F395248

General Info

Members Datasets Scaffolds Average Seq Length
300 260 132 232

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100710536|Ga0068867_1007105361
Length 248
Sequence MKMLAESVQRLTVLKPDPLPLREHLFDERAALASALAKAVAADLRGAIARRGKARLAVSGGSTPRAFLIELSKQTLDWAHVTVVPVDDRWVAPDHPRSNERLLRETLFQGAAAQAQLLPLRRPSPTPESALLPVLTQVSNEALPLDVVVLGMGGDGHTASFFPDADNLPALLDPASRRIVLPVHAPSGGEPRLTLSMARIIAAGFIALHIEGEDKLTAFEDAMGPGKHKPIRAVIDASPKPVEVFWAP

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
7 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
10 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
11 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
12 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
13 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
14 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
15 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
16 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
17 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
18 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
19 2738543024 Aminobacter sp. AP02 Isolate Unclassified
20 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
21 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
22 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
23 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
24 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
25 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
26 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
27 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
28 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
29 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
30 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
31 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
32 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
33 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
34 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
35 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
36 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
37 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
38 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
39 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
40 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
41 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
42 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
43 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
44 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
45 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
46 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
47 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
48 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
49 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
50 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
51 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
52 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
53 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
54 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
55 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
56 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
57 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
58 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
59 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
60 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
61 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
62 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
63 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
64 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
65 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
66 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
67 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
68 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
69 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
70 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
71 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
72 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
73 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
74 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
75 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
76 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
77 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
78 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
79 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
80 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
81 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
82 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
83 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
84 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
85 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
86 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
87 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
88 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
89 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
90 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
91 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
92 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
93 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
94 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
95 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
96 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
97 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
98 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
99 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
100 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
101 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
102 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
103 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
104 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
105 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
106 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
107 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
108 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
109 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
110 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
111 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
112 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
113 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
114 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
115 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
116 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
117 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
118 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
119 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
120 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
121 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
122 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
123 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
124 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
125 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
126 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
127 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
128 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
129 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
130 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
131 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
132 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
133 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
134 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
135 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
136 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
137 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
138 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
139 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
140 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
141 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
142 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
143 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
144 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
145 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
146 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
147 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
148 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
149 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
150 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
151 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
152 3004167301 Mesorhizobium loti 582 Isolate Unclassified
153 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
154 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
155 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
156 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
157 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
158 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
159 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
160 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
161 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
162 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
163 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
164 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
165 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
166 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
167 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
168 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
169 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
170 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
171 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
172 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
173 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
174 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
175 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
176 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
177 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
179 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
180 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
181 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
182 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
183 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
184 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
185 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
186 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
187 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
188 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
189 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
190 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
191 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
192 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
193 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
194 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
195 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
238 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
253 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
254 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
255 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
256 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
257 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
258 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
259 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
260 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44
Metatranscriptomes 0
Isolates 56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 44
Rhizoplane 1.67
Rhizosphere 31.67
Stem 0
Stem Tuber 0
Unclassified 12.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003623 3300001979 Bacteria 6738
2 JGI25156J39149_1003861 3300002705 Bacteria 4762
3 JGI25157J39369_1001862 3300002741 Bacteria 6494
4 JGI25406J46586_10008924 3300003203 Bacteria 4510
5 JGI25165J46597_1000020 3300003214 Bacteria 370477
6 Ga0055542_1000391 3300003762 Bacteria 44080
7 Ga0055542_1000549 3300003762 Bacteria 33335
8 Ga0055529_1002526 3300003763 Bacteria 3483
9 Ga0070658_10072714 3300005327 Bacteria 2818
10 Ga0070674_100361679 3300005356 Bacteria 1175
11 Ga0070659_100227549 3300005366 Bacteria 1540
12 Ga0070663_100008329 3300005455 Bacteria 6372
13 Ga0068867_100295414 3300005459 Bacteria 1334
14 Ga0068867_100710536 3300005459 Bacteria 888
15 Ga0068853_100095018 3300005539 Bacteria 2627
16 Ga0068853_100339871 3300005539 Bacteria 1395
17 Ga0070665_100401583 3300005548 Bacteria 1378
18 Ga0070665_100405187 3300005548 Bacteria 1372
19 Ga0068855_100523097 3300005563 Bacteria 1287
20 Ga0068856_100044870 3300005614 Bacteria 4350
21 Ga0068852_100384362 3300005616 Bacteria 1378
22 Ga0081539_10000646 3300005985 Bacteria 70179
23 Ga0075365_10002239 3300006038 Bacteria 9358
24 Ga0075365_10246177 3300006038 Bacteria 1256
25 Ga0075368_10058534 3300006042 Bacteria 1540
26 Ga0075363_100063199 3300006048 Bacteria 1997
27 Ga0075364_10008071 3300006051 Bacteria 6277
28 Ga0075364_10102730 3300006051 Bacteria 1903
29 Ga0075367_10005655 3300006178 Bacteria 6237
30 Ga0075367_10100647 3300006178 Bacteria 1766
31 Ga0075370_10022441 3300006353 Bacteria 3466
32 Ga0075370_10122389 3300006353 Bacteria 1515
33 Ga0105240_10171592 3300009093 Bacteria 2568
34 Ga0105240_10216862 3300009093 Bacteria 2232
35 Ga0105240_10342572 3300009093 Bacteria 1698
36 Ga0105241_10148112 3300009174 Bacteria 1917
37 Ga0105241_11102822 3300009174 Bacteria 747
38 Ga0105237_10009751 3300009545 Bacteria 10273
39 Ga0105238_10008795 3300009551 Bacteria 10104
40 Ga0105238_10222378 3300009551 Bacteria 1864
41 Ga0105239_10201524 3300010375 Bacteria 2230
42 Ga0157369_10066619 3300013105 Bacteria 3874
43 Ga0163162_10429574 3300013306 Bacteria 1453
44 Ga0163163_10204865 3300014325 Bacteria 2021
45 Ga0157380_10096393 3300014326 Bacteria 2452
46 Ga0157376_10464294 3300014969 Bacteria 1238
47 Ga0182006_1033746 3300015261 Bacteria 2050
48 Ga0209026_1000116 3300025250 Bacteria 133228
49 Ga0209148_1000256 3300025254 Bacteria 83479
50 Ga0209759_1000153 3300025256 Bacteria 119494
51 Ga0209233_1000047 3300025261 Bacteria 459614
52 Ga0209455_1000409 3300025272 Bacteria 34679
53 Ga0207647_10007366 3300025904 Bacteria 7953
54 Ga0207647_10035832 3300025904 Bacteria 3158
55 Ga0207705_10100017 3300025909 Bacteria 2133
56 Ga0207654_10185796 3300025911 Bacteria 1359
57 Ga0207695_10093730 3300025913 Bacteria 3012
58 Ga0207671_10019835 3300025914 Bacteria 5132
59 Ga0207657_10043729 3300025919 Bacteria 3943
60 Ga0207694_10294390 3300025924 Bacteria 1335
61 Ga0207690_10400756 3300025932 Bacteria 1094
62 Ga0207706_10355213 3300025933 Bacteria 1274
63 Ga0207669_10270113 3300025937 Bacteria 1277
64 Ga0207667_10451543 3300025949 Bacteria 1306
65 Ga0207667_10519247 3300025949 Bacteria 1206
66 Ga0207678_10309663 3300026067 Bacteria 1358
67 Ga0207648_10372487 3300026089 Bacteria 1290
68 Ga0207674_10013560 3300026116 Bacteria 9034
69 Ga0207674_10222970 3300026116 Bacteria 1833
70 Ga0207675_100509693 3300026118 Bacteria 1198
71 Ga0207698_10323214 3300026142 Bacteria 1446
72 Ga0268266_10045559 3300028379 Bacteria 3752
73 Ga0268266_10451630 3300028379 Bacteria 1222
74 Ga0268266_10560691 3300028379 Bacteria 1095
75 Ga0307412_10442495 3300031911 Bacteria 1069
76 Ga0395899_0000014 3300037312 Bacteria 488813
77 Ga0395899_0300702 3300037312 Bacteria 1086
78 Ga0395900_0000007 3300037418 Bacteria 488860
79 Ga0395900_0009990 3300037418 Bacteria 9714
80 Ga0395900_0110347 3300037418 Bacteria 2826
81 Ga0395898_0000011 3300037466 Bacteria 488860
82 Ga0395898_0060645 3300037466 Bacteria 3676
83 Ga0395905_0000008 3300037471 Bacteria 488860
84 Ga0395905_0096574 3300037471 Bacteria 2774
85 Ga0395905_0102677 3300037471 Bacteria 2684
86 Ga0395905_0271063 3300037471 Bacteria 1583
87 Ga0395901_0000048 3300038443 Bacteria 174069
88 Ga0395901_0067192 3300038443 Bacteria 3733
89 Ga0395901_0143881 3300038443 Bacteria 2506
90 Ga0395901_0594055 3300038443 Bacteria 1117
91 Ga0439465_0038650 3300041413 Bacteria 1538
92 Ga0439465_0046808 3300041413 Bacteria 1409
93 Ga0451807_1062988 3300041486 Bacteria 1378
94 Ga0439458_0017277 3300042157 Bacteria 1646
95 Ga0466960_0043419 3300044901 Bacteria 2138
96 Ga0495638_0034422 3300046460 Bacteria 3233
97 Ga0495638_0074230 3300046460 Bacteria 2075
98 Ga0495610_0095529 3300046512 Bacteria 1340
99 Ga0495597_0130277 3300046542 Bacteria 1044
100 Ga0495668_0095708 3300046616 Bacteria 1625
101 Ga0495625_0264703 3300046660 Bacteria 1111
102 Ga0495686_0077684 3300047472 Bacteria 2033
103 Ga0496110_0267200 3300048913 Bacteria 1557
104 Ga0496112_0038151 3300048915 Bacteria 4691
105 Ga0496115_0431632 3300048918 Bacteria 1066
106 Ga0496118_0124296 3300048921 Bacteria 1674
107 Ga0496119_0026859 3300048922 Bacteria 3978
108 Ga0496120_0000832 3300048923 Bacteria 44048
109 Ga0496125_0110717 3300048928 Bacteria 1990
110 Ga0501032_0242953 3300049569 Bacteria 1169
111 Ga0501033_0217574 3300049570 Bacteria 1361
112 Ga0501033_0227826 3300049570 Bacteria 1325
113 Ga0501034_0002846 3300049571 Bacteria 20161
114 Ga0501034_0066258 3300049571 Bacteria 3624
115 Ga0501034_0082915 3300049571 Bacteria 3208
116 Ga0501034_0248327 3300049571 Bacteria 1724
117 Ga0501047_0102255 3300049581 Bacteria 2745
118 Ga0501067_0044800 3300049583 Bacteria 2458
119 nmdc:mga03n38_73084_c1 3300050490 Bacteria 1592
120 nmdc:mga03n38_8747_c1 3300050490 Bacteria 3650
121 nmdc:mga00v17_116143_c1 3300050491 Bacteria 1701
122 nmdc:mga00v17_9240_c1 3300050491 Bacteria 5327
123 nmdc:mga0yw44_153580_c1 3300050492 Bacteria 1503
124 nmdc:mga0yw44_290121_c1 3300050492 Bacteria 1095
125 nmdc:mga04h51_46907_c1 3300050495 Bacteria 1434
126 nmdc:mga04h51_73946_c1 3300050495 Bacteria 1196
127 nmdc:mga07m45_8939_c1 3300050496 Bacteria 5172
128 Ga0500610_0096149 3300053079 Bacteria 1536
129 Ga0500568_0000205 3300053139 Bacteria 51687
130 Ga0500604_0148341 3300053151 Bacteria 795
131 Ga0500620_000132 3300053155 Bacteria 14878
132 Ga0500620_054823 3300053155 Bacteria 1345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10222970 Ga0207674_102229702 202
2 iso_pu_bacteria 2871444079 2871445657 202
3 3300041413 Ga0439465_0038650 Ga0439465_0038650_650_1345 210
4 iso_pu_bacteria 2937848649 2937850867 214
5 3300005539 Ga0068853_100095018 Ga0068853_1000950182 215
6 3300005616 Ga0068852_100384362 Ga0068852_1003843622 215
7 3300009093 Ga0105240_10171592 Ga0105240_101715923 215
8 3300009545 Ga0105237_10009751 Ga0105237_100097517 215
9 3300009551 Ga0105238_10008795 Ga0105238_100087952 215
10 3300013105 Ga0157369_10066619 Ga0157369_100666193 215
11 3300025904 Ga0207647_10007366 Ga0207647_100073666 215
12 3300025914 Ga0207671_10019835 Ga0207671_100198352 215
13 3300026142 Ga0207698_10323214 Ga0207698_103232142 215
14 3300037418 Ga0395900_0009990 Ga0395900_0009990_6957_7673 216
15 3300037471 Ga0395905_0096574 Ga0395905_0096574_1165_1881 216
16 3300038443 Ga0395901_0143881 Ga0395901_0143881_313_1029 216
17 3300044901 Ga0466960_0043419 Ga0466960_0043419_1383_2099 216
18 3300048922 Ga0496119_0026859 Ga0496119_0026859_344_1060 216
19 3300048923 Ga0496120_0000832 Ga0496120_0000832_13843_14559 216
20 3300003214 JGI25165J46597_1000020 JGI25165J46597_100002026 217
21 3300025261 Ga0209233_1000047 Ga0209233_1000047308 217
22 3300046460 Ga0495638_0034422 Ga0495638_0034422_1982_2704 217
23 3300037312 Ga0395899_0300702 Ga0395899_0300702_170_886 218
24 3300037471 Ga0395905_0271063 Ga0395905_0271063_78_794 218
25 3300049571 Ga0501034_0248327 Ga0501034_0248327_116_844 218
26 3300048921 Ga0496118_0124296 Ga0496118_0124296_245_961 219
27 3300049571 Ga0501034_0082915 Ga0501034_0082915_845_1555 219
28 3300049570 Ga0501033_0217574 Ga0501033_0217574_136_849 220
29 3300005356 Ga0070674_100361679 Ga0070674_1003616792 222
30 3300049569 Ga0501032_0242953 Ga0501032_0242953_415_1113 222
31 3300005539 Ga0068853_100339871 Ga0068853_1003398712 224
32 3300009174 Ga0105241_11102822 Ga0105241_111028221 224
33 3300025949 Ga0207667_10451543 Ga0207667_104515431 224
34 3300026116 Ga0207674_10013560 Ga0207674_100135606 224
35 3300049571 Ga0501034_0066258 Ga0501034_0066258_2143_2838 225
36 iso_pu_bacteria 2889790730 2889795725 226
37 iso_pu_bacteria 2889914905 2889916040 226
38 iso_pu_bacteria 2738543024 2739309629 227
39 iso_pu_bacteria 2869162929 2869166980 227
40 iso_pu_bacteria 2996336353 2996337615 227
41 iso_pu_bacteria 2643221551 2643778039 228
42 iso_pu_bacteria 2643221555 2643796487 228
43 iso_pu_bacteria 2856349417 2856350793 228
44 iso_pu_bacteria 2871488783 2871490096 228
45 iso_pu_bacteria 2878753008 2878753219 228
46 iso_pu_bacteria 2881155292 2881158451 228
47 iso_pu_bacteria 2881845957 2881847895 228
48 iso_pu_bacteria 2881853255 2881856201 228
49 iso_pu_bacteria 2881861095 2881866997 228
50 iso_pu_bacteria 2882912400 2882914676 228
51 iso_pu_bacteria 2885318864 2885320004 228
52 iso_pu_bacteria 2885342637 2885347874 228
53 iso_pu_bacteria 2885350715 2885352090 228
54 iso_pu_bacteria 2903492973 2903498017 228
55 iso_pu_bacteria 2924784321 2924791184 228
56 3300049581 Ga0501047_0102255 Ga0501047_0102255_116_805 229
57 iso_pu_bacteria 2513237305 2514419635 229
58 iso_pu_bacteria 2588253730 2588514322 229
59 iso_pu_bacteria 2643221550 2643773199 229
60 iso_pu_bacteria 2643221623 2644132479 229
61 iso_pu_bacteria 2844002411 2844004337 229
62 iso_pu_bacteria 2847670302 2847672635 229
63 iso_pu_bacteria 2847686936 2847691798 229
64 iso_pu_bacteria 2856314179 2856315142 229
65 iso_pu_bacteria 2856320880 2856328181 229
66 iso_pu_bacteria 2856364286 2856365914 229
67 iso_pu_bacteria 2857349434 2857353668 229
68 iso_pu_bacteria 2869278585 2869284284 229
69 iso_pu_bacteria 2869285874 2869286801 229
70 iso_pu_bacteria 2871429161 2871434065 229
71 iso_pu_bacteria 2871495908 2871502005 229
72 iso_pu_bacteria 2874102143 2874104644 229
73 iso_pu_bacteria 2874123672 2874125294 229
74 iso_pu_bacteria 2874139085 2874139253 229
75 iso_pu_bacteria 2874146452 2874147723 229
76 iso_pu_bacteria 2874155637 2874156641 229
77 iso_pu_bacteria 2874168670 2874170911 229
78 iso_pu_bacteria 2876363079 2876369178 229
79 iso_pu_bacteria 2876369609 2876373564 229
80 iso_pu_bacteria 2876377896 2876381051 229
81 iso_pu_bacteria 2876392853 2876393769 229
82 iso_pu_bacteria 2876413966 2876414785 229
83 iso_pu_bacteria 2878035449 2878042003 229
84 iso_pu_bacteria 2878738818 2878740100 229
85 iso_pu_bacteria 2878745973 2878746775 229
86 iso_pu_bacteria 2878760144 2878765758 229
87 iso_pu_bacteria 2878767105 2878772432 229
88 iso_pu_bacteria 2881147464 2881154688 229
89 iso_pu_bacteria 2882632389 2882634324 229
90 iso_pu_bacteria 2885326080 2885328985 229
91 iso_pu_bacteria 2885334103 2885341582 229
92 iso_pu_bacteria 2888337043 2888342472 229
93 iso_pu_bacteria 2888350351 2888351819 229
94 iso_pu_bacteria 2889010040 2889013795 229
95 iso_pu_bacteria 2889016732 2889021506 229
96 iso_pu_bacteria 2903448605 2903449386 229
97 iso_pu_bacteria 2903492973 2903498218 229
98 iso_pu_bacteria 2903521522 2903526354 229
99 iso_pu_bacteria 2903528002 2903529641 229
100 iso_pu_bacteria 2903540706 2903546704 229
101 iso_pu_bacteria 2904659560 2904660494 229
102 iso_pu_bacteria 2906308376 2906309155 229
103 iso_pu_bacteria 2906321335 2906326762 229
104 iso_pu_bacteria 2906328253 2906328717 229
105 iso_pu_bacteria 2906354277 2906356727 229
106 iso_pu_bacteria 2906414383 2906415139 229
107 iso_pu_bacteria 2922130491 2922134211 229
108 iso_pu_bacteria 2922158528 2922160775 229
109 iso_pu_bacteria 2922185730 2922189486 229
110 iso_pu_bacteria 2924726620 2924729716 229
111 iso_pu_bacteria 2924762789 2924767164 229
112 iso_pu_bacteria 2924776078 2924777699 229
113 iso_pu_bacteria 2937843397 2937845221 229
114 iso_pu_bacteria 2996310559 2996312884 229
115 iso_pu_bacteria 8002285264 8002288319 229
116 iso_pu_bacteria 2643221564 2643840356 230
117 3300031911 Ga0307412_10442495 Ga0307412_104424952 231
118 3300041413 Ga0439465_0046808 Ga0439465_0046808_279_974 231
119 3300003203 JGI25406J46586_10008924 JGI25406J46586_100089246 232
120 3300005548 Ga0070665_100405187 Ga0070665_1004051872 232
121 3300005985 Ga0081539_10000646 Ga0081539_1000064653 232
122 3300028379 Ga0268266_10560691 Ga0268266_105606912 232
123 3300037418 Ga0395900_0110347 Ga0395900_0110347_194_892 232
124 3300038443 Ga0395901_0067192 Ga0395901_0067192_1869_2567 232
125 3300049570 Ga0501033_0227826 Ga0501033_0227826_95_793 232
126 3300049571 Ga0501034_0002846 Ga0501034_0002846_18725_19423 232
127 3300053139 Ga0500568_0000205 Ga0500568_0000205_45687_46385 232
128 3300009551 Ga0105238_10222378 Ga0105238_102223782 233
129 3300010375 Ga0105239_10201524 Ga0105239_102015242 233
130 3300046660 Ga0495625_0264703 Ga0495625_0264703_396_1097 233
131 3300049583 Ga0501067_0044800 Ga0501067_0044800_36_737 233
132 iso_pu_bacteria 2961127735 2961136510 233
133 iso_pu_bacteria 2968003550 2968005228 233
134 iso_pu_bacteria 2970503327 2970509716 233
135 iso_pu_bacteria 2977828996 2977836183 233
136 iso_pu_bacteria 2979808191 2979814503 233
137 iso_pu_bacteria 8004374579 8004374790 233
138 3300005455 Ga0070663_100008329 Ga0070663_1000083295 234
139 3300005548 Ga0070665_100401583 Ga0070665_1004015832 234
140 3300028379 Ga0268266_10045559 Ga0268266_100455594 234
141 iso_pu_bacteria 2503198000 2503200571 234
142 iso_pu_bacteria 2509276022 2509395358 234
143 iso_pu_bacteria 2512875016 2512928779 234
144 iso_pu_bacteria 2512875024 2512963522 234
145 iso_pu_bacteria 2513237090 2513612381 234
146 iso_pu_bacteria 2513237164 2514038205 234
147 iso_pu_bacteria 2599185301 2599940594 234
148 iso_pu_bacteria 2643221595 2643989869 234
149 iso_pu_bacteria 2643221627 2644153521 234
150 iso_pu_bacteria 2693429783 2694629169 234
151 iso_pu_bacteria 2693429784 2694636917 234
152 iso_pu_bacteria 2791355123 2792750136 234
153 iso_pu_bacteria 2881161766 2881164101 234
154 iso_pu_bacteria 2885305155 2885308805 234
155 iso_pu_bacteria 2937813078 2937813986 234
156 iso_pu_bacteria 2937822353 2937828740 234
157 iso_pu_bacteria 2937891427 2937892373 234
158 iso_pu_bacteria 2937994558 2938000563 234
159 iso_pu_bacteria 2938014810 2938018367 234
160 iso_pu_bacteria 2958034702 2958038382 234
161 iso_pu_bacteria 2958041894 2958044877 234
162 iso_pu_bacteria 2958041894 2958055992 234
163 iso_pu_bacteria 2958064165 2958066473 234
164 iso_pu_bacteria 2958084443 2958091195 234
165 iso_pu_bacteria 2958092219 2958097314 234
166 iso_pu_bacteria 2958100919 2958102268 234
167 iso_pu_bacteria 2958115193 2958121434 234
168 iso_pu_bacteria 2958130278 2958131205 234
169 iso_pu_bacteria 2958144490 2958147885 234
170 iso_pu_bacteria 2958165035 2958170934 234
171 iso_pu_bacteria 2958172287 2958177838 234
172 iso_pu_bacteria 2958179912 2958180604 234
173 iso_pu_bacteria 2961077736 2961078438 234
174 iso_pu_bacteria 2961114664 2961120816 234
175 iso_pu_bacteria 2961163497 2961169378 234
176 iso_pu_bacteria 2963644680 2963650454 234
177 iso_pu_bacteria 2965018300 2965023630 234
178 iso_pu_bacteria 2965062239 2965062627 234
179 iso_pu_bacteria 2965119406 2965123516 234
180 iso_pu_bacteria 2968016561 2968021313 234
181 iso_pu_bacteria 2968083720 2968085627 234
182 iso_pu_bacteria 2968091066 2968095253 234
183 iso_pu_bacteria 2968097103 2968101224 234
184 iso_pu_bacteria 2968110612 2968111553 234
185 iso_pu_bacteria 2968117919 2968120225 234
186 iso_pu_bacteria 2968128360 2968128628 234
187 iso_pu_bacteria 2968171901 2968177768 234
188 iso_pu_bacteria 2970469710 2970476418 234
189 iso_pu_bacteria 2970489779 2970493857 234
190 iso_pu_bacteria 2970554993 2970560614 234
191 iso_pu_bacteria 2970593180 2970598900 234
192 iso_pu_bacteria 2977843712 2977845311 234
193 iso_pu_bacteria 2977858184 2977862281 234
194 iso_pu_bacteria 2977864932 2977865336 234
195 iso_pu_bacteria 2977922695 2977923843 234
196 iso_pu_bacteria 2977942078 2977949889 234
197 iso_pu_bacteria 2977971508 2977972417 234
198 iso_pu_bacteria 2977986579 2977990000 234
199 iso_pu_bacteria 2979742915 2979749338 234
200 iso_pu_bacteria 2979779861 2979780495 234
201 iso_pu_bacteria 2987636660 2987642919 234
202 iso_pu_bacteria 2987652177 2987654511 234
203 iso_pu_bacteria 2987659509 2987665644 234
204 iso_pu_bacteria 2987666974 2987671091 234
205 iso_pu_bacteria 2996341866 2996343048 234
206 iso_pu_bacteria 2996348954 2996356380 234
207 iso_pu_bacteria 3000135777 3000142398 234
208 iso_pu_bacteria 3004167301 3004172316 234
209 iso_pu_bacteria 3004188549 3004194566 234
210 iso_pu_bacteria 3004203850 3004210712 234
211 iso_pu_bacteria 3004211236 3004213281 234
212 iso_pu_bacteria 3004218560 3004221353 234
213 iso_pu_bacteria 3004275668 3004282684 234
214 iso_pu_bacteria 3004289098 3004289713 234
215 iso_pu_bacteria 3004334049 3004338345 234
216 iso_pu_bacteria 637000159 637078477 234
217 iso_pu_bacteria 8004387939 8004388085 234
218 iso_pu_bacteria 8004445564 8004447221 234
219 iso_pu_bacteria 8004703790 8004713167 234
220 iso_pu_bacteria 8004714634 8004715412 234
221 3300005459 Ga0068867_100295414 Ga0068867_1002954142 237
222 3300026089 Ga0207648_10372487 Ga0207648_103724872 237
223 3300001979 JGI24740J21852_10003623 JGI24740J21852_100036233 238
224 3300002705 JGI25156J39149_1003861 JGI25156J39149_10038613 238
225 3300002741 JGI25157J39369_1001862 JGI25157J39369_10018625 238
226 3300003762 Ga0055542_1000391 Ga0055542_100039122 238
227 3300003762 Ga0055542_1000549 Ga0055542_100054928 238
228 3300003763 Ga0055529_1002526 Ga0055529_10025262 238
229 3300005327 Ga0070658_10072714 Ga0070658_100727142 238
230 3300005366 Ga0070659_100227549 Ga0070659_1002275492 238
231 3300005459 Ga0068867_100710536 Ga0068867_1007105361 238
232 3300005563 Ga0068855_100523097 Ga0068855_1005230972 238
233 3300005614 Ga0068856_100044870 Ga0068856_1000448702 238
234 3300006038 Ga0075365_10002239 Ga0075365_100022392 238
235 3300006038 Ga0075365_10246177 Ga0075365_102461772 238
236 3300006042 Ga0075368_10058534 Ga0075368_100585342 238
237 3300006048 Ga0075363_100063199 Ga0075363_1000631992 238
238 3300006051 Ga0075364_10008071 Ga0075364_100080712 238
239 3300006051 Ga0075364_10102730 Ga0075364_101027302 238
240 3300006178 Ga0075367_10005655 Ga0075367_100056552 238
241 3300006178 Ga0075367_10100647 Ga0075367_101006472 238
242 3300006353 Ga0075370_10022441 Ga0075370_100224413 238
243 3300006353 Ga0075370_10122389 Ga0075370_101223892 238
244 3300009093 Ga0105240_10216862 Ga0105240_102168622 238
245 3300009093 Ga0105240_10342572 Ga0105240_103425722 238
246 3300009174 Ga0105241_10148112 Ga0105241_101481122 238
247 3300013306 Ga0163162_10429574 Ga0163162_104295742 238
248 3300014325 Ga0163163_10204865 Ga0163163_102048652 238
249 3300014326 Ga0157380_10096393 Ga0157380_100963932 238
250 3300014969 Ga0157376_10464294 Ga0157376_104642942 238
251 3300015261 Ga0182006_1033746 Ga0182006_10337462 238
252 3300025250 Ga0209026_1000116 Ga0209026_100011672 238
253 3300025254 Ga0209148_1000256 Ga0209148_100025626 238
254 3300025256 Ga0209759_1000153 Ga0209759_100015352 238
255 3300025272 Ga0209455_1000409 Ga0209455_10004094 238
256 3300025904 Ga0207647_10035832 Ga0207647_100358322 238
257 3300025909 Ga0207705_10100017 Ga0207705_101000172 238
258 3300025911 Ga0207654_10185796 Ga0207654_101857962 238
259 3300025913 Ga0207695_10093730 Ga0207695_100937302 238
260 3300025919 Ga0207657_10043729 Ga0207657_100437292 238
261 3300025924 Ga0207694_10294390 Ga0207694_102943902 238
262 3300025932 Ga0207690_10400756 Ga0207690_104007562 238
263 3300025933 Ga0207706_10355213 Ga0207706_103552132 238
264 3300025937 Ga0207669_10270113 Ga0207669_102701132 238
265 3300025949 Ga0207667_10519247 Ga0207667_105192471 238
266 3300026067 Ga0207678_10309663 Ga0207678_103096632 238
267 3300026118 Ga0207675_100509693 Ga0207675_1005096932 238
268 3300028379 Ga0268266_10451630 Ga0268266_104516301 238
269 3300037312 Ga0395899_0000014 Ga0395899_0000014_119994_120719 238
270 3300037418 Ga0395900_0000007 Ga0395900_0000007_120013_120738 238
271 3300037466 Ga0395898_0000011 Ga0395898_0000011_368123_368848 238
272 3300037466 Ga0395898_0060645 Ga0395898_0060645_2056_2772 238
273 3300037471 Ga0395905_0000008 Ga0395905_0000008_120013_120738 238
274 3300037471 Ga0395905_0102677 Ga0395905_0102677_1931_2647 238
275 3300038443 Ga0395901_0000048 Ga0395901_0000048_53332_54057 238
276 3300038443 Ga0395901_0594055 Ga0395901_0594055_144_860 238
277 3300041486 Ga0451807_1062988 Ga0451807_1062988_298_1014 238
278 3300042157 Ga0439458_0017277 Ga0439458_0017277_33_749 238
279 3300046460 Ga0495638_0074230 Ga0495638_0074230_669_1385 238
280 3300046512 Ga0495610_0095529 Ga0495610_0095529_166_882 238
281 3300046542 Ga0495597_0130277 Ga0495597_0130277_175_891 238
282 3300046616 Ga0495668_0095708 Ga0495668_0095708_724_1440 238
283 3300047472 Ga0495686_0077684 Ga0495686_0077684_818_1534 238
284 3300048913 Ga0496110_0267200 Ga0496110_0267200_216_932 238
285 3300048915 Ga0496112_0038151 Ga0496112_0038151_3189_3905 238
286 3300048918 Ga0496115_0431632 Ga0496115_0431632_300_1016 238
287 3300048928 Ga0496125_0110717 Ga0496125_0110717_507_1223 238
288 3300050490 nmdc:mga03n38_73084_c1 nmdc:mga03n38_73084_c1_44_760 238
289 3300050490 nmdc:mga03n38_8747_c1 nmdc:mga03n38_8747_c1_2438_3154 238
290 3300050491 nmdc:mga00v17_116143_c1 nmdc:mga00v17_116143_c1_597_1313 238
291 3300050491 nmdc:mga00v17_9240_c1 nmdc:mga00v17_9240_c1_2183_2899 238
292 3300050492 nmdc:mga0yw44_153580_c1 nmdc:mga0yw44_153580_c1_746_1462 238
293 3300050492 nmdc:mga0yw44_290121_c1 nmdc:mga0yw44_290121_c1_111_827 238
294 3300050495 nmdc:mga04h51_46907_c1 nmdc:mga04h51_46907_c1_559_1275 238
295 3300050495 nmdc:mga04h51_73946_c1 nmdc:mga04h51_73946_c1_346_1062 238
296 3300050496 nmdc:mga07m45_8939_c1 nmdc:mga07m45_8939_c1_2996_3712 238
297 3300053079 Ga0500610_0096149 Ga0500610_0096149_395_1111 238
298 3300053151 Ga0500604_0148341 Ga0500604_0148341_42_758 238
299 3300053155 Ga0500620_000132 Ga0500620_000132_13379_14095 238
300 3300053155 Ga0500620_054823 Ga0500620_054823_71_787 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

27

246

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lwd-assembly1.cif.gz_A-2 crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution 0.967 19 238
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.963 8 238
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.9509 8 238
3lwd-assembly1.cif.gz_A-2 crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution 0.9373 19 238
3lhi-assembly1.cif.gz_A crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution 0.9217 11 238
ID Description Score Start End Superfamily
3lwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9668 19 238 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9561 7 238 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.952 7 238 3.40.50.1360
3lwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9369 19 238 3.40.50.1360
3lhiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9016 11 238 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A4S0RPS9-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9994 34 235 GO:0005975
GO:0006098
GO:0017057
AF-A0A4R4GQF8-F1-model_v4 deleted 0.9976 20 112
AF-A0A3S2D1D0-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9959 64 238 GO:0005975
GO:0006098
GO:0017057
AF-A0A4S0RPS9-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9945 34 235 GO:0005975
GO:0006098
GO:0017057
AF-A0A528LKF4-F1-model_v4 6-phosphogluconolactonase 0.9935 146 238 GO:0005975

Feature Viewer

pLDDT pTM Quality
92.88 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map