F395279

General Info

Members Datasets Scaffolds Average Seq Length
300 155 600 269

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100005249|Ga0068863_1000052494
Length 300
Sequence VFAIQSLTSLKRLVLFHGETTMKVLRTAFLLTALTLVLLVLGNAFGGPNGMKMALGFAVVMNAFAYFFSDKIALWSSGAKPVSREELPRLYEVMERLAAKANLPVPKLYIVPEAAPNAFATGRNPRHASVAVTQGLLQLMTDDELEGVIAHELSHVRNYDILISSIAATIAGAITYMARMGYWASLFGYGGSSRDNDRILAPIAALMLQLGISRQREYAADETGARMVGQPYGLISALQKLGAYNQRIPSSIPQSTAALCIVKPLFGGGVGSIFASLFSTHPPLDERIAALRQMTITREG

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
51 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
93 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5
Rhizosphere 94.33
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100005249 3300005841 Bacteria 12790
2 Ga0068869_100043405 3300005334 Bacteria 3229
3 Ga0070680_100045913 3300005336 Bacteria 3553
4 Ga0070703_10001358 3300005406 Bacteria 7417
5 Ga0070709_10008465 3300005434 Bacteria 5653
6 Ga0070709_10036401 3300005434 Bacteria 2998
7 Ga0070709_10288379 3300005434 Bacteria 1195
8 Ga0070714_100403195 3300005435 Bacteria 1293
9 Ga0070713_100045128 3300005436 Bacteria 3610
10 Ga0070713_100208048 3300005436 Bacteria 1770
11 Ga0070713_100428016 3300005436 Bacteria 1240
12 Ga0070713_100527681 3300005436 Unclassified 1116
13 Ga0070711_100047299 3300005439 Bacteria 2936
14 Ga0070711_100094968 3300005439 Bacteria 2157
15 Ga0070711_100108224 3300005439 Bacteria 2036
16 Ga0070711_100326402 3300005439 Unclassified 1228
17 Ga0070711_100334765 3300005439 Bacteria 1213
18 Ga0070705_100002232 3300005440 Bacteria 9829
19 Ga0070694_100001484 3300005444 Bacteria 13772
20 Ga0070708_100000117 3300005445 Bacteria 52877
21 Ga0070708_100033004 3300005445 Unclassified 4496
22 Ga0070708_100094578 3300005445 Bacteria 2727
23 Ga0070681_10181168 3300005458 Bacteria 2028
24 Ga0070706_100065698 3300005467 Bacteria 3355
25 Ga0070706_100282850 3300005467 Bacteria 1548
26 Ga0070707_100002191 3300005468 Bacteria 18669
27 Ga0070707_100014694 3300005468 Bacteria 7337
28 Ga0070707_100037672 3300005468 Bacteria 4616
29 Ga0070707_100042256 3300005468 Bacteria 4364
30 Ga0070707_100142454 3300005468 Bacteria 2333
31 Ga0070707_100161522 3300005468 Bacteria 2183
32 Ga0070707_100357680 3300005468 Bacteria 1418
33 Ga0070698_100001763 3300005471 Bacteria 24145
34 Ga0070698_100036248 3300005471 Bacteria 5097
35 Ga0070698_100038822 3300005471 Bacteria 4906
36 Ga0070699_100176677 3300005518 Unclassified 1894
37 Ga0070679_100011128 3300005530 Bacteria 8567
38 Ga0070697_100000409 3300005536 Bacteria 33067
39 Ga0070697_100001016 3300005536 Bacteria 21200
40 Ga0070697_100165174 3300005536 Bacteria 1872
41 Ga0070697_100337214 3300005536 Bacteria 1300
42 Ga0070697_100359595 3300005536 Unclassified 1258
43 Ga0068853_100278319 3300005539 Bacteria 1542
44 Ga0070686_100116121 3300005544 Bacteria 1831
45 Ga0070696_100000256 3300005546 Bacteria 32190
46 Ga0070693_100000011 3300005547 Bacteria 72890
47 Ga0070693_100021380 3300005547 Bacteria 3427
48 Ga0070665_100001777 3300005548 Bacteria 24558
49 Ga0070704_100001288 3300005549 Bacteria 13259
50 Ga0068858_100033602 3300005842 Bacteria 4758
51 Ga0068860_100006359 3300005843 Bacteria 11852
52 Ga0068860_100158218 3300005843 Bacteria 2184
53 Ga0070716_100023924 3300006173 Bacteria 3247
54 Ga0070716_100038515 3300006173 Bacteria 2648
55 Ga0070712_100006554 3300006175 Bacteria 7226
56 Ga0070712_100027881 3300006175 Bacteria 3774
57 Ga0097621_100112019 3300006237 Bacteria 2306
58 Ga0068871_100049422 3300006358 Bacteria 3399
59 Ga0068871_100177672 3300006358 Bacteria 1828
60 Ga0075428_100372150 3300006844 Bacteria 1532
61 Ga0075434_100100551 3300006871 Bacteria 2897
62 Ga0075434_100775536 3300006871 Bacteria 975
63 Ga0075436_100076104 3300006914 Bacteria 2324
64 Ga0075436_100227884 3300006914 Bacteria 1323
65 Ga0075435_100016961 3300007076 Bacteria 5499
66 Ga0075435_100021542 3300007076 Bacteria 4958
67 Ga0075435_100119304 3300007076 Bacteria 2200
68 Ga0075435_100268048 3300007076 Bacteria 1456
69 Ga0099794_10001781 3300007265 Bacteria 7680
70 Ga0099794_10011467 3300007265 Bacteria 3795
71 Ga0099794_10012389 3300007265 Bacteria 3679
72 Ga0099794_10013871 3300007265 Bacteria 3518
73 Ga0099794_10018028 3300007265 Bacteria 3158
74 Ga0099794_10038403 3300007265 Bacteria 2268
75 Ga0099794_10039670 3300007265 Bacteria 2236
76 Ga0099794_10057786 3300007265 Bacteria 1880
77 Ga0099794_10090556 3300007265 Bacteria 1517
78 Ga0099794_10151680 3300007265 Bacteria 1176
79 Ga0099795_10006547 3300007788 Unclassified 3186
80 Ga0105240_10017361 3300009093 Bacteria 9702
81 Ga0105240_10127376 3300009093 Bacteria 3058
82 Ga0105240_10160473 3300009093 Bacteria 2671
83 Ga0105245_10052468 3300009098 Bacteria 3657
84 Ga0105242_10408543 3300009176 Bacteria 1269
85 Ga0105248_10043892 3300009177 Bacteria 5014
86 Ga0105237_10084186 3300009545 Bacteria 3171
87 Ga0105249_10075950 3300009553 Bacteria 3113
88 Ga0105249_10469860 3300009553 Bacteria 1299
89 Ga0099796_10001666 3300010159 Bacteria 4601
90 Ga0105239_10074572 3300010375 Bacteria 3730
91 Ga0157370_10084928 3300013104 Bacteria 2974
92 Ga0157374_10003492 3300013296 Bacteria 13209
93 Ga0157374_10211496 3300013296 Bacteria 1901
94 Ga0157374_10284146 3300013296 Bacteria 1634
95 Ga0157378_10000262 3300013297 Bacteria 51559
96 Ga0157378_10000698 3300013297 Bacteria 31469
97 Ga0157378_10174267 3300013297 Bacteria 2020
98 Ga0157375_10255324 3300013308 Bacteria 1914
99 Ga0157376_10000060 3300014969 Bacteria 95745
100 Ga0157376_10005956 3300014969 Bacteria 8565
101 Ga0228598_1006882 3300024227 Bacteria 2335
102 Ga0207653_10002343 3300025885 Bacteria 6035
103 Ga0207642_10054351 3300025899 Bacteria 1826
104 Ga0207685_10021008 3300025905 Unclassified 2180
105 Ga0207685_10049363 3300025905 Bacteria 1616
106 Ga0207699_10006088 3300025906 Bacteria 5812
107 Ga0207695_10091932 3300025913 Bacteria 3046
108 Ga0207695_10189576 3300025913 Bacteria 1974
109 Ga0207695_10205535 3300025913 Bacteria 1882
110 Ga0207671_10046851 3300025914 Bacteria 3199
111 Ga0207693_10011714 3300025915 Bacteria 7093
112 Ga0207693_10018771 3300025915 Bacteria 5504
113 Ga0207693_10095347 3300025915 Bacteria 2332
114 Ga0207663_10030642 3300025916 Bacteria 3175
115 Ga0207660_10027074 3300025917 Bacteria 3909
116 Ga0207646_10000152 3300025922 Bacteria 95335
117 Ga0207646_10001515 3300025922 Bacteria 28609
118 Ga0207646_10003050 3300025922 Bacteria 19282
119 Ga0207646_10106116 3300025922 Bacteria 2520
120 Ga0207646_10255173 3300025922 Bacteria 1585
121 Ga0207687_10067869 3300025927 Bacteria 2538
122 Ga0207687_10320234 3300025927 Bacteria 1255
123 Ga0207700_10098538 3300025928 Bacteria 2326
124 Ga0207700_10193308 3300025928 Bacteria 1711
125 Ga0207700_10390996 3300025928 Bacteria 1217
126 Ga0207664_10530013 3300025929 Unclassified 1056
127 Ga0207709_10343986 3300025935 Bacteria 1123
128 Ga0207665_10000384 3300025939 Bacteria 30285
129 Ga0207665_10027201 3300025939 Bacteria 3779
130 Ga0207665_10051689 3300025939 Bacteria 2767
131 Ga0207665_10054959 3300025939 Bacteria 2685
132 Ga0207665_10121907 3300025939 Unclassified 1842
133 Ga0207665_10192512 3300025939 Bacteria 1482
134 Ga0207665_10369897 3300025939 Unclassified 1086
135 Ga0207711_10035596 3300025941 Bacteria 4221
136 Ga0207689_10097899 3300025942 Bacteria 2410
137 Ga0207712_10052165 3300025961 Bacteria 2864
138 Ga0207703_10040463 3300026035 Bacteria 3730
139 Ga0207641_10002916 3300026088 Bacteria 15490
140 Ga0207698_10748980 3300026142 Bacteria 976
141 Ga0209179_1012029 3300027512 Bacteria 1547
142 Ga0209588_1001308 3300027671 Bacteria 6474
143 Ga0209588_1006283 3300027671 Bacteria 3446
144 Ga0209588_1013591 3300027671 Unclassified 2484
145 Ga0209588_1033078 3300027671 Bacteria 1658
146 Ga0265354_1000435 3300028016 Bacteria 7280
147 Ga0268266_10000529 3300028379 Bacteria 53323
148 Ga0268264_10006263 3300028381 Bacteria 10038
149 Ga0268264_10279970 3300028381 Bacteria 1562
150 Ga0265338_10034535 3300028800 Bacteria 4885
151 Ga0265338_10039889 3300028800 Bacteria 4420
152 Ga0265770_1007982 3300030878 Bacteria 1500
153 Ga0265760_10014689 3300031090 Bacteria 2244
154 Ga0265320_10001947 3300031240 Bacteria 14572
155 Ga0265320_10134710 3300031240 Unclassified 1121
156 Ga0265325_10009061 3300031241 Bacteria 5840
157 Ga0265325_10014985 3300031241 Bacteria 4370
158 Ga0265325_10105607 3300031241 Unclassified 1374
159 Ga0265329_10000949 3300031242 Bacteria 14584
160 Ga0265331_10001914 3300031250 Bacteria 14585
161 Ga0265331_10066969 3300031250 Bacteria 1685
162 Ga0265316_10085500 3300031344 Unclassified 2413
163 Ga0265313_10005607 3300031595 Bacteria 9183
164 Ga0265313_10037211 3300031595 Bacteria 2436
165 Ga0265314_10046187 3300031711 Bacteria 3074
166 Ga0316576_10033779 3300031727 Bacteria 3644
167 Ga0316578_10239315 3300031728 Unclassified 1090
168 Ga0307412_10146643 3300031911 Bacteria 1736
169 Ga0307416_100003121 3300032002 Bacteria 9696
170 Ga0307415_100055159 3300032126 Bacteria 2717
171 Ga0316212_1005665 3300033547 Bacteria 1814
172 Ga0316212_1009506 3300033547 Bacteria 1396
173 Ga0373926_0036007 3300035083 Bacteria 1757
174 Ga0373954_0000101 3300035118 Bacteria 28794
175 Ga0373954_0053500 3300035118 Bacteria 1898
176 Ga0373956_0027022 3300035119 Bacteria 2489
177 Ga0373956_0027661 3300035119 Bacteria 2464
178 Ga0373956_0154607 3300035119 Bacteria 1080
179 Ga0373956_0176369 3300035119 Bacteria 1009
180 Ga0373957_0000537 3300035120 Bacteria 9590
181 Ga0373943_0032450 3300035170 Bacteria 2483
182 Ga0373946_0136564 3300035171 Bacteria 1133
183 Ga0373955_0000992 3300035172 Bacteria 12018
184 Ga0373955_0088412 3300035172 Bacteria 1762
185 Ga0373924_0082593 3300035410 Bacteria 1368
186 Ga0373924_0142712 3300035410 Bacteria 1045
187 Ga0373931_0182796 3300035691 Bacteria 1243
188 Ga0373931_0202988 3300035691 Bacteria 1185
189 Ga0373927_0004330 3300035695 Bacteria 9951
190 Ga0373927_0011828 3300035695 Bacteria 5813
191 Ga0373927_0055379 3300035695 Bacteria 2565
192 Ga0373933_0000334 3300035724 Bacteria 30278
193 Ga0373933_0001408 3300035724 Bacteria 14124
194 Ga0373947_0209787 3300035725 Bacteria 1277
195 Ga0373937_0000020 3300036401 Bacteria 131263
196 Ga0373937_0014779 3300036401 Bacteria 6893
197 Ga0373937_0082415 3300036401 Bacteria 2976
198 Ga0316584_0289605 3300036712 Bacteria 1188
199 Ga0373925_0006457 3300037068 Bacteria 8624
200 Ga0451577_0000290 3300042876 Bacteria 97706
201 Ga0451577_0224452 3300042876 Bacteria 1698
202 Ga0451577_0299773 3300042876 Bacteria 1456
203 Ga0453683_0016115 3300044673 Bacteria 4830
204 Ga0453683_0050347 3300044673 Unclassified 2610
205 Ga0453684_0000104 3300044712 Bacteria 365431
206 Ga0495603_0096410 3300046455 Bacteria 1728
207 Ga0495629_0235141 3300046459 Bacteria 1262
208 Ga0495651_0000223 3300046462 Bacteria 43261
209 Ga0495651_0016347 3300046462 Bacteria 5746
210 Ga0495651_0084329 3300046462 Bacteria 2394
211 Ga0495651_0226458 3300046462 Bacteria 1290
212 Ga0495653_0016534 3300046463 Bacteria 6004
213 Ga0495653_0040019 3300046463 Bacteria 3667
214 Ga0495653_0085248 3300046463 Bacteria 2325
215 Ga0495580_0003673 3300046472 Bacteria 13011
216 Ga0495580_0008715 3300046472 Bacteria 8039
217 Ga0495580_0293742 3300046472 Unclassified 1107
218 Ga0495664_0053347 3300046477 Bacteria 2404
219 Ga0495664_0180212 3300046477 Bacteria 1281
220 Ga0495608_0083710 3300046511 Bacteria 2070
221 Ga0495608_0128655 3300046511 Unclassified 1621
222 Ga0495628_0009597 3300046516 Bacteria 8261
223 Ga0495628_0133624 3300046516 Bacteria 1897
224 Ga0495630_0054467 3300046517 Bacteria 2997
225 Ga0495652_0029218 3300046529 Bacteria 4844
226 Ga0495652_0038697 3300046529 Bacteria 4130
227 Ga0495665_0144333 3300046531 Bacteria 1243
228 Ga0495640_0011849 3300046533 Bacteria 6688
229 Ga0495640_0151214 3300046533 Bacteria 1491
230 Ga0495587_0001958 3300046536 Bacteria 13726
231 Ga0495587_0045834 3300046536 Bacteria 2597
232 Ga0495645_0007866 3300046543 Bacteria 7417
233 Ga0495645_0009662 3300046543 Bacteria 6746
234 Ga0495645_0022595 3300046543 Bacteria 4551
235 Ga0495622_0074464 3300046557 Unclassified 1566
236 Ga0495667_0005999 3300046559 Bacteria 8216
237 Ga0495667_0024363 3300046559 Bacteria 4075
238 Ga0495667_0043440 3300046559 Bacteria 2978
239 Ga0495667_0073911 3300046559 Bacteria 2220
240 Ga0495667_0223958 3300046559 Bacteria 1200
241 Ga0495657_0002043 3300046675 Bacteria 17195
242 Ga0495657_0011005 3300046675 Bacteria 6785
243 Ga0495623_0000594 3300046679 Bacteria 24223
244 Ga0495646_0023937 3300046680 Bacteria 3845
245 Ga0495658_0020139 3300046683 Bacteria 3495
246 Ga0495658_0227111 3300046683 Bacteria 1170
247 Ga0495613_0216712 3300046689 Unclassified 1345
248 Ga0495613_0374757 3300046689 Bacteria 974
249 Ga0495600_0001156 3300046809 Bacteria 14402
250 Ga0495604_0002988 3300047317 Bacteria 13546
251 Ga0495604_0018862 3300047317 Bacteria 5524
252 Ga0495604_0031618 3300047317 Bacteria 4198
253 Ga0495674_0011925 3300047319 Bacteria 8195
254 Ga0495674_0029482 3300047319 Bacteria 4995
255 Ga0495674_0070500 3300047319 Bacteria 3020
256 Ga0495680_0000603 3300047322 Bacteria 40525
257 Ga0495675_0000035 3300047444 Bacteria 95152
258 Ga0495675_0018374 3300047444 Unclassified 4437
259 Ga0495675_0058927 3300047444 Unclassified 2435
260 Ga0495675_0121474 3300047444 Bacteria 1626
261 Ga0495684_0004578 3300047471 Bacteria 10805
262 Ga0495684_0012186 3300047471 Bacteria 6633
263 Ga0495684_0137523 3300047471 Bacteria 1833
264 Ga0495684_0195504 3300047471 Bacteria 1493
265 Ga0495684_0352516 3300047471 Bacteria 1044
266 Ga0495593_0002408 3300047673 Bacteria 11255
267 Ga0495602_0000417 3300048088 Bacteria 39873
268 Ga0495602_0011635 3300048088 Bacteria 9089
269 Ga0495602_0279414 3300048088 Bacteria 1231
270 Ga0495614_0047089 3300048089 Bacteria 1849
271 Ga0495614_0105205 3300048089 Bacteria 1236
272 Ga0496100_0143394 3300048903 Bacteria 1696
273 Ga0496100_0186003 3300048903 Bacteria 1505
274 Ga0496101_0193102 3300048904 Bacteria 1572
275 Ga0496102_0013035 3300048905 Bacteria 7196
276 Ga0496102_0748756 3300048905 Bacteria 900
277 Ga0496104_0017188 3300048907 Bacteria 6580
278 Ga0496104_0264321 3300048907 Bacteria 1633
279 Ga0496105_0326269 3300048908 Bacteria 1229
280 Ga0496106_0039576 3300048909 Bacteria 3531
281 Ga0496112_0177559 3300048915 Bacteria 2094
282 Ga0496112_0191498 3300048915 Bacteria 2007
283 Ga0496114_0265940 3300048917 Bacteria 1511
284 Ga0496115_0060303 3300048918 Bacteria 3057
285 Ga0496115_0070591 3300048918 Bacteria 2832
286 Ga0496115_0127989 3300048918 Bacteria 2092
287 nmdc:mga0n895_468022_c1 3300050512 Bacteria 1272
288 nmdc:mga0n895_739758_c1 3300050512 Bacteria 977
289 nmdc:mga0rr50_124410_c1 3300050513 Bacteria 2057
290 nmdc:mga0rr50_218769_c2 3300050513 Unclassified 1262
291 nmdc:mga0rr50_60779_c1 3300050513 Bacteria 2844
292 nmdc:mga0rr50_7376_c2 3300050513 Bacteria 4328
293 nmdc:mga08x19_27336_c1 3300050514 Bacteria 3567
294 nmdc:mga08x19_343_c1 3300050514 Bacteria 33683
295 nmdc:mga08x19_3973_c1 3300050514 Bacteria 8799
296 nmdc:mga0a205_119503_c1 3300050515 Bacteria 2534
297 Ga0495601_0029925 3300053077 Bacteria 3381
298 Ga0495612_0007416 3300053078 Bacteria 4481
299 Ga0495612_0074097 3300053078 Bacteria 1423
300 Ga0495612_0079815 3300053078 Bacteria 1374
301 Ga0068863_100005249
302 Ga0068869_100043405
303 Ga0070680_100045913
304 Ga0070703_10001358
305 Ga0070709_10008465
306 Ga0070709_10036401
307 Ga0070709_10288379
308 Ga0070714_100403195
309 Ga0070713_100045128
310 Ga0070713_100208048
311 Ga0070713_100428016
312 Ga0070713_100527681
313 Ga0070711_100047299
314 Ga0070711_100094968
315 Ga0070711_100108224
316 Ga0070711_100326402
317 Ga0070711_100334765
318 Ga0070705_100002232
319 Ga0070694_100001484
320 Ga0070708_100000117
321 Ga0070708_100033004
322 Ga0070708_100094578
323 Ga0070681_10181168
324 Ga0070706_100065698
325 Ga0070706_100282850
326 Ga0070707_100002191
327 Ga0070707_100014694
328 Ga0070707_100037672
329 Ga0070707_100042256
330 Ga0070707_100142454
331 Ga0070707_100161522
332 Ga0070707_100357680
333 Ga0070698_100001763
334 Ga0070698_100036248
335 Ga0070698_100038822
336 Ga0070699_100176677
337 Ga0070679_100011128
338 Ga0070697_100000409
339 Ga0070697_100001016
340 Ga0070697_100165174
341 Ga0070697_100337214
342 Ga0070697_100359595
343 Ga0068853_100278319
344 Ga0070686_100116121
345 Ga0070696_100000256
346 Ga0070693_100000011
347 Ga0070693_100021380
348 Ga0070665_100001777
349 Ga0070704_100001288
350 Ga0068858_100033602
351 Ga0068860_100006359
352 Ga0068860_100158218
353 Ga0070716_100023924
354 Ga0070716_100038515
355 Ga0070712_100006554
356 Ga0070712_100027881
357 Ga0097621_100112019
358 Ga0068871_100049422
359 Ga0068871_100177672
360 Ga0075428_100372150
361 Ga0075434_100100551
362 Ga0075434_100775536
363 Ga0075436_100076104
364 Ga0075436_100227884
365 Ga0075435_100016961
366 Ga0075435_100021542
367 Ga0075435_100119304
368 Ga0075435_100268048
369 Ga0099794_10001781
370 Ga0099794_10011467
371 Ga0099794_10012389
372 Ga0099794_10013871
373 Ga0099794_10018028
374 Ga0099794_10038403
375 Ga0099794_10039670
376 Ga0099794_10057786
377 Ga0099794_10090556
378 Ga0099794_10151680
379 Ga0099795_10006547
380 Ga0105240_10017361
381 Ga0105240_10127376
382 Ga0105240_10160473
383 Ga0105245_10052468
384 Ga0105242_10408543
385 Ga0105248_10043892
386 Ga0105237_10084186
387 Ga0105249_10075950
388 Ga0105249_10469860
389 Ga0099796_10001666
390 Ga0105239_10074572
391 Ga0157370_10084928
392 Ga0157374_10003492
393 Ga0157374_10211496
394 Ga0157374_10284146
395 Ga0157378_10000262
396 Ga0157378_10000698
397 Ga0157378_10174267
398 Ga0157375_10255324
399 Ga0157376_10000060
400 Ga0157376_10005956
401 Ga0228598_1006882
402 Ga0207653_10002343
403 Ga0207642_10054351
404 Ga0207685_10021008
405 Ga0207685_10049363
406 Ga0207699_10006088
407 Ga0207695_10091932
408 Ga0207695_10189576
409 Ga0207695_10205535
410 Ga0207671_10046851
411 Ga0207693_10011714
412 Ga0207693_10018771
413 Ga0207693_10095347
414 Ga0207663_10030642
415 Ga0207660_10027074
416 Ga0207646_10000152
417 Ga0207646_10001515
418 Ga0207646_10003050
419 Ga0207646_10106116
420 Ga0207646_10255173
421 Ga0207687_10067869
422 Ga0207687_10320234
423 Ga0207700_10098538
424 Ga0207700_10193308
425 Ga0207700_10390996
426 Ga0207664_10530013
427 Ga0207709_10343986
428 Ga0207665_10000384
429 Ga0207665_10027201
430 Ga0207665_10051689
431 Ga0207665_10054959
432 Ga0207665_10121907
433 Ga0207665_10192512
434 Ga0207665_10369897
435 Ga0207711_10035596
436 Ga0207689_10097899
437 Ga0207712_10052165
438 Ga0207703_10040463
439 Ga0207641_10002916
440 Ga0207698_10748980
441 Ga0209179_1012029
442 Ga0209588_1001308
443 Ga0209588_1006283
444 Ga0209588_1013591
445 Ga0209588_1033078
446 Ga0265354_1000435
447 Ga0268266_10000529
448 Ga0268264_10006263
449 Ga0268264_10279970
450 Ga0265338_10034535
451 Ga0265338_10039889
452 Ga0265770_1007982
453 Ga0265760_10014689
454 Ga0265320_10001947
455 Ga0265320_10134710
456 Ga0265325_10009061
457 Ga0265325_10014985
458 Ga0265325_10105607
459 Ga0265329_10000949
460 Ga0265331_10001914
461 Ga0265331_10066969
462 Ga0265316_10085500
463 Ga0265313_10005607
464 Ga0265313_10037211
465 Ga0265314_10046187
466 Ga0316576_10033779
467 Ga0316578_10239315
468 Ga0307412_10146643
469 Ga0307416_100003121
470 Ga0307415_100055159
471 Ga0316212_1005665
472 Ga0316212_1009506
473 Ga0373926_0036007
474 Ga0373954_0000101
475 Ga0373954_0053500
476 Ga0373956_0027022
477 Ga0373956_0027661
478 Ga0373956_0154607
479 Ga0373956_0176369
480 Ga0373957_0000537
481 Ga0373943_0032450
482 Ga0373946_0136564
483 Ga0373955_0000992
484 Ga0373955_0088412
485 Ga0373924_0082593
486 Ga0373924_0142712
487 Ga0373931_0182796
488 Ga0373931_0202988
489 Ga0373927_0004330
490 Ga0373927_0011828
491 Ga0373927_0055379
492 Ga0373933_0000334
493 Ga0373933_0001408
494 Ga0373947_0209787
495 Ga0373937_0000020
496 Ga0373937_0014779
497 Ga0373937_0082415
498 Ga0316584_0289605
499 Ga0373925_0006457
500 Ga0451577_0000290
501 Ga0451577_0224452
502 Ga0451577_0299773
503 Ga0453683_0016115
504 Ga0453683_0050347
505 Ga0453684_0000104
506 Ga0495603_0096410
507 Ga0495629_0235141
508 Ga0495651_0000223
509 Ga0495651_0016347
510 Ga0495651_0084329
511 Ga0495651_0226458
512 Ga0495653_0016534
513 Ga0495653_0040019
514 Ga0495653_0085248
515 Ga0495580_0003673
516 Ga0495580_0008715
517 Ga0495580_0293742
518 Ga0495664_0053347
519 Ga0495664_0180212
520 Ga0495608_0083710
521 Ga0495608_0128655
522 Ga0495628_0009597
523 Ga0495628_0133624
524 Ga0495630_0054467
525 Ga0495652_0029218
526 Ga0495652_0038697
527 Ga0495665_0144333
528 Ga0495640_0011849
529 Ga0495640_0151214
530 Ga0495587_0001958
531 Ga0495587_0045834
532 Ga0495645_0007866
533 Ga0495645_0009662
534 Ga0495645_0022595
535 Ga0495622_0074464
536 Ga0495667_0005999
537 Ga0495667_0024363
538 Ga0495667_0043440
539 Ga0495667_0073911
540 Ga0495667_0223958
541 Ga0495657_0002043
542 Ga0495657_0011005
543 Ga0495623_0000594
544 Ga0495646_0023937
545 Ga0495658_0020139
546 Ga0495658_0227111
547 Ga0495613_0216712
548 Ga0495613_0374757
549 Ga0495600_0001156
550 Ga0495604_0002988
551 Ga0495604_0018862
552 Ga0495604_0031618
553 Ga0495674_0011925
554 Ga0495674_0029482
555 Ga0495674_0070500
556 Ga0495680_0000603
557 Ga0495675_0000035
558 Ga0495675_0018374
559 Ga0495675_0058927
560 Ga0495675_0121474
561 Ga0495684_0004578
562 Ga0495684_0012186
563 Ga0495684_0137523
564 Ga0495684_0195504
565 Ga0495684_0352516
566 Ga0495593_0002408
567 Ga0495602_0000417
568 Ga0495602_0011635
569 Ga0495602_0279414
570 Ga0495614_0047089
571 Ga0495614_0105205
572 Ga0496100_0143394
573 Ga0496100_0186003
574 Ga0496101_0193102
575 Ga0496102_0013035
576 Ga0496102_0748756
577 Ga0496104_0017188
578 Ga0496104_0264321
579 Ga0496105_0326269
580 Ga0496106_0039576
581 Ga0496112_0177559
582 Ga0496112_0191498
583 Ga0496114_0265940
584 Ga0496115_0060303
585 Ga0496115_0070591
586 Ga0496115_0127989
587 nmdc:mga0n895_468022_c1
588 nmdc:mga0n895_739758_c1
589 nmdc:mga0rr50_124410_c1
590 nmdc:mga0rr50_218769_c2
591 nmdc:mga0rr50_60779_c1
592 nmdc:mga0rr50_7376_c2
593 nmdc:mga08x19_27336_c1
594 nmdc:mga08x19_343_c1
595 nmdc:mga08x19_3973_c1
596 nmdc:mga0a205_119503_c1
597 Ga0495601_0029925
598 Ga0495612_0007416
599 Ga0495612_0074097
600 Ga0495612_0079815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

84

295

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8475 69 137
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8143 52 137
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7008 52 137
4hx3-assembly1.cif.gz_A crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin 0.6602 66 135
6ait-assembly1.cif.gz_E crystal structure of e. coli bepa 0.6178 40 283
ID Description Score Start End Superfamily
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8965 58 146 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8695 58 146 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8679 59 147 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8506 59 147 3.30.2010.10
af_O53978_67_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8401 65 135 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A6B3I2P7-F1-model_v4 M48 family metalloprotease 0.949 51 139 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A528D7J6-F1-model_v4 Protease HtpX 0.9472 58 136 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A2R6AI78-F1-model_v4 Protease HtpX 0.9031 80 283 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A662VIQ5-F1-model_v4 Zinc metalloprotease HtpX 0.8975 31 120 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A2N0M2S6-F1-model_v4 Protease HtpX 0.8941 1 288 GO:0004222
GO:0005886
GO:0006508
GO:0046872

Map