F395051

General Info

Members Datasets Scaffolds Average Seq Length
299 153 299 154

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0005821|Ga0501034_0005821_10919_11419
Length 166
Sequence MADPIKLHDLKPAAGSNRRKKRVGRGIAGKGGKTAXXXXKGQKARNKVPLGFEGGQMPLHMRIPKLKGFNNPFRVEYQGINLDVIEGTDLSEISPATLHAKGLAHKGALIKVLGRGELTRAVTVKAHAFSKSAETAITAAGGTVEVLPKPWGDRRPPVKGNQFANR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
59 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
60 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
61 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
68 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
69 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
70 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
71 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
74 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
79 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
150 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.37
Nodule 0
Rhizoplane 4.01
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10005056 3300003373 Bacteria 3227
2 JGI25405J52794_10095141 3300003911 Bacteria 661
3 JGI25405J52794_10124382 3300003911 Bacteria 582
4 Ga0070670_100300125 3300005331 Bacteria 1405
5 Ga0070661_100103545 3300005344 Bacteria 2120
6 Ga0070673_100515657 3300005364 Bacteria 1083
7 Ga0068867_101485532 3300005459 Bacteria 631
8 Ga0070684_101758973 3300005535 Bacteria 585
9 Ga0070665_100119492 3300005548 Bacteria 2638
10 Ga0070704_100580345 3300005549 Bacteria 983
11 Ga0068861_100563534 3300005719 Bacteria 1040
12 Ga0068858_100071381 3300005842 Bacteria 3221
13 Ga0068860_100049813 3300005843 Bacteria 3988
14 Ga0068862_100931378 3300005844 Bacteria 856
15 Ga0081455_10001246 3300005937 Bacteria 31840
16 Ga0081455_10006029 3300005937 Bacteria 13133
17 Ga0081455_10019861 3300005937 Bacteria 6345
18 Ga0081455_10466944 3300005937 Bacteria 858
19 Ga0081538_10012203 3300005981 Bacteria 6904
20 Ga0081538_10015407 3300005981 Bacteria 5919
21 Ga0081538_10027452 3300005981 Bacteria 3946
22 Ga0075365_10101091 3300006038 Bacteria 1974
23 Ga0075365_10117278 3300006038 Bacteria 1834
24 Ga0075365_10121830 3300006038 Bacteria 1800
25 Ga0075365_10131527 3300006038 Bacteria 1732
26 Ga0075365_10225887 3300006038 Bacteria 1314
27 Ga0075365_10385294 3300006038 Bacteria 989
28 Ga0075365_10530197 3300006038 Bacteria 833
29 Ga0075365_10551091 3300006038 Bacteria 815
30 Ga0075363_100076606 3300006048 Bacteria 1824
31 Ga0075363_100325336 3300006048 Bacteria 895
32 Ga0075364_10017387 3300006051 Bacteria 4492
33 Ga0075364_10131148 3300006051 Bacteria 1682
34 Ga0075364_10888479 3300006051 Bacteria 607
35 Ga0075362_10024023 3300006177 Bacteria 2583
36 Ga0075362_10197452 3300006177 Bacteria 978
37 Ga0075367_10010858 3300006178 Bacteria 4799
38 Ga0075367_10268840 3300006178 Bacteria 1071
39 Ga0075428_100006199 3300006844 Bacteria 13302
40 Ga0075428_100007971 3300006844 Bacteria 11750
41 Ga0075428_100050387 3300006844 Bacteria 4567
42 Ga0075428_100157963 3300006844 Bacteria 2462
43 Ga0075428_100218774 3300006844 Bacteria 2057
44 Ga0075428_100720335 3300006844 Bacteria 1062
45 Ga0075430_100004496 3300006846 Bacteria 11750
46 Ga0075430_100006208 3300006846 Bacteria 10075
47 Ga0075430_100012317 3300006846 Bacteria 7274
48 Ga0075430_100113394 3300006846 Bacteria 2260
49 Ga0075431_100014147 3300006847 Bacteria 8068
50 Ga0075431_100053150 3300006847 Bacteria 4176
51 Ga0075431_100115310 3300006847 Bacteria 2773
52 Ga0075431_100720748 3300006847 Bacteria 974
53 Ga0075429_100001166 3300006880 Bacteria 21212
54 Ga0075429_100004700 3300006880 Bacteria 11750
55 Ga0075429_100051850 3300006880 Bacteria 3569
56 Ga0075429_100263036 3300006880 Bacteria 1510
57 Ga0075429_100333871 3300006880 Bacteria 1327
58 Ga0068865_101287072 3300006881 Bacteria 650
59 Ga0075436_101007764 3300006914 Bacteria 625
60 Ga0105251_10092859 3300009011 Bacteria 1385
61 Ga0111539_10174198 3300009094 Bacteria 2513
62 Ga0111539_10523500 3300009094 Bacteria 1381
63 Ga0111539_12874603 3300009094 Bacteria 557
64 Ga0105245_10008148 3300009098 Bacteria 9165
65 Ga0105245_10424165 3300009098 Bacteria 1334
66 Ga0105247_10086273 3300009101 Bacteria 1986
67 Ga0114129_10013234 3300009147 Bacteria 11750
68 Ga0114129_10039268 3300009147 Bacteria 6674
69 Ga0114129_10043279 3300009147 Bacteria 6335
70 Ga0114129_10156852 3300009147 Bacteria 3112
71 Ga0105241_10281168 3300009174 Bacteria 1421
72 Ga0105242_10373337 3300009176 Bacteria 1323
73 Ga0105248_10982165 3300009177 Bacteria 954
74 Ga0105239_10877409 3300010375 Bacteria 1029
75 Ga0157374_10366304 3300013296 Bacteria 1434
76 Ga0157374_10998617 3300013296 Bacteria 856
77 Ga0157378_10853101 3300013297 Bacteria 939
78 Ga0157372_11582268 3300013307 Bacteria 755
79 Ga0157375_10675092 3300013308 Bacteria 1188
80 Ga0163163_10078303 3300014325 Bacteria 3302
81 Ga0163163_11224970 3300014325 Bacteria 813
82 Ga0163163_11294273 3300014325 Bacteria 791
83 Ga0182008_10050407 3300014497 Bacteria 2066
84 Ga0207654_10190661 3300025911 Bacteria 1343
85 Ga0207649_10969131 3300025920 Bacteria 668
86 Ga0207687_10015908 3300025927 Bacteria 4936
87 Ga0207644_10091812 3300025931 Bacteria 2264
88 Ga0207686_10262880 3300025934 Bacteria 1266
89 Ga0207711_10322777 3300025941 Bacteria 1427
90 Ga0207651_10614845 3300025960 Bacteria 951
91 Ga0207683_10596755 3300026121 Bacteria 1022
92 Ga0207428_10216662 3300027907 Bacteria 1437
93 Ga0268264_10036210 3300028381 Bacteria 4064
94 Ga0268264_10932821 3300028381 Bacteria 872
95 Ga0307408_100887464 3300031548 Bacteria 815
96 Ga0316576_10207055 3300031727 Bacteria 1477
97 Ga0307406_10581561 3300031901 Bacteria 921
98 Ga0307407_10331049 3300031903 Bacteria 1072
99 Ga0307407_10401102 3300031903 Bacteria 984
100 Ga0307416_100316536 3300032002 Bacteria 1560
101 Ga0307415_100064534 3300032126 Bacteria 2548
102 Ga0373930_0000469 3300034816 Bacteria 5443
103 Ga0373930_0038033 3300034816 Bacteria 1015
104 Ga0373928_0002792 3300035084 Bacteria 3370
105 Ga0373929_0000799 3300035085 Bacteria 6117
106 Ga0373932_0004715 3300035112 Bacteria 3217
107 Ga0373931_0000003 3300035691 Bacteria 560286
108 Ga0373931_0000106 3300035691 Bacteria 38061
109 Ga0373931_0066736 3300035691 Bacteria 1953
110 Ga0373937_0328235 3300036401 Bacteria 1448
111 Ga0316582_0196844 3300036647 Bacteria 1374
112 Ga0436362_1060110 3300039453 Bacteria 768
113 Ga0439439_0149682 3300041406 Bacteria 662
114 Ga0439466_0114043 3300041411 Bacteria 837
115 Ga0439465_0060625 3300041413 Bacteria 1253
116 Ga0451837_0961044 3300041494 Bacteria 967
117 Ga0451849_0759663 3300041505 Bacteria 650
118 Ga0451855_0852182 3300041511 Bacteria 562
119 Ga0439448_0005269 3300042005 Bacteria 3684
120 Ga0439450_000478 3300042008 Bacteria 5212
121 Ga0439450_093059 3300042008 Bacteria 759
122 Ga0439454_002950 3300042011 Bacteria 1850
123 Ga0439463_001342 3300042016 Bacteria 6565
124 Ga0439434_0005020 3300042435 Bacteria 3867
125 Ga0439464_0000848 3300042439 Bacteria 6778
126 Ga0450901_004697 3300042533 Bacteria 1410
127 Ga0439440_0026710 3300042993 Bacteria 1337
128 Ga0495603_0518215 3300046455 Bacteria 683
129 Ga0495629_0479787 3300046459 Bacteria 840
130 Ga0495630_0023183 3300046517 Bacteria 4588
131 Ga0495621_0023842 3300046539 Bacteria 2038
132 Ga0495645_0403383 3300046543 Bacteria 871
133 Ga0495667_0316571 3300046559 Bacteria 987
134 Ga0495588_0238223 3300046674 Bacteria 960
135 Ga0495599_0174798 3300046678 Bacteria 1325
136 Ga0495646_0304758 3300046680 Bacteria 842
137 Ga0495647_0047335 3300046681 Bacteria 1659
138 Ga0495658_0479464 3300046683 Bacteria 795
139 Ga0495613_0365544 3300046689 Bacteria 989
140 Ga0495613_0400701 3300046689 Bacteria 936
141 Ga0495581_0317461 3300047315 Bacteria 910
142 Ga0496100_0359014 3300048903 Bacteria 1102
143 Ga0496102_0052615 3300048905 Bacteria 3711
144 Ga0496103_0126889 3300048906 Bacteria 1627
145 Ga0496104_0267341 3300048907 Bacteria 1622
146 Ga0496105_0105062 3300048908 Bacteria 2331
147 Ga0496108_0025977 3300048911 Bacteria 4830
148 Ga0496109_0004660 3300048912 Bacteria 11447
149 Ga0496110_0004643 3300048913 Bacteria 10677
150 Ga0496111_0031524 3300048914 Bacteria 3777
151 Ga0496114_0004194 3300048917 Bacteria 11164
152 Ga0496114_0071439 3300048917 Bacteria 2917
153 Ga0496114_0636199 3300048917 Bacteria 939
154 Ga0501031_0020256 3300049568 Bacteria 4337
155 Ga0501031_0024880 3300049568 Bacteria 3905
156 Ga0501032_0789912 3300049569 Bacteria 600
157 Ga0501033_0000586 3300049570 Bacteria 33688
158 Ga0501033_0007082 3300049570 Bacteria 8756
159 Ga0501033_0185849 3300049570 Bacteria 1489
160 Ga0501033_0338324 3300049570 Bacteria 1055
161 Ga0501034_0003206 3300049571 Bacteria 18765
162 Ga0501034_0004900 3300049571 Bacteria 14756
163 Ga0501034_0005821 3300049571 Bacteria 13408
164 Ga0501034_0641892 3300049571 Bacteria 964
165 Ga0501034_1344271 3300049571 Bacteria 590
166 Ga0501036_0043183 3300049572 Bacteria 3817
167 Ga0501036_0429233 3300049572 Bacteria 1102
168 Ga0501037_0122578 3300049573 Bacteria 1868
169 Ga0501037_0507974 3300049573 Bacteria 817
170 Ga0501038_0038011 3300049574 Bacteria 4217
171 Ga0501038_0315438 3300049574 Bacteria 1224
172 Ga0501038_0671116 3300049574 Bacteria 779
173 Ga0501039_0002563 3300049575 Bacteria 13562
174 Ga0501040_0002053 3300049576 Bacteria 12978
175 Ga0501040_0011866 3300049576 Bacteria 5701
176 Ga0501041_0018833 3300049577 Bacteria 4111
177 Ga0501041_0194373 3300049577 Bacteria 1271
178 Ga0501041_0221307 3300049577 Bacteria 1188
179 Ga0501041_0313499 3300049577 Bacteria 989
180 Ga0501042_0013371 3300049578 Bacteria 5584
181 Ga0501042_0152813 3300049578 Bacteria 1664
182 Ga0501042_0180926 3300049578 Bacteria 1521
183 Ga0501042_0519105 3300049578 Bacteria 865
184 Ga0501043_0296531 3300049579 Bacteria 1237
185 Ga0501046_0046282 3300049580 Bacteria 3453
186 Ga0501046_0062087 3300049580 Bacteria 2920
187 Ga0501046_0150889 3300049580 Bacteria 1753
188 Ga0501046_0229406 3300049580 Bacteria 1373
189 Ga0501047_0144851 3300049581 Bacteria 2253
190 Ga0501047_0288795 3300049581 Bacteria 1484
191 Ga0501048_0004571 3300049582 Bacteria 10528
192 Ga0501048_0030590 3300049582 Bacteria 3895
193 Ga0501048_0885679 3300049582 Bacteria 642
194 Ga0501067_0060022 3300049583 Bacteria 2105
195 Ga0501068_0005345 3300049584 Bacteria 7020
196 Ga0501068_0009439 3300049584 Bacteria 5460
197 Ga0501068_0014974 3300049584 Bacteria 4444
198 Ga0501069_0013429 3300049585 Bacteria 4368
199 Ga0501069_0850351 3300049585 Bacteria 554
200 Ga0501070_0000976 3300049586 Bacteria 25697
201 Ga0501070_0022920 3300049586 Bacteria 5227
202 Ga0501071_0005915 3300049587 Bacteria 7914
203 Ga0501071_0059569 3300049587 Bacteria 2762
204 Ga0501071_0221710 3300049587 Bacteria 1423
205 Ga0501071_0552228 3300049587 Bacteria 885
206 Ga0501071_0768060 3300049587 Bacteria 743
207 Ga0501072_0000404 3300049588 Bacteria 30870
208 Ga0501072_0010936 3300049588 Bacteria 6919
209 Ga0501072_0052518 3300049588 Bacteria 3209
210 Ga0501072_0117707 3300049588 Bacteria 2116
211 Ga0501072_1256667 3300049588 Bacteria 574
212 Ga0501073_0002841 3300049589 Bacteria 12980
213 Ga0501073_0004116 3300049589 Bacteria 10914
214 Ga0501073_0338417 3300049589 Bacteria 1039
215 Ga0501074_0002739 3300049590 Bacteria 12327
216 Ga0501074_0042273 3300049590 Bacteria 3298
217 Ga0501074_0082781 3300049590 Bacteria 2301
218 Ga0501074_0144408 3300049590 Bacteria 1702
219 Ga0501074_0190530 3300049590 Bacteria 1462
220 Ga0501075_0003133 3300049591 Bacteria 11058
221 Ga0501075_0004688 3300049591 Bacteria 9283
222 Ga0501075_0224701 3300049591 Bacteria 1432
223 Ga0501075_0709778 3300049591 Bacteria 766
224 Ga0501076_0007602 3300049592 Bacteria 7891
225 Ga0501076_0166008 3300049592 Bacteria 1799
226 Ga0501077_0006635 3300049593 Bacteria 7107
227 Ga0501077_0010895 3300049593 Bacteria 5665
228 Ga0501077_0136159 3300049593 Bacteria 1558
229 Ga0501077_0316605 3300049593 Bacteria 995
230 Ga0501077_0388735 3300049593 Bacteria 891
231 Ga0501079_0017365 3300049741 Bacteria 5495
232 Ga0501079_0026873 3300049741 Bacteria 4413
233 Ga0501079_0085952 3300049741 Bacteria 2434
234 Ga0501079_0338430 3300049741 Bacteria 1179
235 Ga0501079_0466042 3300049741 Bacteria 992
236 Ga0501080_0016669 3300049742 Bacteria 6784
237 Ga0501080_0133748 3300049742 Bacteria 2295
238 Ga0501080_0296614 3300049742 Bacteria 1467
239 Ga0501080_0548080 3300049742 Bacteria 1030
240 Ga0501080_0632581 3300049742 Bacteria 948
241 Ga0501081_0006867 3300049743 Bacteria 7402
242 Ga0501081_1038998 3300049743 Bacteria 619
243 Ga0501083_0000616 3300049744 Bacteria 22924
244 Ga0501083_0013069 3300049744 Bacteria 5801
245 Ga0501083_0216626 3300049744 Bacteria 1248
246 Ga0501035_0824481 3300049822 Bacteria 740
247 Ga0501044_0007378 3300049823 Bacteria 12090
248 Ga0501045_0002201 3300049824 Bacteria 13214
249 Ga0501045_0012325 3300049824 Bacteria 6019
250 Ga0501045_0713379 3300049824 Bacteria 740
251 nmdc:mga03n38_228288_c1 3300050490 Bacteria 975
252 nmdc:mga00v17_16891_c1 3300050491 Bacteria 4120
253 nmdc:mga00v17_582849_c1 3300050491 Bacteria 722
254 nmdc:mga0yw44_275631_c1 3300050492 Bacteria 1123
255 nmdc:mga0yw44_293988_c1 3300050492 Bacteria 1087
256 nmdc:mga0yw44_327823_c1 3300050492 Bacteria 1029
257 nmdc:mga0yw44_371051_c1 3300050492 Bacteria 965
258 nmdc:mga0yw44_811981_c1 3300050492 Bacteria 635
259 nmdc:mga06z11_18858_c1 3300050494 Bacteria 3160
260 nmdc:mga06z11_258901_c1 3300050494 Bacteria 1026
261 nmdc:mga05p37_171_c1 3300050507 Bacteria 63303
262 nmdc:mga05p37_24020_c1 3300050507 Bacteria 7404
263 nmdc:mga05p37_336344_c1 3300050507 Bacteria 1782
264 nmdc:mga05p37_47080_c1 3300050507 Bacteria 5303
265 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
266 nmdc:mga09592_27861_c1 3300050508 Bacteria 4689
267 nmdc:mga09592_327329_c1 3300050508 Bacteria 1327
268 nmdc:mga09592_349546_c1 3300050508 Bacteria 1280
269 nmdc:mga09592_565_c1 3300050508 Bacteria 28059
270 nmdc:mga09592_623055_c1 3300050508 Bacteria 923
271 nmdc:mga0qj67_127210_c1 3300050509 Bacteria 2062
272 nmdc:mga0qj67_2649_c1 3300050509 Bacteria 12826
273 nmdc:mga0qj67_276018_c1 3300050509 Bacteria 1362
274 nmdc:mga0qj67_5012_c1 3300050509 Bacteria 9622
275 nmdc:mga06r32_247059_c1 3300050510 Bacteria 1772
276 nmdc:mga06r32_32845_c1 3300050510 Bacteria 4886
277 nmdc:mga06r32_342_c1 3300050510 Bacteria 38838
278 nmdc:mga06r32_72641_c1 3300050510 Bacteria 3331
279 nmdc:mga06r32_791242_c1 3300050510 Bacteria 910
280 nmdc:mga06r32_927643_c1 3300050510 Bacteria 826
281 nmdc:mga08y16_226856_c1 3300050511 Bacteria 1933
282 nmdc:mga0a205_734225_c1 3300050515 Bacteria 836
283 nmdc:mga0sz30_139775_c1 3300050516 Bacteria 1069
284 Ga0500635_0001744 3300053080 Bacteria 5297
285 Ga0495595_0030859 3300053084 Bacteria 2406
286 Ga0500566_0000391 3300053094 Bacteria 24277
287 Ga0500616_0001847 3300053153 Bacteria 19181
288 Ga0501084_0004976 3300054114 Bacteria 10867
289 Ga0501084_0009323 3300054114 Bacteria 8120
290 Ga0501084_0017951 3300054114 Bacteria 5892
291 Ga0501084_1251050 3300054114 Bacteria 622
292 Ga0501082_0018922 3300060353 Bacteria 5933
293 Ga0501082_0052772 3300060353 Bacteria 3505
294 Ga0501082_0129993 3300060353 Bacteria 2185
295 Ga0501082_0134865 3300060353 Bacteria 2142
296 Ga0530510_0000429 3300061734 Bacteria 27096
297 Ga0530510_0008315 3300061734 Bacteria 7237
298 Ga0530510_0010398 3300061734 Bacteria 6523
299 Ga0530510_0502054 3300061734 Bacteria 919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0852182 Ga0451855_0852182_109_540 137
2 3300049571 Ga0501034_1344271 Ga0501034_1344271_82_570 138
3 3300049580 Ga0501046_0229406 Ga0501046_0229406_862_1356 138
4 3300006038 Ga0075365_10121830 Ga0075365_101218303 141
5 3300034816 Ga0373930_0000469 Ga0373930_0000469_1346_1837 141
6 3300035084 Ga0373928_0002792 Ga0373928_0002792_401_892 141
7 3300035085 Ga0373929_0000799 Ga0373929_0000799_4008_4499 141
8 3300035691 Ga0373931_0000003 Ga0373931_0000003_384858_385349 141
9 3300036401 Ga0373937_0328235 Ga0373937_0328235_565_1038 141
10 3300046559 Ga0495667_0316571 Ga0495667_0316571_399_872 141
11 3300053084 Ga0495595_0030859 Ga0495595_0030859_1763_2236 141
12 3300005843 Ga0068860_100049813 Ga0068860_1000498135 143
13 3300028381 Ga0268264_10036210 Ga0268264_100362104 143
14 3300009098 Ga0105245_10008148 Ga0105245_1000814815 144
15 3300009174 Ga0105241_10281168 Ga0105241_102811682 144
16 3300009176 Ga0105242_10373337 Ga0105242_103733373 144
17 3300010375 Ga0105239_10877409 Ga0105239_108774092 144
18 3300013296 Ga0157374_10998617 Ga0157374_109986173 144
19 3300013297 Ga0157378_10853101 Ga0157378_108531013 144
20 3300025911 Ga0207654_10190661 Ga0207654_101906612 144
21 3300025927 Ga0207687_10015908 Ga0207687_1001590811 144
22 3300025934 Ga0207686_10262880 Ga0207686_102628803 144
23 3300041494 Ga0451837_0961044 Ga0451837_0961044_150_638 144
24 3300049589 Ga0501073_0338417 Ga0501073_0338417_586_1020 144
25 3300049744 Ga0501083_0216626 Ga0501083_0216626_39_473 144
26 3300006051 Ga0075364_10888479 Ga0075364_108884792 145
27 3300014325 Ga0163163_11294273 Ga0163163_112942732 145
28 3300041505 Ga0451849_0759663 Ga0451849_0759663_91_585 145
29 3300006038 Ga0075365_10131527 Ga0075365_101315273 146
30 3300006038 Ga0075365_10225887 Ga0075365_102258873 146
31 3300006038 Ga0075365_10385294 Ga0075365_103852942 146
32 3300006048 Ga0075363_100325336 Ga0075363_1003253362 146
33 3300006051 Ga0075364_10131148 Ga0075364_101311483 146
34 3300006178 Ga0075367_10010858 Ga0075367_100108585 146
35 3300006178 Ga0075367_10268840 Ga0075367_102688402 146
36 3300006914 Ga0075436_101007764 Ga0075436_1010077642 146
37 3300046543 Ga0495645_0403383 Ga0495645_0403383_333_821 146
38 3300046678 Ga0495599_0174798 Ga0495599_0174798_783_1271 146
39 3300046680 Ga0495646_0304758 Ga0495646_0304758_140_628 146
40 3300046689 Ga0495613_0365544 Ga0495613_0365544_322_810 146
41 3300049581 Ga0501047_0288795 Ga0501047_0288795_665_1153 146
42 3300050490 nmdc:mga03n38_228288_c1 nmdc:mga03n38_228288_c1_141_629 146
43 3300050491 nmdc:mga00v17_582849_c1 nmdc:mga00v17_582849_c1_119_607 146
44 3300050492 nmdc:mga0yw44_275631_c1 nmdc:mga0yw44_275631_c1_512_1006 146
45 3300050492 nmdc:mga0yw44_293988_c1 nmdc:mga0yw44_293988_c1_136_624 146
46 3300050492 nmdc:mga0yw44_811981_c1 nmdc:mga0yw44_811981_c1_21_509 146
47 3300050494 nmdc:mga06z11_18858_c1 nmdc:mga06z11_18858_c1_1479_1967 146
48 3300050494 nmdc:mga06z11_258901_c1 nmdc:mga06z11_258901_c1_108_596 146
49 3300005937 Ga0081455_10006029 Ga0081455_1000602920 147
50 3300006038 Ga0075365_10117278 Ga0075365_101172782 147
51 3300006038 Ga0075365_10530197 Ga0075365_105301972 147
52 3300014325 Ga0163163_11224970 Ga0163163_112249702 147
53 3300031903 Ga0307407_10331049 Ga0307407_103310492 147
54 3300039453 Ga0436362_1060110 Ga0436362_1060110_96_584 147
55 3300046459 Ga0495629_0479787 Ga0495629_0479787_158_646 147
56 3300047315 Ga0495581_0317461 Ga0495581_0317461_212_700 147
57 3300049582 Ga0501048_0885679 Ga0501048_0885679_110_598 147
58 3300049587 Ga0501071_0552228 Ga0501071_0552228_343_837 147
59 3300050492 nmdc:mga0yw44_371051_c1 nmdc:mga0yw44_371051_c1_124_618 147
60 3300005937 Ga0081455_10466944 Ga0081455_104669442 148
61 3300006881 Ga0068865_101287072 Ga0068865_1012870721 148
62 3300009094 Ga0111539_12874603 Ga0111539_128746031 148
63 3300032126 Ga0307415_100064534 Ga0307415_1000645346 148
64 3300035691 Ga0373931_0066736 Ga0373931_0066736_1007_1495 148
65 3300046517 Ga0495630_0023183 Ga0495630_0023183_909_1397 148
66 3300046683 Ga0495658_0479464 Ga0495658_0479464_37_525 148
67 3300048903 Ga0496100_0359014 Ga0496100_0359014_365_853 148
68 3300048917 Ga0496114_0071439 Ga0496114_0071439_713_1201 148
69 3300049571 Ga0501034_0003206 Ga0501034_0003206_11588_12076 148
70 3300049571 Ga0501034_0004900 Ga0501034_0004900_13495_13983 148
71 3300049577 Ga0501041_0313499 Ga0501041_0313499_288_776 148
72 3300049578 Ga0501042_0180926 Ga0501042_0180926_663_1151 148
73 3300049590 Ga0501074_0144408 Ga0501074_0144408_666_1154 148
74 3300049593 Ga0501077_0316605 Ga0501077_0316605_86_574 148
75 3300053080 Ga0500635_0001744 Ga0500635_0001744_4523_5011 148
76 3300054114 Ga0501084_0017951 Ga0501084_0017951_110_598 148
77 3300005344 Ga0070661_100103545 Ga0070661_1001035452 149
78 3300005364 Ga0070673_100515657 Ga0070673_1005156573 149
79 3300005535 Ga0070684_101758973 Ga0070684_1017589731 149
80 3300006048 Ga0075363_100076606 Ga0075363_1000766062 149
81 3300006177 Ga0075362_10024023 Ga0075362_100240232 149
82 3300006844 Ga0075428_100007971 Ga0075428_1000079718 149
83 3300006844 Ga0075428_100720335 Ga0075428_1007203352 149
84 3300006846 Ga0075430_100004496 Ga0075430_1000044968 149
85 3300006847 Ga0075431_100014147 Ga0075431_10001414714 149
86 3300006880 Ga0075429_100004700 Ga0075429_1000047008 149
87 3300009094 Ga0111539_10523500 Ga0111539_105235003 149
88 3300009098 Ga0105245_10424165 Ga0105245_104241652 149
89 3300009147 Ga0114129_10013234 Ga0114129_1001323413 149
90 3300013296 Ga0157374_10366304 Ga0157374_103663042 149
91 3300025920 Ga0207649_10969131 Ga0207649_109691311 149
92 3300025960 Ga0207651_10614845 Ga0207651_106148452 149
93 3300026121 Ga0207683_10596755 Ga0207683_105967552 149
94 3300027907 Ga0207428_10216662 Ga0207428_102166623 149
95 3300031727 Ga0316576_10207055 Ga0316576_102070553 149
96 3300036647 Ga0316582_0196844 Ga0316582_0196844_207_695 149
97 3300046455 Ga0495603_0518215 Ga0495603_0518215_79_567 149
98 3300046674 Ga0495588_0238223 Ga0495588_0238223_366_854 149
99 3300050507 nmdc:mga05p37_171_c1 nmdc:mga05p37_171_c1_44646_45140 149
100 3300050507 nmdc:mga05p37_336344_c1 nmdc:mga05p37_336344_c1_969_1463 149
101 3300050508 nmdc:mga09592_565_c1 nmdc:mga09592_565_c1_16664_17158 149
102 3300050509 nmdc:mga0qj67_2649_c1 nmdc:mga0qj67_2649_c1_9854_10348 149
103 3300050510 nmdc:mga06r32_32845_c1 nmdc:mga06r32_32845_c1_2681_3175 149
104 3300050511 nmdc:mga08y16_226856_c1 nmdc:mga08y16_226856_c1_537_1031 149
105 3300050515 nmdc:mga0a205_734225_c1 nmdc:mga0a205_734225_c1_250_744 149
106 3300053153 Ga0500616_0001847 Ga0500616_0001847_15530_16018 149
107 3300005981 Ga0081538_10027452 Ga0081538_100274523 150
108 3300006844 Ga0075428_100157963 Ga0075428_1001579633 150
109 3300006844 Ga0075428_100218774 Ga0075428_1002187741 150
110 3300006846 Ga0075430_100006208 Ga0075430_10000620815 150
111 3300006847 Ga0075431_100720748 Ga0075431_1007207482 150
112 3300006880 Ga0075429_100001166 Ga0075429_10000116623 150
113 3300006880 Ga0075429_100333871 Ga0075429_1003338713 150
114 3300009147 Ga0114129_10039268 Ga0114129_100392682 150
115 3300031901 Ga0307406_10581561 Ga0307406_105815612 150
116 3300046681 Ga0495647_0047335 Ga0495647_0047335_336_824 150
117 3300046689 Ga0495613_0400701 Ga0495613_0400701_319_807 150
118 3300049741 Ga0501079_0338430 Ga0501079_0338430_369_857 150
119 3300049824 Ga0501045_0713379 Ga0501045_0713379_90_578 150
120 3300050507 nmdc:mga05p37_47080_c1 nmdc:mga05p37_47080_c1_3161_3655 150
121 3300050508 nmdc:mga09592_183_c1 nmdc:mga09592_183_c1_23389_23883 150
122 3300050508 nmdc:mga09592_623055_c1 nmdc:mga09592_623055_c1_21_515 150
123 3300050509 nmdc:mga0qj67_5012_c1 nmdc:mga0qj67_5012_c1_2900_3394 150
124 3300050510 nmdc:mga06r32_247059_c1 nmdc:mga06r32_247059_c1_439_933 150
125 3300050510 nmdc:mga06r32_342_c1 nmdc:mga06r32_342_c1_35112_35606 150
126 3300009094 Ga0111539_10174198 Ga0111539_101741982 151
127 3300050508 nmdc:mga09592_349546_c1 nmdc:mga09592_349546_c1_451_945 151
128 3300050510 nmdc:mga06r32_791242_c1 nmdc:mga06r32_791242_c1_185_679 151
129 3300014497 Ga0182008_10050407 Ga0182008_100504072 152
130 3300031903 Ga0307407_10401102 Ga0307407_104011022 152
131 3300049577 Ga0501041_0221307 Ga0501041_0221307_392_880 152
132 3300042008 Ga0439450_093059 Ga0439450_093059_127_615 153
133 3300049568 Ga0501031_0020256 Ga0501031_0020256_490_984 153
134 3300049570 Ga0501033_0338324 Ga0501033_0338324_319_813 153
135 3300049572 Ga0501036_0043183 Ga0501036_0043183_182_676 153
136 3300049575 Ga0501039_0002563 Ga0501039_0002563_2368_2862 153
137 3300049576 Ga0501040_0002053 Ga0501040_0002053_8897_9391 153
138 3300049578 Ga0501042_0519105 Ga0501042_0519105_11_505 153
139 3300049580 Ga0501046_0046282 Ga0501046_0046282_1919_2413 153
140 3300049582 Ga0501048_0030590 Ga0501048_0030590_2402_2896 153
141 3300049584 Ga0501068_0005345 Ga0501068_0005345_4955_5449 153
142 3300049587 Ga0501071_0059569 Ga0501071_0059569_925_1419 153
143 3300049588 Ga0501072_0000404 Ga0501072_0000404_20438_20932 153
144 3300049590 Ga0501074_0042273 Ga0501074_0042273_2612_3106 153
145 3300049591 Ga0501075_0003133 Ga0501075_0003133_4608_5102 153
146 3300049593 Ga0501077_0010895 Ga0501077_0010895_4510_5004 153
147 3300049741 Ga0501079_0085952 Ga0501079_0085952_941_1435 153
148 3300049824 Ga0501045_0012325 Ga0501045_0012325_151_645 153
149 3300060353 Ga0501082_0052772 Ga0501082_0052772_2197_2691 153
150 3300061734 Ga0530510_0008315 Ga0530510_0008315_2458_2952 153
151 3300005548 Ga0070665_100119492 Ga0070665_1001194925 154
152 3300005842 Ga0068858_100071381 Ga0068858_1000713812 154
153 3300005844 Ga0068862_100931378 Ga0068862_1009313782 154
154 3300009011 Ga0105251_10092859 Ga0105251_100928593 154
155 3300009101 Ga0105247_10086273 Ga0105247_100862732 154
156 3300009177 Ga0105248_10982165 Ga0105248_109821652 154
157 3300014325 Ga0163163_10078303 Ga0163163_100783033 154
158 3300025941 Ga0207711_10322777 Ga0207711_103227772 154
159 3300028381 Ga0268264_10932821 Ga0268264_109328213 154
160 3300034816 Ga0373930_0038033 Ga0373930_0038033_398_889 154
161 3300035112 Ga0373932_0004715 Ga0373932_0004715_2591_3082 154
162 3300035691 Ga0373931_0000106 Ga0373931_0000106_20232_20723 154
163 3300048905 Ga0496102_0052615 Ga0496102_0052615_2849_3337 154
164 3300048906 Ga0496103_0126889 Ga0496103_0126889_692_1180 154
165 3300048907 Ga0496104_0267341 Ga0496104_0267341_437_925 154
166 3300048908 Ga0496105_0105062 Ga0496105_0105062_860_1348 154
167 3300048911 Ga0496108_0025977 Ga0496108_0025977_1210_1698 154
168 3300048912 Ga0496109_0004660 Ga0496109_0004660_10157_10645 154
169 3300048913 Ga0496110_0004643 Ga0496110_0004643_6198_6686 154
170 3300048917 Ga0496114_0004194 Ga0496114_0004194_6243_6731 154
171 3300003911 JGI25405J52794_10095141 JGI25405J52794_100951411 155
172 3300005937 Ga0081455_10019861 Ga0081455_100198613 155
173 3300006844 Ga0075428_100006199 Ga0075428_10000619911 155
174 3300006844 Ga0075428_100050387 Ga0075428_1000503874 155
175 3300006846 Ga0075430_100012317 Ga0075430_1000123173 155
176 3300006846 Ga0075430_100113394 Ga0075430_1001133943 155
177 3300006847 Ga0075431_100115310 Ga0075431_1001153102 155
178 3300006880 Ga0075429_100051850 Ga0075429_1000518504 155
179 3300009147 Ga0114129_10043279 Ga0114129_100432794 155
180 3300042005 Ga0439448_0005269 Ga0439448_0005269_145_639 155
181 3300042008 Ga0439450_000478 Ga0439450_000478_2521_3015 155
182 3300042011 Ga0439454_002950 Ga0439454_002950_313_807 155
183 3300042016 Ga0439463_001342 Ga0439463_001342_815_1309 155
184 3300042439 Ga0439464_0000848 Ga0439464_0000848_3375_3869 155
185 3300042993 Ga0439440_0026710 Ga0439440_0026710_259_753 155
186 3300049570 Ga0501033_0185849 Ga0501033_0185849_424_912 155
187 3300049573 Ga0501037_0507974 Ga0501037_0507974_106_600 155
188 3300049577 Ga0501041_0194373 Ga0501041_0194373_16_510 155
189 3300049578 Ga0501042_0152813 Ga0501042_0152813_449_937 155
190 3300049579 Ga0501043_0296531 Ga0501043_0296531_714_1202 155
191 3300049580 Ga0501046_0062087 Ga0501046_0062087_20_514 155
192 3300049587 Ga0501071_0221710 Ga0501071_0221710_346_834 155
193 3300049588 Ga0501072_0052518 Ga0501072_0052518_2395_2889 155
194 3300049588 Ga0501072_1256667 Ga0501072_1256667_71_559 155
195 3300049591 Ga0501075_0224701 Ga0501075_0224701_467_955 155
196 3300049591 Ga0501075_0709778 Ga0501075_0709778_32_526 155
197 3300049592 Ga0501076_0166008 Ga0501076_0166008_902_1390 155
198 3300049593 Ga0501077_0136159 Ga0501077_0136159_922_1410 155
199 3300049593 Ga0501077_0388735 Ga0501077_0388735_241_735 155
200 3300049741 Ga0501079_0466042 Ga0501079_0466042_22_516 155
201 3300049742 Ga0501080_0548080 Ga0501080_0548080_59_547 155
202 3300049742 Ga0501080_0632581 Ga0501080_0632581_339_833 155
203 3300049743 Ga0501081_1038998 Ga0501081_1038998_33_527 155
204 3300049822 Ga0501035_0824481 Ga0501035_0824481_169_657 155
205 3300050507 nmdc:mga05p37_24020_c1 nmdc:mga05p37_24020_c1_4466_4960 155
206 3300050508 nmdc:mga09592_327329_c1 nmdc:mga09592_327329_c1_428_922 155
207 3300050509 nmdc:mga0qj67_127210_c1 nmdc:mga0qj67_127210_c1_23_517 155
208 3300050509 nmdc:mga0qj67_276018_c1 nmdc:mga0qj67_276018_c1_342_830 155
209 3300054114 Ga0501084_1251050 Ga0501084_1251050_73_567 155
210 3300060353 Ga0501082_0134865 Ga0501082_0134865_158_652 155
211 3300061734 Ga0530510_0000429 Ga0530510_0000429_3140_3634 155
212 3300061734 Ga0530510_0502054 Ga0530510_0502054_59_547 155
213 3300005459 Ga0068867_101485532 Ga0068867_1014855321 156
214 3300005549 Ga0070704_100580345 Ga0070704_1005803451 156
215 3300005719 Ga0068861_100563534 Ga0068861_1005635342 156
216 3300013308 Ga0157375_10675092 Ga0157375_106750922 156
217 3300048917 Ga0496114_0636199 Ga0496114_0636199_60_548 156
218 3300005331 Ga0070670_100300125 Ga0070670_1003001252 157
219 3300042533 Ga0450901_004697 Ga0450901_004697_491_985 157
220 3300046539 Ga0495621_0023842 Ga0495621_0023842_112_600 157
221 3300049584 Ga0501068_0009439 Ga0501068_0009439_3166_3666 157
222 3300049585 Ga0501069_0013429 Ga0501069_0013429_1561_2061 157
223 3300049585 Ga0501069_0850351 Ga0501069_0850351_47_541 157
224 3300049586 Ga0501070_0000976 Ga0501070_0000976_11197_11697 157
225 3300049589 Ga0501073_0004116 Ga0501073_0004116_5181_5681 157
226 3300049590 Ga0501074_0082781 Ga0501074_0082781_1130_1630 157
227 3300049741 Ga0501079_0026873 Ga0501079_0026873_1198_1698 157
228 3300049742 Ga0501080_0016669 Ga0501080_0016669_5513_6013 157
229 3300049744 Ga0501083_0000616 Ga0501083_0000616_10531_11031 157
230 3300054114 Ga0501084_0009323 Ga0501084_0009323_1689_2189 157
231 3300060353 Ga0501082_0129993 Ga0501082_0129993_1568_2068 157
232 3300032002 Ga0307416_100316536 Ga0307416_1003165363 159
233 3300041406 Ga0439439_0149682 Ga0439439_0149682_127_627 159
234 3300042435 Ga0439434_0005020 Ga0439434_0005020_911_1411 159
235 3300006038 Ga0075365_10101091 Ga0075365_101010912 162
236 3300006038 Ga0075365_10551091 Ga0075365_105510913 162
237 3300006051 Ga0075364_10017387 Ga0075364_100173874 162
238 3300006177 Ga0075362_10197452 Ga0075362_101974521 162
239 3300013307 Ga0157372_11582268 Ga0157372_115822682 162
240 3300025931 Ga0207644_10091812 Ga0207644_100918125 162
241 3300041411 Ga0439466_0114043 Ga0439466_0114043_315_803 162
242 3300048914 Ga0496111_0031524 Ga0496111_0031524_2885_3373 162
243 3300049569 Ga0501032_0789912 Ga0501032_0789912_70_558 162
244 3300049570 Ga0501033_0000586 Ga0501033_0000586_15219_15710 162
245 3300049572 Ga0501036_0429233 Ga0501036_0429233_495_986 162
246 3300049574 Ga0501038_0315438 Ga0501038_0315438_238_729 162
247 3300049574 Ga0501038_0671116 Ga0501038_0671116_179_667 162
248 3300049581 Ga0501047_0144851 Ga0501047_0144851_496_987 162
249 3300049823 Ga0501044_0007378 Ga0501044_0007378_10083_10574 162
250 3300050491 nmdc:mga00v17_16891_c1 nmdc:mga00v17_16891_c1_2149_2640 162
251 3300050492 nmdc:mga0yw44_327823_c1 nmdc:mga0yw44_327823_c1_167_658 162
252 3300050516 nmdc:mga0sz30_139775_c1 nmdc:mga0sz30_139775_c1_257_748 162
253 3300053094 Ga0500566_0000391 Ga0500566_0000391_7142_7633 162
254 3300003373 JGI25407J50210_10005056 JGI25407J50210_100050564 164
255 3300003911 JGI25405J52794_10124382 JGI25405J52794_101243821 164
256 3300005937 Ga0081455_10001246 Ga0081455_1000124615 164
257 3300005981 Ga0081538_10012203 Ga0081538_100122032 164
258 3300005981 Ga0081538_10015407 Ga0081538_100154073 164
259 3300006847 Ga0075431_100053150 Ga0075431_1000531505 164
260 3300006880 Ga0075429_100263036 Ga0075429_1002630362 164
261 3300009147 Ga0114129_10156852 Ga0114129_101568524 164
262 3300031548 Ga0307408_100887464 Ga0307408_1008874641 164
263 3300041413 Ga0439465_0060625 Ga0439465_0060625_514_1008 164
264 3300049568 Ga0501031_0024880 Ga0501031_0024880_3243_3737 164
265 3300049570 Ga0501033_0007082 Ga0501033_0007082_4741_5235 164
266 3300049571 Ga0501034_0005821 Ga0501034_0005821_10919_11419 164
267 3300049571 Ga0501034_0641892 Ga0501034_0641892_65_559 164
268 3300049573 Ga0501037_0122578 Ga0501037_0122578_1219_1713 164
269 3300049574 Ga0501038_0038011 Ga0501038_0038011_3599_4093 164
270 3300049576 Ga0501040_0011866 Ga0501040_0011866_67_561 164
271 3300049577 Ga0501041_0018833 Ga0501041_0018833_663_1157 164
272 3300049578 Ga0501042_0013371 Ga0501042_0013371_491_985 164
273 3300049580 Ga0501046_0150889 Ga0501046_0150889_1199_1693 164
274 3300049582 Ga0501048_0004571 Ga0501048_0004571_7159_7653 164
275 3300049583 Ga0501067_0060022 Ga0501067_0060022_431_931 164
276 3300049584 Ga0501068_0014974 Ga0501068_0014974_3703_4203 164
277 3300049586 Ga0501070_0022920 Ga0501070_0022920_2591_3091 164
278 3300049587 Ga0501071_0005915 Ga0501071_0005915_4117_4611 164
279 3300049587 Ga0501071_0768060 Ga0501071_0768060_79_573 164
280 3300049588 Ga0501072_0010936 Ga0501072_0010936_2312_2812 164
281 3300049588 Ga0501072_0117707 Ga0501072_0117707_1607_2101 164
282 3300049589 Ga0501073_0002841 Ga0501073_0002841_12366_12866 164
283 3300049590 Ga0501074_0002739 Ga0501074_0002739_8002_8502 164
284 3300049590 Ga0501074_0190530 Ga0501074_0190530_848_1342 164
285 3300049591 Ga0501075_0004688 Ga0501075_0004688_4934_5428 164
286 3300049592 Ga0501076_0007602 Ga0501076_0007602_5656_6150 164
287 3300049593 Ga0501077_0006635 Ga0501077_0006635_6294_6788 164
288 3300049741 Ga0501079_0017365 Ga0501079_0017365_3939_4433 164
289 3300049742 Ga0501080_0133748 Ga0501080_0133748_1083_1583 164
290 3300049742 Ga0501080_0296614 Ga0501080_0296614_951_1445 164
291 3300049743 Ga0501081_0006867 Ga0501081_0006867_4123_4617 164
292 3300049744 Ga0501083_0013069 Ga0501083_0013069_3275_3775 164
293 3300049824 Ga0501045_0002201 Ga0501045_0002201_6955_7449 164
294 3300050508 nmdc:mga09592_27861_c1 nmdc:mga09592_27861_c1_1746_2240 164
295 3300050510 nmdc:mga06r32_72641_c1 nmdc:mga06r32_72641_c1_1540_2034 164
296 3300050510 nmdc:mga06r32_927643_c1 nmdc:mga06r32_927643_c1_67_561 164
297 3300054114 Ga0501084_0004976 Ga0501084_0004976_4808_5302 164
298 3300060353 Ga0501082_0018922 Ga0501082_0018922_777_1271 164
299 3300061734 Ga0530510_0010398 Ga0530510_0010398_4934_5428 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

31

145

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yx6-assembly3.cif.gz_D-3 crystal structure of ph0822 0.8875 120 145
2yx6-assembly2.cif.gz_C crystal structure of ph0822 0.8783 120 145
8hl5-assembly1.cif.gz_L18E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8534 78 144
6th6-assembly1.cif.gz_BR cryo-em structure of t. kodakarensis 70s ribosome 0.853 76 144
7aoi-assembly1.cif.gz_AP trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.8248 72 141
ID Description Score Start End Superfamily
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.913 75 141 3.100.10.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9058 67 144 3.100.10.10
af_Q54PP3_103_187_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.897 71 144 3.100.10.10
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8955 76 142 3.100.10.10
af_Q10PV6_148_224_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8916 75 142 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A7Z9N4H0-F1-model_v4 50S ribosomal protein L15 0.959 75 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A382ID69-F1-model_v4 Large ribosomal subunit protein uL15/eL18 domain-containing protein 0.9542 78 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A6B3F858-F1-model_v4 50S ribosomal protein L15 0.9513 69 144 GO:0003735
GO:0006412
GO:0022625
AF-A0A2W0BP79-F1-model_v4 50S ribosomal protein L15 0.9421 90 144 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D1D0C7-F1-model_v4 50S ribosomal protein L15 0.9417 67 144 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
73.32 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map