F395049

General Info

Members Datasets Scaffolds Average Seq Length
299 110 293 313

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0162378|Ga0501032_0162378_244_1185
Length 313
Sequence MNIPLFPESASTFAPEVDALFAVLVAFSAGLGTLLVVLILYYAIRYRRGSPAPRVGRRARNLWLEAAWTSATLVVAFGLFAWGAHLYAERETPPANALHIVAIGKQWMWKFQHPDGQREINILHVPVGRPVLVELASQDVIHSLYIPAFRVKQDAVPGMTTNVWFEATRTGSFHLFCAEFCGTEHSAMEGRLVALSPEDYARWLDEQPPSDSPVAAGGMLYRALGCSGCHEPGGTIRAPDLHGVYGRPVALASATTVLADTRYIRDSILMPRKEIAAGYAPVMPSFDGLLDEDELMQLVAYVRSLSDAEAAAR

Samples

Sample ID Description Type Environment
1 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
2 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
3 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
4 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
5 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
47 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.33
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 1
Rhizoplane 0.33
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009109 3300001979 Bacteria 3902
2 JGI24740J21852_10014788 3300001979 Bacteria 2867
3 JGI24740J21852_10048343 3300001979 Bacteria 1236
4 JGI25155J39150_1000003 3300002704 Bacteria 279666
5 JGI25156J39149_1000004 3300002705 Bacteria 273027
6 JGI25154J39366_1000088 3300002738 Bacteria 84250
7 JGI25157J39369_1000004 3300002741 Bacteria 273009
8 JGI25152J39213_1003744 3300002773 Bacteria 5082
9 JGI25151J46595_10001543 3300003187 Bacteria 15373
10 rootH1_10042788 3300003323 Bacteria 5113
11 Ga0070658_10001372 3300005327 Bacteria 20819
12 Ga0070658_10083908 3300005327 Bacteria 2619
13 Ga0070658_10181226 3300005327 Bacteria 1772
14 Ga0070658_10412799 3300005327 Bacteria 1160
15 Ga0070683_100012954 3300005329 Bacteria 7259
16 Ga0070683_100096518 3300005329 Bacteria 2780
17 Ga0070683_100426315 3300005329 Bacteria 1265
18 Ga0070680_100004894 3300005336 Bacteria 10086
19 Ga0070680_100029606 3300005336 Bacteria 4397
20 Ga0070680_100031189 3300005336 Bacteria 4285
21 Ga0070680_100041944 3300005336 Bacteria 3711
22 Ga0070680_100175586 3300005336 Bacteria 1803
23 Ga0070680_100327159 3300005336 Bacteria 1301
24 Ga0070680_100376353 3300005336 Bacteria 1209
25 Ga0070682_100026421 3300005337 Bacteria 3474
26 Ga0070660_100000773 3300005339 Bacteria 21239
27 Ga0070660_100009060 3300005339 Bacteria 6985
28 Ga0070660_100027972 3300005339 Bacteria 4214
29 Ga0070660_100052619 3300005339 Bacteria 3139
30 Ga0070691_10011271 3300005341 Bacteria 4078
31 Ga0070661_100027855 3300005344 Bacteria 4072
32 Ga0070661_100037933 3300005344 Bacteria 3507
33 Ga0070661_100081596 3300005344 Bacteria 2388
34 Ga0070692_10011921 3300005345 Bacteria 4008
35 Ga0070692_10032671 3300005345 Bacteria 2618
36 Ga0070659_100215185 3300005366 Bacteria 1584
37 Ga0070659_100259255 3300005366 Bacteria 1442
38 Ga0070659_100376264 3300005366 Bacteria 1195
39 Ga0070662_100125674 3300005457 Bacteria 1971
40 Ga0070681_10316027 3300005458 Bacteria 1471
41 Ga0070679_100015564 3300005530 Bacteria 7308
42 Ga0070679_100034651 3300005530 Bacteria 5003
43 Ga0070679_100069664 3300005530 Bacteria 3508
44 Ga0070679_100131346 3300005530 Bacteria 2485
45 Ga0070684_100010629 3300005535 Bacteria 7298
46 Ga0070684_100055942 3300005535 Bacteria 3441
47 Ga0070684_100179532 3300005535 Bacteria 1924
48 Ga0068853_100022095 3300005539 Bacteria 5309
49 Ga0068853_100091209 3300005539 Bacteria 2679
50 Ga0068853_100231230 3300005539 Bacteria 1692
51 Ga0068855_100002571 3300005563 Bacteria 22364
52 Ga0068855_100143929 3300005563 Bacteria 2715
53 Ga0068855_100162760 3300005563 Bacteria 2531
54 Ga0068855_100215875 3300005563 Bacteria 2153
55 Ga0068855_100255279 3300005563 Bacteria 1955
56 Ga0070664_100024737 3300005564 Bacteria 4971
57 Ga0068857_100080092 3300005577 Bacteria 2916
58 Ga0068854_100122491 3300005578 Bacteria 1976
59 Ga0068854_100214620 3300005578 Bacteria 1519
60 Ga0068854_100250300 3300005578 Bacteria 1414
61 Ga0068856_100017355 3300005614 Bacteria 6979
62 Ga0068856_100052923 3300005614 Bacteria 4004
63 Ga0068856_100269119 3300005614 Bacteria 1720
64 Ga0068856_100613651 3300005614 Bacteria 1109
65 Ga0068852_100004781 3300005616 Bacteria 9620
66 Ga0068852_100006343 3300005616 Bacteria 8535
67 Ga0068852_100087721 3300005616 Bacteria 2777
68 Ga0068852_100119304 3300005616 Bacteria 2411
69 Ga0068852_100262293 3300005616 Bacteria 1659
70 Ga0068852_100270040 3300005616 Bacteria 1636
71 Ga0068851_10095280 3300005834 Bacteria 1573
72 Ga0068851_10117174 3300005834 Bacteria 1428
73 Ga0105240_10033474 3300009093 Bacteria 6639
74 Ga0105240_10034327 3300009093 Bacteria 6544
75 Ga0105241_10130332 3300009174 Bacteria 2035
76 Ga0105241_10269422 3300009174 Bacteria 1450
77 Ga0105237_10066214 3300009545 Bacteria 3608
78 Ga0105237_10365983 3300009545 Bacteria 1446
79 Ga0105238_10021258 3300009551 Bacteria 6613
80 Ga0105238_10243275 3300009551 Bacteria 1777
81 Ga0105238_10356138 3300009551 Bacteria 1453
82 Ga0105239_10187043 3300010375 Bacteria 2318
83 Ga0157373_10019273 3300013100 Bacteria 4969
84 Ga0157373_10038456 3300013100 Bacteria 3429
85 Ga0157373_10080609 3300013100 Bacteria 2295
86 Ga0157373_10088121 3300013100 Bacteria 2187
87 Ga0157373_10134029 3300013100 Bacteria 1741
88 Ga0157373_10139771 3300013100 Bacteria 1703
89 Ga0157373_10216014 3300013100 Bacteria 1352
90 Ga0157371_10000892 3300013102 Bacteria 33627
91 Ga0157371_10020196 3300013102 Bacteria 4902
92 Ga0157371_10155352 3300013102 Bacteria 1632
93 Ga0157370_10002480 3300013104 Bacteria 22253
94 Ga0157370_10057231 3300013104 Bacteria 3708
95 Ga0157370_10065590 3300013104 Bacteria 3435
96 Ga0157369_10043516 3300013105 Bacteria 4894
97 Ga0157369_10096452 3300013105 Bacteria 3155
98 Ga0157369_10098243 3300013105 Bacteria 3123
99 Ga0157369_10104166 3300013105 Bacteria 3022
100 Ga0157374_10405724 3300013296 Bacteria 1360
101 Ga0206353_11647538 3300020082 Bacteria 2499
102 Ga0209435_100006 3300025206 Bacteria 542459
103 Ga0209646_1000015 3300025246 Bacteria 542459
104 Ga0209026_1000039 3300025250 Bacteria 280608
105 Ga0209759_1000005 3300025256 Bacteria 542459
106 Ga0209129_1000070 3300025258 Bacteria 212476
107 Ga0209025_1000239 3300025294 Bacteria 128436
108 Ga0207656_10011331 3300025321 Bacteria 3367
109 Ga0207647_10007033 3300025904 Bacteria 8160
110 Ga0207647_10011034 3300025904 Bacteria 6354
111 Ga0207647_10032953 3300025904 Bacteria 3322
112 Ga0207705_10000419 3300025909 Bacteria 37164
113 Ga0207705_10007786 3300025909 Bacteria 7868
114 Ga0207705_10020909 3300025909 Bacteria 4669
115 Ga0207705_10074066 3300025909 Bacteria 2471
116 Ga0207705_10084421 3300025909 Bacteria 2318
117 Ga0207705_10113026 3300025909 Bacteria 2008
118 Ga0207705_10149159 3300025909 Bacteria 1751
119 Ga0207707_10210936 3300025912 Bacteria 1692
120 Ga0207695_10044125 3300025913 Bacteria 4745
121 Ga0207695_10325590 3300025913 Bacteria 1426
122 Ga0207671_10038188 3300025914 Bacteria 3559
123 Ga0207671_10247402 3300025914 Bacteria 1401
124 Ga0207660_10001220 3300025917 Bacteria 17201
125 Ga0207660_10001524 3300025917 Bacteria 15540
126 Ga0207660_10136874 3300025917 Bacteria 1869
127 Ga0207660_10333510 3300025917 Bacteria 1213
128 Ga0207657_10000159 3300025919 Bacteria 69260
129 Ga0207657_10003049 3300025919 Bacteria 17918
130 Ga0207657_10012429 3300025919 Bacteria 8409
131 Ga0207657_10018668 3300025919 Bacteria 6610
132 Ga0207657_10029831 3300025919 Bacteria 4958
133 Ga0207657_10052208 3300025919 Bacteria 3549
134 Ga0207657_10053308 3300025919 Bacteria 3504
135 Ga0207657_10100185 3300025919 Bacteria 2405
136 Ga0207649_10047536 3300025920 Bacteria 2642
137 Ga0207652_10025746 3300025921 Bacteria 4894
138 Ga0207652_10058987 3300025921 Bacteria 3307
139 Ga0207694_10065036 3300025924 Bacteria 2843
140 Ga0207694_10108880 3300025924 Bacteria 2202
141 Ga0207694_10174160 3300025924 Bacteria 1743
142 Ga0207664_10157519 3300025929 Bacteria 1934
143 Ga0207664_10319128 3300025929 Bacteria 1371
144 Ga0207690_10058842 3300025932 Bacteria 2601
145 Ga0207690_10242609 3300025932 Bacteria 1388
146 Ga0207706_10002112 3300025933 Bacteria 19449
147 Ga0207706_10141323 3300025933 Bacteria 2118
148 Ga0207661_10002226 3300025944 Bacteria 13382
149 Ga0207661_10028936 3300025944 Bacteria 4249
150 Ga0207661_10213300 3300025944 Bacteria 1703
151 Ga0207679_10236120 3300025945 Bacteria 1546
152 Ga0207667_10000314 3300025949 Bacteria 67212
153 Ga0207667_10006431 3300025949 Bacteria 14231
154 Ga0207667_10028616 3300025949 Bacteria 6050
155 Ga0207667_10063666 3300025949 Bacteria 3853
156 Ga0207667_10081721 3300025949 Bacteria 3347
157 Ga0207667_10207474 3300025949 Bacteria 2009
158 Ga0207640_10050192 3300025981 Bacteria 2705
159 Ga0207640_10105222 3300025981 Bacteria 1988
160 Ga0207640_10164443 3300025981 Bacteria 1646
161 Ga0207639_10017610 3300026041 Bacteria 5067
162 Ga0207639_10041295 3300026041 Bacteria 3450
163 Ga0207639_10415592 3300026041 Bacteria 1215
164 Ga0207678_10027118 3300026067 Bacteria 4995
165 Ga0207678_10054302 3300026067 Bacteria 3450
166 Ga0207678_10205850 3300026067 Bacteria 1683
167 Ga0207702_10009071 3300026078 Bacteria 8372
168 Ga0207702_10020297 3300026078 Bacteria 5503
169 Ga0207702_10126793 3300026078 Bacteria 2293
170 Ga0207702_10355789 3300026078 Bacteria 1402
171 Ga0207674_10001151 3300026116 Bacteria 34261
172 Ga0207674_10010596 3300026116 Bacteria 10430
173 Ga0207674_10016765 3300026116 Bacteria 8007
174 Ga0207674_10021224 3300026116 Bacteria 7000
175 Ga0207674_10026962 3300026116 Bacteria 6091
176 Ga0207698_10010901 3300026142 Bacteria 5869
177 Ga0207698_10012327 3300026142 Bacteria 5591
178 Ga0207698_10014443 3300026142 Bacteria 5250
179 Ga0207698_10136909 3300026142 Bacteria 2103
180 Ga0209371_1000591 3300027312 Bacteria 32498
181 Ga0268256_1009215 3300030500 Bacteria 3307
182 Ga0395899_0002359 3300037312 Bacteria 15373
183 Ga0395899_0014162 3300037312 Bacteria 6085
184 Ga0395899_0023961 3300037312 Bacteria 4617
185 Ga0395899_0028000 3300037312 Bacteria 4243
186 Ga0395899_0029583 3300037312 Bacteria 4120
187 Ga0395899_0055803 3300037312 Bacteria 2921
188 Ga0395899_0138183 3300037312 Bacteria 1735
189 Ga0395900_0003060 3300037418 Bacteria 18209
190 Ga0395900_0020634 3300037418 Bacteria 6732
191 Ga0395900_0038428 3300037418 Bacteria 4932
192 Ga0395900_0049335 3300037418 Bacteria 4336
193 Ga0395900_0058197 3300037418 Bacteria 3978
194 Ga0395900_0063717 3300037418 Bacteria 3789
195 Ga0395900_0084752 3300037418 Bacteria 3257
196 Ga0395900_0127642 3300037418 Bacteria 2607
197 Ga0395900_0132949 3300037418 Bacteria 2549
198 Ga0395900_0133192 3300037418 Bacteria 2546
199 Ga0395900_0141887 3300037418 Bacteria 2459
200 Ga0395900_0173550 3300037418 Bacteria 2193
201 Ga0395900_0535451 3300037418 Bacteria 1117
202 Ga0395898_0004355 3300037466 Bacteria 15496
203 Ga0395898_0033031 3300037466 Bacteria 5165
204 Ga0395898_0033058 3300037466 Bacteria 5163
205 Ga0395898_0036093 3300037466 Bacteria 4910
206 Ga0395898_0178351 3300037466 Bacteria 2030
207 Ga0395898_0461288 3300037466 Bacteria 1209
208 Ga0395905_0035459 3300037471 Bacteria 4684
209 Ga0395905_0047218 3300037471 Bacteria 4036
210 Ga0395905_0061444 3300037471 Bacteria 3514
211 Ga0395905_0065625 3300037471 Bacteria 3398
212 Ga0395905_0074535 3300037471 Bacteria 3180
213 Ga0395905_0119550 3300037471 Bacteria 2476
214 Ga0395905_0175170 3300037471 Bacteria 2014
215 Ga0395905_0177434 3300037471 Bacteria 2000
216 Ga0395905_0223404 3300037471 Bacteria 1762
217 Ga0395905_0292579 3300037471 Bacteria 1515
218 Ga0395905_0493349 3300037471 Bacteria 1124
219 Ga0395901_0002327 3300038443 Bacteria 19364
220 Ga0395901_0005170 3300038443 Bacteria 13166
221 Ga0395901_0008749 3300038443 Bacteria 10238
222 Ga0395901_0042743 3300038443 Bacteria 4699
223 Ga0395901_0068129 3300038443 Bacteria 3707
224 Ga0395901_0081188 3300038443 Bacteria 3387
225 Ga0395901_0086750 3300038443 Bacteria 3272
226 Ga0395901_0132549 3300038443 Bacteria 2618
227 Ga0395901_0158794 3300038443 Bacteria 2374
228 Ga0395901_0163794 3300038443 Bacteria 2335
229 Ga0395901_0193040 3300038443 Bacteria 2135
230 Ga0395901_0212822 3300038443 Bacteria 2022
231 Ga0395901_0214856 3300038443 Bacteria 2011
232 Ga0395901_0336499 3300038443 Bacteria 1560
233 Ga0436360_0803732 3300039438 Bacteria 1675
234 Ga0466972_0047946 3300044658 Bacteria 2065
235 Ga0466965_0112881 3300044683 Bacteria 1398
236 Ga0466965_0235769 3300044683 Bacteria 978
237 Ga0466966_0017112 3300044684 Bacteria 4796
238 Ga0466961_0024834 3300044693 Bacteria 3855
239 Ga0466961_0075459 3300044693 Bacteria 2137
240 Ga0466963_0000208 3300044694 Bacteria 24989
241 Ga0466963_0040798 3300044694 Bacteria 3043
242 Ga0466963_0045421 3300044694 Bacteria 2893
243 Ga0466964_0015933 3300044706 Bacteria 2864
244 Ga0466971_0063477 3300044719 Bacteria 1672
245 Ga0466968_0004433 3300044735 Bacteria 5250
246 Ga0466970_0000181 3300044765 Bacteria 30258
247 Ga0466970_0091947 3300044765 Bacteria 1647
248 Ga0466970_0107971 3300044765 Bacteria 1519
249 Ga0466957_0001777 3300044842 Bacteria 11344
250 Ga0466957_0270089 3300044842 Bacteria 1135
251 Ga0466959_0060999 3300045049 Bacteria 2743
252 Ga0466959_0112310 3300045049 Bacteria 1944
253 Ga0466958_0000543 3300045836 Bacteria 16041
254 Ga0466958_0014733 3300045836 Bacteria 4466
255 Ga0466958_0016109 3300045836 Bacteria 4300
256 Ga0466958_0039011 3300045836 Bacteria 2852
257 Ga0466958_0048935 3300045836 Bacteria 2556
258 Ga0466958_0140721 3300045836 Bacteria 1519
259 Ga0466967_0000567 3300045976 Bacteria 18158
260 Ga0466967_0003532 3300045976 Bacteria 10231
261 Ga0466967_0005247 3300045976 Bacteria 8932
262 Ga0466967_0008683 3300045976 Bacteria 7476
263 Ga0466967_0028037 3300045976 Bacteria 4695
264 Ga0466967_0028238 3300045976 Bacteria 4681
265 Ga0466967_0042381 3300045976 Bacteria 3933
266 Ga0466967_0093736 3300045976 Bacteria 2733
267 Ga0466967_0096335 3300045976 Bacteria 2699
268 Ga0466967_0102604 3300045976 Bacteria 2617
269 Ga0466967_0102638 3300045976 Bacteria 2616
270 Ga0466967_0103600 3300045976 Bacteria 2604
271 Ga0466967_0150784 3300045976 Bacteria 2173
272 Ga0466967_0282205 3300045976 Bacteria 1594
273 Ga0466967_0543932 3300045976 Bacteria 1143
274 Ga0501032_0162378 3300049569 Bacteria 1467
275 Ga0501034_0114740 3300049571 Bacteria 2682
276 Ga0501036_0052735 3300049572 Bacteria 3445
277 Ga0501043_0037599 3300049579 Bacteria 3807
278 Ga0501046_0205370 3300049580 Bacteria 1465
279 Ga0501046_0318893 3300049580 Bacteria 1133
280 Ga0501047_0029642 3300049581 Bacteria 5276
281 Ga0501047_0062477 3300049581 Bacteria 3592
282 Ga0501067_0062496 3300049583 Bacteria 2061
283 Ga0501069_0180997 3300049585 Bacteria 1218
284 Ga0501074_0021496 3300049590 Bacteria 4684
285 Ga0501080_0026725 3300049742 Bacteria 5364
286 Ga0501080_0163788 3300049742 Bacteria 2053
287 Ga0501083_0006063 3300049744 Bacteria 8563
288 Ga0501083_0044738 3300049744 Bacteria 2996
289 Ga0501083_0052512 3300049744 Bacteria 2738
290 Ga0501035_0157755 3300049822 Bacteria 1966
291 Ga0501084_0135367 3300054114 Bacteria 2074
292 Ga0501084_0224676 3300054114 Bacteria 1584
293 Ga0501082_0115978 3300060353 Bacteria 2319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0016109 Ga0466958_0016109_3514_4284 254
2 3300044683 Ga0466965_0112881 Ga0466965_0112881_19_849 274
3 3300038443 Ga0395901_0163794 Ga0395901_0163794_1235_2185 280
4 3300049572 Ga0501036_0052735 Ga0501036_0052735_688_1629 289
5 3300026067 Ga0207678_10054302 Ga0207678_100543022 294
6 3300037418 Ga0395900_0535451 Ga0395900_0535451_53_940 295
7 3300037471 Ga0395905_0047218 Ga0395905_0047218_2327_3214 295
8 3300037471 Ga0395905_0074535 Ga0395905_0074535_2241_3128 295
9 3300037471 Ga0395905_0223404 Ga0395905_0223404_823_1710 295
10 3300038443 Ga0395901_0008749 Ga0395901_0008749_4722_5609 295
11 3300038443 Ga0395901_0086750 Ga0395901_0086750_53_940 295
12 3300005457 Ga0070662_100125674 Ga0070662_1001256742 300
13 3300005578 Ga0068854_100122491 Ga0068854_1001224912 300
14 3300005616 Ga0068852_100119304 Ga0068852_1001193042 300
15 3300025919 Ga0207657_10018668 Ga0207657_100186686 300
16 3300025933 Ga0207706_10141323 Ga0207706_101413232 300
17 3300025945 Ga0207679_10236120 Ga0207679_102361202 300
18 3300026142 Ga0207698_10136909 Ga0207698_101369093 300
19 3300045976 Ga0466967_0102604 Ga0466967_0102604_35_982 300
20 3300044693 Ga0466961_0075459 Ga0466961_0075459_503_1453 304
21 3300044694 Ga0466963_0045421 Ga0466963_0045421_643_1593 304
22 3300045836 Ga0466958_0048935 Ga0466958_0048935_703_1653 304
23 3300045976 Ga0466967_0042381 Ga0466967_0042381_2458_3375 305
24 3300005614 Ga0068856_100613651 Ga0068856_1006136512 306
25 iso_pu_bacteria 2524023209 2524457455 307
26 iso_pu_bacteria 2667528174 2671116679 307
27 iso_pu_bacteria 2842298080 2842298988 307
28 iso_pu_bacteria 2842357229 2842358453 307
29 iso_pu_bacteria 3005416602 3005422425 307
30 iso_pu_bacteria 8005682033 8005686135 307
31 3300002773 JGI25152J39213_1003744 JGI25152J39213_10037442 308
32 3300003187 JGI25151J46595_10001543 JGI25151J46595_1000154317 308
33 3300025258 Ga0209129_1000070 Ga0209129_1000070220 308
34 3300025294 Ga0209025_1000239 Ga0209025_100023953 308
35 3300039438 Ga0436360_0803732 Ga0436360_0803732_662_1591 308
36 3300002704 JGI25155J39150_1000003 JGI25155J39150_1000003232 311
37 3300002705 JGI25156J39149_1000004 JGI25156J39149_1000004226 311
38 3300002738 JGI25154J39366_1000088 JGI25154J39366_100008850 311
39 3300002741 JGI25157J39369_1000004 JGI25157J39369_100000450 311
40 3300003323 rootH1_10042788 rootH1_100427882 311
41 3300005614 Ga0068856_100052923 Ga0068856_1000529232 311
42 3300025206 Ga0209435_100006 Ga0209435_10000651 311
43 3300025246 Ga0209646_1000015 Ga0209646_1000015483 311
44 3300025250 Ga0209026_1000039 Ga0209026_100003951 311
45 3300025256 Ga0209759_1000005 Ga0209759_100000551 311
46 3300026078 Ga0207702_10020297 Ga0207702_100202972 311
47 3300027312 Ga0209371_1000591 Ga0209371_100059121 311
48 3300030500 Ga0268256_1009215 Ga0268256_10092152 311
49 3300044694 Ga0466963_0040798 Ga0466963_0040798_1857_2798 311
50 3300044719 Ga0466971_0063477 Ga0466971_0063477_658_1599 311
51 3300044765 Ga0466970_0000181 Ga0466970_0000181_16012_16953 311
52 3300045976 Ga0466967_0003532 Ga0466967_0003532_2447_3388 311
53 3300045976 Ga0466967_0103600 Ga0466967_0103600_1237_2178 311
54 3300049579 Ga0501043_0037599 Ga0501043_0037599_592_1533 311
55 3300049742 Ga0501080_0163788 Ga0501080_0163788_947_1888 311
56 3300005563 Ga0068855_100215875 Ga0068855_1002158753 312
57 3300049571 Ga0501034_0114740 Ga0501034_0114740_974_1912 312
58 3300049580 Ga0501046_0318893 Ga0501046_0318893_110_1048 312
59 3300049581 Ga0501047_0029642 Ga0501047_0029642_3307_4245 312
60 3300049581 Ga0501047_0062477 Ga0501047_0062477_1767_2705 312
61 3300049583 Ga0501067_0062496 Ga0501067_0062496_560_1498 312
62 3300049585 Ga0501069_0180997 Ga0501069_0180997_145_1083 312
63 3300049590 Ga0501074_0021496 Ga0501074_0021496_523_1461 312
64 3300049742 Ga0501080_0026725 Ga0501080_0026725_132_1070 312
65 3300049744 Ga0501083_0006063 Ga0501083_0006063_2437_3375 312
66 3300049744 Ga0501083_0044738 Ga0501083_0044738_1038_1976 312
67 3300049744 Ga0501083_0052512 Ga0501083_0052512_543_1481 312
68 3300049822 Ga0501035_0157755 Ga0501035_0157755_417_1355 312
69 3300054114 Ga0501084_0135367 Ga0501084_0135367_139_1077 312
70 3300054114 Ga0501084_0224676 Ga0501084_0224676_401_1339 312
71 3300060353 Ga0501082_0115978 Ga0501082_0115978_1127_2065 312
72 3300001979 JGI24740J21852_10048343 JGI24740J21852_100483431 313
73 3300005327 Ga0070658_10412799 Ga0070658_104127991 313
74 3300005336 Ga0070680_100327159 Ga0070680_1003271591 313
75 3300005337 Ga0070682_100026421 Ga0070682_1000264212 313
76 3300005339 Ga0070660_100009060 Ga0070660_1000090607 313
77 3300005530 Ga0070679_100034651 Ga0070679_1000346515 313
78 3300005535 Ga0070684_100179532 Ga0070684_1001795323 313
79 3300005539 Ga0068853_100231230 Ga0068853_1002312302 313
80 3300005614 Ga0068856_100017355 Ga0068856_1000173556 313
81 3300013100 Ga0157373_10216014 Ga0157373_102160142 313
82 3300025904 Ga0207647_10032953 Ga0207647_100329532 313
83 3300025919 Ga0207657_10012429 Ga0207657_100124292 313
84 3300025919 Ga0207657_10029831 Ga0207657_100298316 313
85 3300025921 Ga0207652_10025746 Ga0207652_100257461 313
86 3300025932 Ga0207690_10058842 Ga0207690_100588422 313
87 3300025933 Ga0207706_10002112 Ga0207706_1000211213 313
88 3300026116 Ga0207674_10016765 Ga0207674_100167656 313
89 3300037418 Ga0395900_0003060 Ga0395900_0003060_10908_11849 313
90 3300038443 Ga0395901_0042743 Ga0395901_0042743_1265_2206 313
91 3300049569 Ga0501032_0162378 Ga0501032_0162378_244_1185 313
92 3300049580 Ga0501046_0205370 Ga0501046_0205370_174_1115 313
93 3300005329 Ga0070683_100426315 Ga0070683_1004263152 314
94 3300005336 Ga0070680_100004894 Ga0070680_1000048947 314
95 3300005336 Ga0070680_100029606 Ga0070680_1000296064 314
96 3300005336 Ga0070680_100041944 Ga0070680_1000419442 314
97 3300005336 Ga0070680_100376353 Ga0070680_1003763532 314
98 3300005339 Ga0070660_100027972 Ga0070660_1000279724 314
99 3300005345 Ga0070692_10011921 Ga0070692_100119212 314
100 3300005458 Ga0070681_10316027 Ga0070681_103160272 314
101 3300005530 Ga0070679_100015564 Ga0070679_1000155643 314
102 3300005530 Ga0070679_100069664 Ga0070679_1000696642 314
103 3300005563 Ga0068855_100143929 Ga0068855_1001439292 314
104 3300005563 Ga0068855_100162760 Ga0068855_1001627602 314
105 3300005577 Ga0068857_100080092 Ga0068857_1000800922 314
106 3300005578 Ga0068854_100250300 Ga0068854_1002503002 314
107 3300005614 Ga0068856_100269119 Ga0068856_1002691192 314
108 3300005616 Ga0068852_100004781 Ga0068852_1000047819 314
109 3300005616 Ga0068852_100006343 Ga0068852_1000063435 314
110 3300009093 Ga0105240_10033474 Ga0105240_100334742 314
111 3300009174 Ga0105241_10269422 Ga0105241_102694221 314
112 3300009551 Ga0105238_10356138 Ga0105238_103561382 314
113 3300013100 Ga0157373_10134029 Ga0157373_101340292 314
114 3300013100 Ga0157373_10139771 Ga0157373_101397712 314
115 3300013102 Ga0157371_10020196 Ga0157371_100201966 314
116 3300013102 Ga0157371_10155352 Ga0157371_101553522 314
117 3300013104 Ga0157370_10002480 Ga0157370_100024803 314
118 3300013104 Ga0157370_10065590 Ga0157370_100655903 314
119 3300013105 Ga0157369_10043516 Ga0157369_100435164 314
120 3300013105 Ga0157369_10098243 Ga0157369_100982432 314
121 3300020082 Ga0206353_11647538 Ga0206353_116475382 314
122 3300025909 Ga0207705_10074066 Ga0207705_100740662 314
123 3300025909 Ga0207705_10113026 Ga0207705_101130262 314
124 3300025912 Ga0207707_10210936 Ga0207707_102109362 314
125 3300025917 Ga0207660_10001220 Ga0207660_1000122019 314
126 3300025917 Ga0207660_10001524 Ga0207660_100015245 314
127 3300025919 Ga0207657_10053308 Ga0207657_100533082 314
128 3300025921 Ga0207652_10058987 Ga0207652_100589872 314
129 3300025924 Ga0207694_10065036 Ga0207694_100650362 314
130 3300025924 Ga0207694_10108880 Ga0207694_101088802 314
131 3300025929 Ga0207664_10319128 Ga0207664_103191282 314
132 3300025944 Ga0207661_10213300 Ga0207661_102133002 314
133 3300025949 Ga0207667_10006431 Ga0207667_100064314 314
134 3300025949 Ga0207667_10063666 Ga0207667_100636662 314
135 3300025949 Ga0207667_10207474 Ga0207667_102074742 314
136 3300026041 Ga0207639_10041295 Ga0207639_100412953 314
137 3300026067 Ga0207678_10205850 Ga0207678_102058502 314
138 3300026078 Ga0207702_10355789 Ga0207702_103557891 314
139 3300026116 Ga0207674_10010596 Ga0207674_100105966 314
140 3300026142 Ga0207698_10012327 Ga0207698_100123274 314
141 3300037312 Ga0395899_0002359 Ga0395899_0002359_2607_3551 314
142 3300037312 Ga0395899_0023961 Ga0395899_0023961_131_1075 314
143 3300037312 Ga0395899_0029583 Ga0395899_0029583_3157_4101 314
144 3300037312 Ga0395899_0055803 Ga0395899_0055803_485_1429 314
145 3300037312 Ga0395899_0138183 Ga0395899_0138183_362_1306 314
146 3300037418 Ga0395900_0020634 Ga0395900_0020634_5383_6327 314
147 3300037418 Ga0395900_0038428 Ga0395900_0038428_1164_2108 314
148 3300037418 Ga0395900_0049335 Ga0395900_0049335_1987_2931 314
149 3300037418 Ga0395900_0063717 Ga0395900_0063717_1392_2336 314
150 3300037418 Ga0395900_0084752 Ga0395900_0084752_876_1820 314
151 3300037418 Ga0395900_0141887 Ga0395900_0141887_567_1511 314
152 3300037418 Ga0395900_0173550 Ga0395900_0173550_198_1142 314
153 3300037466 Ga0395898_0004355 Ga0395898_0004355_11304_12248 314
154 3300037466 Ga0395898_0033058 Ga0395898_0033058_2624_3568 314
155 3300037466 Ga0395898_0036093 Ga0395898_0036093_1211_2155 314
156 3300037466 Ga0395898_0178351 Ga0395898_0178351_989_1933 314
157 3300037466 Ga0395898_0461288 Ga0395898_0461288_194_1138 314
158 3300037471 Ga0395905_0061444 Ga0395905_0061444_820_1764 314
159 3300037471 Ga0395905_0065625 Ga0395905_0065625_1931_2875 314
160 3300037471 Ga0395905_0119550 Ga0395905_0119550_1138_2082 314
161 3300037471 Ga0395905_0493349 Ga0395905_0493349_48_992 314
162 3300038443 Ga0395901_0002327 Ga0395901_0002327_5595_6539 314
163 3300038443 Ga0395901_0068129 Ga0395901_0068129_189_1133 314
164 3300038443 Ga0395901_0132549 Ga0395901_0132549_876_1820 314
165 3300038443 Ga0395901_0158794 Ga0395901_0158794_944_1888 314
166 3300038443 Ga0395901_0193040 Ga0395901_0193040_594_1538 314
167 3300038443 Ga0395901_0212822 Ga0395901_0212822_280_1224 314
168 3300038443 Ga0395901_0214856 Ga0395901_0214856_692_1636 314
169 3300038443 Ga0395901_0336499 Ga0395901_0336499_274_1218 314
170 3300044684 Ga0466966_0017112 Ga0466966_0017112_293_1237 314
171 3300044694 Ga0466963_0000208 Ga0466963_0000208_4894_5838 314
172 3300044706 Ga0466964_0015933 Ga0466964_0015933_638_1582 314
173 3300044765 Ga0466970_0107971 Ga0466970_0107971_190_1134 314
174 3300044842 Ga0466957_0001777 Ga0466957_0001777_2657_3601 314
175 3300045049 Ga0466959_0060999 Ga0466959_0060999_442_1386 314
176 3300045836 Ga0466958_0000543 Ga0466958_0000543_12915_13859 314
177 3300045836 Ga0466958_0014733 Ga0466958_0014733_1727_2671 314
178 3300045976 Ga0466967_0000567 Ga0466967_0000567_4894_5838 314
179 3300045976 Ga0466967_0008683 Ga0466967_0008683_3859_4803 314
180 3300045976 Ga0466967_0028037 Ga0466967_0028037_606_1550 314
181 3300045976 Ga0466967_0028238 Ga0466967_0028238_1640_2584 314
182 3300045976 Ga0466967_0150784 Ga0466967_0150784_486_1430 314
183 3300045976 Ga0466967_0282205 Ga0466967_0282205_628_1572 314
184 3300045976 Ga0466967_0543932 Ga0466967_0543932_186_1130 314
185 3300001979 JGI24740J21852_10009109 JGI24740J21852_100091093 315
186 3300001979 JGI24740J21852_10014788 JGI24740J21852_100147883 315
187 3300005327 Ga0070658_10001372 Ga0070658_100013726 315
188 3300005327 Ga0070658_10083908 Ga0070658_100839082 315
189 3300005327 Ga0070658_10181226 Ga0070658_101812262 315
190 3300005329 Ga0070683_100012954 Ga0070683_1000129544 315
191 3300005329 Ga0070683_100096518 Ga0070683_1000965182 315
192 3300005336 Ga0070680_100031189 Ga0070680_1000311892 315
193 3300005336 Ga0070680_100175586 Ga0070680_1001755862 315
194 3300005339 Ga0070660_100000773 Ga0070660_1000007736 315
195 3300005339 Ga0070660_100052619 Ga0070660_1000526192 315
196 3300005341 Ga0070691_10011271 Ga0070691_100112714 315
197 3300005344 Ga0070661_100027855 Ga0070661_1000278555 315
198 3300005344 Ga0070661_100037933 Ga0070661_1000379332 315
199 3300005344 Ga0070661_100081596 Ga0070661_1000815962 315
200 3300005345 Ga0070692_10032671 Ga0070692_100326712 315
201 3300005366 Ga0070659_100215185 Ga0070659_1002151852 315
202 3300005366 Ga0070659_100259255 Ga0070659_1002592551 315
203 3300005366 Ga0070659_100376264 Ga0070659_1003762641 315
204 3300005530 Ga0070679_100131346 Ga0070679_1001313463 315
205 3300005535 Ga0070684_100010629 Ga0070684_1000106295 315
206 3300005535 Ga0070684_100055942 Ga0070684_1000559425 315
207 3300005539 Ga0068853_100022095 Ga0068853_1000220952 315
208 3300005539 Ga0068853_100091209 Ga0068853_1000912092 315
209 3300005563 Ga0068855_100002571 Ga0068855_1000025713 315
210 3300005563 Ga0068855_100255279 Ga0068855_1002552792 315
211 3300005564 Ga0070664_100024737 Ga0070664_1000247375 315
212 3300005578 Ga0068854_100214620 Ga0068854_1002146202 315
213 3300005616 Ga0068852_100087721 Ga0068852_1000877214 315
214 3300005616 Ga0068852_100262293 Ga0068852_1002622932 315
215 3300005616 Ga0068852_100270040 Ga0068852_1002700402 315
216 3300005834 Ga0068851_10095280 Ga0068851_100952801 315
217 3300005834 Ga0068851_10117174 Ga0068851_101171742 315
218 3300009093 Ga0105240_10034327 Ga0105240_100343274 315
219 3300009174 Ga0105241_10130332 Ga0105241_101303322 315
220 3300009545 Ga0105237_10066214 Ga0105237_100662143 315
221 3300009545 Ga0105237_10365983 Ga0105237_103659831 315
222 3300009551 Ga0105238_10021258 Ga0105238_100212585 315
223 3300009551 Ga0105238_10243275 Ga0105238_102432752 315
224 3300010375 Ga0105239_10187043 Ga0105239_101870432 315
225 3300013100 Ga0157373_10019273 Ga0157373_100192733 315
226 3300013100 Ga0157373_10038456 Ga0157373_100384562 315
227 3300013100 Ga0157373_10080609 Ga0157373_100806092 315
228 3300013100 Ga0157373_10088121 Ga0157373_100881212 315
229 3300013102 Ga0157371_10000892 Ga0157371_1000089215 315
230 3300013104 Ga0157370_10057231 Ga0157370_100572312 315
231 3300013105 Ga0157369_10096452 Ga0157369_100964522 315
232 3300013105 Ga0157369_10104166 Ga0157369_101041662 315
233 3300013296 Ga0157374_10405724 Ga0157374_104057242 315
234 3300025321 Ga0207656_10011331 Ga0207656_100113311 315
235 3300025904 Ga0207647_10007033 Ga0207647_100070333 315
236 3300025904 Ga0207647_10011034 Ga0207647_100110342 315
237 3300025909 Ga0207705_10000419 Ga0207705_1000041917 315
238 3300025909 Ga0207705_10007786 Ga0207705_100077863 315
239 3300025909 Ga0207705_10020909 Ga0207705_100209094 315
240 3300025909 Ga0207705_10084421 Ga0207705_100844213 315
241 3300025909 Ga0207705_10149159 Ga0207705_101491592 315
242 3300025913 Ga0207695_10044125 Ga0207695_100441256 315
243 3300025913 Ga0207695_10325590 Ga0207695_103255902 315
244 3300025914 Ga0207671_10038188 Ga0207671_100381882 315
245 3300025914 Ga0207671_10247402 Ga0207671_102474022 315
246 3300025917 Ga0207660_10136874 Ga0207660_101368742 315
247 3300025917 Ga0207660_10333510 Ga0207660_103335102 315
248 3300025919 Ga0207657_10000159 Ga0207657_1000015919 315
249 3300025919 Ga0207657_10003049 Ga0207657_1000304915 315
250 3300025919 Ga0207657_10052208 Ga0207657_100522082 315
251 3300025919 Ga0207657_10100185 Ga0207657_101001852 315
252 3300025920 Ga0207649_10047536 Ga0207649_100475362 315
253 3300025924 Ga0207694_10174160 Ga0207694_101741602 315
254 3300025929 Ga0207664_10157519 Ga0207664_101575193 315
255 3300025932 Ga0207690_10242609 Ga0207690_102426092 315
256 3300025944 Ga0207661_10002226 Ga0207661_1000222616 315
257 3300025944 Ga0207661_10028936 Ga0207661_100289362 315
258 3300025949 Ga0207667_10000314 Ga0207667_1000031464 315
259 3300025949 Ga0207667_10028616 Ga0207667_100286165 315
260 3300025949 Ga0207667_10081721 Ga0207667_100817213 315
261 3300025981 Ga0207640_10050192 Ga0207640_100501924 315
262 3300025981 Ga0207640_10105222 Ga0207640_101052222 315
263 3300025981 Ga0207640_10164443 Ga0207640_101644432 315
264 3300026041 Ga0207639_10017610 Ga0207639_100176104 315
265 3300026041 Ga0207639_10415592 Ga0207639_104155922 315
266 3300026067 Ga0207678_10027118 Ga0207678_100271184 315
267 3300026078 Ga0207702_10009071 Ga0207702_100090719 315
268 3300026078 Ga0207702_10126793 Ga0207702_101267932 315
269 3300026116 Ga0207674_10001151 Ga0207674_1000115118 315
270 3300026116 Ga0207674_10021224 Ga0207674_100212245 315
271 3300026116 Ga0207674_10026962 Ga0207674_100269625 315
272 3300026142 Ga0207698_10010901 Ga0207698_100109018 315
273 3300026142 Ga0207698_10014443 Ga0207698_100144436 315
274 3300037312 Ga0395899_0014162 Ga0395899_0014162_4832_5782 315
275 3300037312 Ga0395899_0028000 Ga0395899_0028000_1588_2535 315
276 3300037418 Ga0395900_0058197 Ga0395900_0058197_2704_3654 315
277 3300037418 Ga0395900_0127642 Ga0395900_0127642_1032_1979 315
278 3300037418 Ga0395900_0132949 Ga0395900_0132949_811_1758 315
279 3300037418 Ga0395900_0133192 Ga0395900_0133192_163_1110 315
280 3300037466 Ga0395898_0033031 Ga0395898_0033031_3562_4509 315
281 3300037471 Ga0395905_0035459 Ga0395905_0035459_3215_4162 315
282 3300037471 Ga0395905_0175170 Ga0395905_0175170_241_1191 315
283 3300037471 Ga0395905_0177434 Ga0395905_0177434_954_1904 315
284 3300037471 Ga0395905_0292579 Ga0395905_0292579_326_1273 315
285 3300038443 Ga0395901_0005170 Ga0395901_0005170_8313_9263 315
286 3300038443 Ga0395901_0081188 Ga0395901_0081188_222_1172 315
287 3300044658 Ga0466972_0047946 Ga0466972_0047946_249_1196 315
288 3300044683 Ga0466965_0235769 Ga0466965_0235769_15_962 315
289 3300044693 Ga0466961_0024834 Ga0466961_0024834_1341_2288 315
290 3300044735 Ga0466968_0004433 Ga0466968_0004433_1937_2884 315
291 3300044765 Ga0466970_0091947 Ga0466970_0091947_523_1470 315
292 3300044842 Ga0466957_0270089 Ga0466957_0270089_144_1091 315
293 3300045049 Ga0466959_0112310 Ga0466959_0112310_875_1825 315
294 3300045836 Ga0466958_0039011 Ga0466958_0039011_1021_1968 315
295 3300045836 Ga0466958_0140721 Ga0466958_0140721_100_1047 315
296 3300045976 Ga0466967_0005247 Ga0466967_0005247_1563_2528 315
297 3300045976 Ga0466967_0093736 Ga0466967_0093736_219_1166 315
298 3300045976 Ga0466967_0096335 Ga0466967_0096335_789_1736 315
299 3300045976 Ga0466967_0102638 Ga0466967_0102638_22_969 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

117

194

0.95

PF00034

Cytochrom_C

Cytochrome c

214

306

0.78

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

212

302

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9097 93 208
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.9094 97 207
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.8755 117 209
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.8747 117 209
1w2l-assembly1.cif.gz_A cytochrome c domain of caa3 oxygen oxidoreductase 0.8745 212 306
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.931 122 204 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8932 91 208 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8815 100 206 2.60.40.420
af_P9WP69_149_325_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8758 100 207 2.60.40.420
1w2lA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8745 212 306 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A3D4PXL4-F1-model_v4 Cytochrome c oxidase subunit II 0.9619 122 208 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A812IPE1-F1-model_v4 CoxN protein 0.9512 122 208 GO:0004129
GO:0005507
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A2V8PE98-F1-model_v4 Cytochrome-c oxidase 0.9428 123 197 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A3M1YEC9-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.939 123 201 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-B2YKU2-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.934 122 203 GO:0004129
GO:0005507
GO:0005743

Feature Viewer

pLDDT pTM Quality
78.41 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map