga0501080_0014463 | Ga0501080_0014463_2207_2800 | 194 |
| 293 | 3300049744 | Ga0501083_0100491 | Ga0501083_0100491_1117_1710 | 194 |
| 294 | 3300050490 | nmdc:mga03n38_40736_c1 | nmdc:mga03n38_40736_c1_1008_1598 | 194 |
| 295 | 3300050490 | nmdc:mga03n38_8627_c1 | nmdc:mga03n38_8627_c1_648_1232 | 194 |
| 296 | 3300050491 | nmdc:mga00v17_349726_c1 | nmdc:mga00v17_349726_c1_329_931 | 194 |
| 297 | 3300050491 | nmdc:mga00v17_58517_c1 | nmdc:mga00v17_58517_c1_1226_1810 | 194 |
| 298 | 3300050492 | nmdc:mga0yw44_2078_c1 | nmdc:mga0yw44_2078_c1_986_1570 | 194 |
| 299 | 3300050492 | nmdc:mga0yw44_48072_c1 | nmdc:mga0yw44_48072_c1_792_1391 | 194 |
| 300 | 3300060353 | Ga0501082_0310522 | Ga0501082_0310522_83_667 | 194 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pq7-assembly1.cif.gz_A-2 | crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution | 0.6025 | 7 | 163 |
| 6yvc-assembly4.cif.gz_D | crystal structure of the small alarmone hydrolase (sah) of pseudomonas aeruginosa | 0.5708 | 1 | 184 |
| 6yvc-assembly1.cif.gz_A | crystal structure of the small alarmone hydrolase (sah) of pseudomonas aeruginosa | 0.5625 | 1 | 184 |
| 4s1c-assembly3.cif.gz_A | crystal structure of l. monocytogenes phosphodiesterase pgph hd domain | 0.5608 | 9 | 184 |
| 7p1y-assembly2.cif.gz_CCC-2 | a small alarmone hydrolase tdactapo2 mutant - t78n | 0.5593 | 7 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ08_320_474_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7916 | 9 | 115 | 1.10.3210.10 |
| af_Q2G2T1_122_299_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7249 | 25 | 116 | 1.10.3210.10 |
| 5ihyB01 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like | 0.6504 | 1 | 97 | 1.10.472.50 |
| 5ihyB01 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like | 0.6342 | 1 | 97 | 1.10.472.50 |
| 3dtoA01 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like | 0.6158 | 1 | 99 | 1.10.472.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538L6I3-F1-model_v4 | HDIG domain-containing protein | 0.9954 | 5 | 187 |
|
| AF-A0A838PKQ8-F1-model_v4 | HDIG domain-containing protein | 0.9924 | 5 | 188 |
|
| AF-A0A6J4S6N2-F1-model_v4 | Lactate 2-monooxygenase (EC 1.13.12.4) | 0.9922 | 5 | 187 |
GO:0010181
GO:0050040 |
| AF-A0A832IMP2-F1-model_v4 | HDIG domain-containing protein | 0.9918 | 5 | 141 |
|
| AF-A0A7V9GT93-F1-model_v4 | HDIG domain-containing protein | 0.9907 | 4 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar