F395045

General Info

Members Datasets Scaffolds Average Seq Length
299 176 598 193

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0045213|Ga0501031_0045213_1379_2014
Length 211
Sequence MGMKLVVGLGNPGAEYRDTRHNVGFQVVDELARRWGVDQWREAFESLASKTVRNGEPVLLCKPLTFMNLSGRAVAAVAGFYKVAIEDLLIVTDDVALPLARLRVRRGGSDGGHNGLKSVAQSLGTPDYARLRIGVGRGDVQAADGSVVGRPGMADHVLGRFRPGERETISAAILRAADASEMFIAEGIERVMNAFNAAERQDGTRDPESAA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 4.68
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0045213 3300049568 Bacteria 2873
2 Ga0065715_10260943 3300005293 Bacteria 1080
3 Ga0070683_100000094 3300005329 Bacteria 58242
4 Ga0070683_100113459 3300005329 Bacteria 2558
5 Ga0070690_100450791 3300005330 Unclassified 954
6 Ga0070670_100004478 3300005331 Bacteria 11706
7 Ga0070670_100006909 3300005331 Bacteria 9618
8 Ga0070670_100008888 3300005331 Bacteria 8576
9 Ga0070666_10027592 3300005335 Bacteria 3720
10 Ga0070660_100363465 3300005339 Bacteria 1193
11 Ga0070661_100000392 3300005344 Bacteria 33974
12 Ga0070661_100001504 3300005344 Bacteria 16216
13 Ga0070669_100122210 3300005353 Unclassified 1988
14 Ga0070675_100343826 3300005354 Bacteria 1322
15 Ga0070675_100391707 3300005354 Unclassified 1238
16 Ga0070675_100746197 3300005354 Bacteria 893
17 Ga0070671_100354726 3300005355 Bacteria 1252
18 Ga0070674_100073985 3300005356 Bacteria 2417
19 Ga0070673_100565707 3300005364 Unclassified 1034
20 Ga0070673_101224893 3300005364 Bacteria 704
21 Ga0070659_100014688 3300005366 Bacteria 5855
22 Ga0070659_100112982 3300005366 Bacteria 2194
23 Ga0070659_100171796 3300005366 Bacteria 1776
24 Ga0070659_100184607 3300005366 Bacteria 1712
25 Ga0070714_100082256 3300005435 Bacteria 2805
26 Ga0070694_100539586 3300005444 Unclassified 933
27 Ga0070663_100031649 3300005455 Bacteria 3638
28 Ga0070662_100101790 3300005457 Bacteria 2175
29 Ga0070662_100261577 3300005457 Bacteria 1394
30 Ga0070662_100459376 3300005457 Bacteria 1058
31 Ga0070681_10010817 3300005458 Bacteria 9019
32 Ga0070706_100104627 3300005467 Bacteria 2633
33 Ga0070707_100203670 3300005468 Unclassified 1929
34 Ga0070698_100219753 3300005471 Bacteria 1834
35 Ga0070699_100028109 3300005518 Bacteria 4850
36 Ga0070699_100556937 3300005518 Unclassified 1044
37 Ga0070679_100016516 3300005530 Bacteria 7125
38 Ga0070679_100218626 3300005530 Unclassified 1867
39 Ga0070684_100000166 3300005535 Bacteria 45212
40 Ga0070697_100292225 3300005536 Bacteria 1400
41 Ga0068853_100010863 3300005539 Bacteria 7378
42 Ga0068853_101247061 3300005539 Bacteria 718
43 Ga0070672_100253459 3300005543 Bacteria 1483
44 Ga0070696_100446716 3300005546 Bacteria 1019
45 Ga0070693_100165471 3300005547 Bacteria 1412
46 Ga0070704_100289376 3300005549 Bacteria 1361
47 Ga0068855_100014652 3300005563 Bacteria 9442
48 Ga0070664_100000479 3300005564 Bacteria 30222
49 Ga0070664_100005036 3300005564 Bacteria 10589
50 Ga0070664_100015089 3300005564 Bacteria 6308
51 Ga0070664_100236971 3300005564 Bacteria 1637
52 Ga0068857_100000227 3300005577 Bacteria 37461
53 Ga0068857_100783017 3300005577 Unclassified 910
54 Ga0068857_101302526 3300005577 Bacteria 705
55 Ga0068854_100012371 3300005578 Bacteria 5587
56 Ga0068854_100282404 3300005578 Bacteria 1337
57 Ga0068856_100008422 3300005614 Bacteria 10041
58 Ga0068852_100021228 3300005616 Bacteria 5179
59 Ga0068864_100077797 3300005618 Bacteria 2902
60 Ga0068861_100131526 3300005719 Bacteria 2031
61 Ga0068851_10058820 3300005834 Bacteria 1965
62 Ga0068858_100040879 3300005842 Bacteria 4300
63 Ga0068858_100276739 3300005842 Bacteria 1598
64 Ga0068858_100806195 3300005842 Bacteria 916
65 Ga0068860_100863266 3300005843 Unclassified 920
66 Ga0068871_100255267 3300006358 Bacteria 1528
67 Ga0075428_100008684 3300006844 Bacteria 11272
68 Ga0075428_100009761 3300006844 Bacteria 10668
69 Ga0075428_100294003 3300006844 Bacteria 1747
70 Ga0075430_100002768 3300006846 Bacteria 14650
71 Ga0075430_100019465 3300006846 Bacteria 5772
72 Ga0075430_100224332 3300006846 Unclassified 1559
73 Ga0075430_100293964 3300006846 Bacteria 1344
74 Ga0075431_100003437 3300006847 Bacteria 15361
75 Ga0075431_100061459 3300006847 Bacteria 3876
76 Ga0075431_100314695 3300006847 Bacteria 1579
77 Ga0075431_100342802 3300006847 Bacteria 1503
78 Ga0075433_10267827 3300006852 Unclassified 1514
79 Ga0075433_10604122 3300006852 Bacteria 963
80 Ga0075434_100014324 3300006871 Bacteria 7578
81 Ga0075434_100185804 3300006871 Bacteria 2099
82 Ga0075434_100884038 3300006871 Bacteria 909
83 Ga0075429_100079968 3300006880 Bacteria 2849
84 Ga0075429_100282549 3300006880 Bacteria 1453
85 Ga0068865_100182695 3300006881 Bacteria 1616
86 Ga0075436_100249123 3300006914 Bacteria 1265
87 Ga0105240_10004875 3300009093 Bacteria 20188
88 Ga0111539_10417417 3300009094 Bacteria 1563
89 Ga0111539_10560259 3300009094 Bacteria 1331
90 Ga0111539_10574583 3300009094 Bacteria 1313
91 Ga0111539_10622201 3300009094 Bacteria 1257
92 Ga0111539_11180226 3300009094 Bacteria 889
93 Ga0105245_10968718 3300009098 Unclassified 894
94 Ga0114129_10015605 3300009147 Bacteria 10801
95 Ga0114129_10020336 3300009147 Bacteria 9444
96 Ga0114129_10122910 3300009147 Bacteria 3571
97 Ga0114129_10132183 3300009147 Bacteria 3426
98 Ga0114129_10301242 3300009147 Bacteria 2136
99 Ga0114129_10449200 3300009147 Bacteria 1691
100 Ga0105243_10658920 3300009148 Bacteria 1015
101 Ga0105248_10026969 3300009177 Bacteria 6389
102 Ga0105237_10030227 3300009545 Bacteria 5505
103 Ga0105238_10003371 3300009551 Bacteria 15944
104 Ga0105249_10258425 3300009553 Bacteria 1729
105 Ga0157373_10706309 3300013100 Bacteria 739
106 Ga0157370_10023445 3300013104 Bacteria 6125
107 Ga0157369_10013881 3300013105 Bacteria 9099
108 Ga0157374_10315113 3300013296 Bacteria 1549
109 Ga0157374_10703483 3300013296 Bacteria 1024
110 Ga0163162_10670491 3300013306 Bacteria 1160
111 Ga0157372_10008257 3300013307 Bacteria 11071
112 Ga0157375_10445981 3300013308 Bacteria 1460
113 Ga0157380_10030172 3300014326 Bacteria 4151
114 Ga0157380_10373777 3300014326 Bacteria 1342
115 Ga0157380_11167291 3300014326 Bacteria 812
116 Ga0157379_11004489 3300014968 Bacteria 795
117 Ga0209025_1022386 3300025294 Bacteria 3354
118 Ga0207656_10012105 3300025321 Bacteria 3275
119 Ga0207688_10060094 3300025901 Bacteria 2141
120 Ga0207680_10160219 3300025903 Bacteria 1508
121 Ga0207684_10209991 3300025910 Bacteria 1679
122 Ga0207707_10006896 3300025912 Bacteria 9909
123 Ga0207649_10010919 3300025920 Bacteria 4994
124 Ga0207649_10010946 3300025920 Bacteria 4989
125 Ga0207649_10099179 3300025920 Bacteria 1924
126 Ga0207652_10098654 3300025921 Bacteria 2577
127 Ga0207652_10115635 3300025921 Bacteria 2383
128 Ga0207646_10158075 3300025922 Unclassified 2045
129 Ga0207681_10249693 3300025923 Bacteria 1385
130 Ga0207681_10313862 3300025923 Unclassified 1244
131 Ga0207694_10009032 3300025924 Bacteria 7523
132 Ga0207650_10003836 3300025925 Bacteria 10275
133 Ga0207650_10014293 3300025925 Bacteria 5515
134 Ga0207659_10399677 3300025926 Bacteria 1149
135 Ga0207687_10046792 3300025927 Bacteria 2996
136 Ga0207664_10063613 3300025929 Bacteria 2949
137 Ga0207644_10295882 3300025931 Bacteria 1303
138 Ga0207690_10013514 3300025932 Bacteria 4907
139 Ga0207690_10069385 3300025932 Bacteria 2425
140 Ga0207690_10078143 3300025932 Bacteria 2302
141 Ga0207706_10104683 3300025933 Bacteria 2490
142 Ga0207706_10133726 3300025933 Bacteria 2181
143 Ga0207706_10244106 3300025933 Bacteria 1570
144 Ga0207691_10065061 3300025940 Bacteria 3302
145 Ga0207689_10512967 3300025942 Bacteria 1005
146 Ga0207689_10936775 3300025942 Bacteria 731
147 Ga0207661_10077528 3300025944 Bacteria 2733
148 Ga0207661_10090080 3300025944 Bacteria 2553
149 Ga0207679_10002245 3300025945 Bacteria 11932
150 Ga0207679_10030973 3300025945 Bacteria 3741
151 Ga0207679_10051895 3300025945 Bacteria 3005
152 Ga0207667_10046426 3300025949 Bacteria 4599
153 Ga0207667_10916270 3300025949 Bacteria 868
154 Ga0207651_10592789 3300025960 Unclassified 968
155 Ga0207712_10328890 3300025961 Bacteria 1264
156 Ga0207640_10010488 3300025981 Bacteria 5219
157 Ga0207640_10257899 3300025981 Bacteria 1357
158 Ga0207703_10668881 3300026035 Bacteria 986
159 Ga0207703_11351357 3300026035 Bacteria 685
160 Ga0207639_10007632 3300026041 Bacteria 7379
161 Ga0207639_10939756 3300026041 Bacteria 809
162 Ga0207678_10040510 3300026067 Bacteria 4040
163 Ga0207708_10365302 3300026075 Bacteria 1187
164 Ga0207702_10004791 3300026078 Bacteria 11922
165 Ga0207676_10108786 3300026095 Bacteria 2315
166 Ga0207674_10000883 3300026116 Bacteria 39210
167 Ga0207674_10012122 3300026116 Bacteria 9652
168 Ga0207675_100047032 3300026118 Bacteria 4030
169 Ga0207683_10469878 3300026121 Bacteria 1160
170 Ga0207698_10011203 3300026142 Bacteria 5802
171 Ga0207698_10708875 3300026142 Bacteria 1002
172 Ga0207428_10027782 3300027907 Bacteria 4707
173 Ga0268264_10933067 3300028381 Bacteria 872
174 Ga0265338_10164263 3300028800 Bacteria 1711
175 Ga0307408_100048640 3300031548 Bacteria 3042
176 Ga0307408_100615793 3300031548 Unclassified 966
177 Ga0307408_101082041 3300031548 Bacteria 743
178 Ga0307405_10615522 3300031731 Bacteria 888
179 Ga0307405_10691255 3300031731 Bacteria 844
180 Ga0307405_10837165 3300031731 Bacteria 774
181 Ga0307413_10183182 3300031824 Bacteria 1496
182 Ga0307412_10010760 3300031911 Bacteria 5278
183 Ga0307412_10144111 3300031911 Bacteria 1749
184 Ga0307409_100260323 3300031995 Unclassified 1592
185 Ga0307409_100271195 3300031995 Bacteria 1563
186 Ga0307416_100028298 3300032002 Bacteria 4165
187 Ga0307416_100112819 3300032002 Bacteria 2400
188 Ga0307416_100115351 3300032002 Bacteria 2378
189 Ga0307416_100334270 3300032002 Unclassified 1524
190 Ga0307416_100625597 3300032002 Bacteria 1159
191 Ga0307411_10108351 3300032005 Bacteria 1982
192 Ga0307411_10158958 3300032005 Bacteria 1689
193 Ga0307411_10221117 3300032005 Unclassified 1469
194 Ga0307411_10305170 3300032005 Bacteria 1278
195 Ga0307415_100371457 3300032126 Bacteria 1211
196 Ga0307415_100373471 3300032126 Unclassified 1208
197 Ga0373926_0127798 3300035083 Bacteria 961
198 Ga0373936_0082735 3300035113 Bacteria 1338
199 Ga0373946_0024439 3300035171 Bacteria 2368
200 Ga0373931_0239639 3300035691 Bacteria 1099
201 Ga0373925_0003124 3300037068 Bacteria 12999
202 Ga0451807_0655572 3300041486 Bacteria 2562
203 Ga0451851_0694502 3300041507 Unclassified 652
204 Ga0439431_0015213 3300041997 Bacteria 1789
205 Ga0439446_0011335 3300042156 Bacteria 2419
206 Ga0439434_0166202 3300042435 Bacteria 735
207 Ga0439435_0008402 3300042436 Bacteria 2392
208 Ga0439435_0112447 3300042436 Unclassified 846
209 Ga0439460_0015508 3300042461 Bacteria 2019
210 Ga0439460_0028613 3300042461 Bacteria 1573
211 Ga0439460_0177453 3300042461 Unclassified 719
212 Ga0451577_0030854 3300042876 Bacteria 4840
213 Ga0451577_0082331 3300042876 Bacteria 2871
214 Ga0453683_0612050 3300044673 Bacteria 711
215 Ga0453684_0049442 3300044712 Bacteria 5546
216 Ga0453684_0406168 3300044712 Bacteria 1524
217 Ga0495603_0271716 3300046455 Bacteria 975
218 Ga0495620_0263189 3300046515 Bacteria 657
219 Ga0495674_0263468 3300047319 Unclassified 1416
220 Ga0496100_0729433 3300048903 Bacteria 774
221 Ga0496101_0038227 3300048904 Bacteria 3408
222 Ga0496102_0017952 3300048905 Bacteria 6207
223 Ga0496104_0003182 3300048907 Bacteria 14111
224 Ga0496108_0046024 3300048911 Bacteria 3644
225 Ga0496109_0000869 3300048912 Bacteria 25170
226 Ga0496109_1318548 3300048912 Unclassified 658
227 Ga0496110_0822686 3300048913 Unclassified 833
228 Ga0496111_0007522 3300048914 Bacteria 7148
229 Ga0496111_0688830 3300048914 Bacteria 744
230 Ga0496112_0000918 3300048915 Bacteria 21281
231 Ga0496112_0700923 3300048915 Bacteria 940
232 Ga0496113_0014536 3300048916 Bacteria 5374
233 Ga0501034_0124185 3300049571 Bacteria 2567
234 Ga0501034_0165802 3300049571 Bacteria 2178
235 Ga0501036_0108720 3300049572 Bacteria 2344
236 Ga0501036_0546698 3300049572 Unclassified 962
237 Ga0501038_0881426 3300049574 Unclassified 661
238 Ga0501039_0018193 3300049575 Bacteria 5394
239 Ga0501040_0228508 3300049576 Unclassified 1325
240 Ga0501041_0156035 3300049577 Unclassified 1426
241 Ga0501041_0251840 3300049577 Bacteria 1110
242 Ga0501042_0096327 3300049578 Unclassified 2126
243 Ga0501048_0369675 3300049582 Unclassified 1023
244 Ga0501048_0389932 3300049582 Bacteria 995
245 Ga0501071_0019912 3300049587 Bacteria 4660
246 Ga0501071_0383839 3300049587 Unclassified 1071
247 Ga0501072_0082110 3300049588 Bacteria 2555
248 Ga0501072_0085290 3300049588 Bacteria 2505
249 Ga0501073_0399277 3300049589 Bacteria 950
250 Ga0501075_0039445 3300049591 Bacteria 3535
251 Ga0501075_0636980 3300049591 Unclassified 813
252 Ga0501076_0023972 3300049592 Bacteria 4710
253 Ga0501076_0264023 3300049592 Unclassified 1410
254 Ga0501079_0459296 3300049741 Bacteria 1000
255 Ga0501080_0092071 3300049742 Bacteria 2816
256 Ga0501080_0116993 3300049742 Bacteria 2471
257 Ga0501081_0090790 3300049743 Bacteria 2148
258 Ga0501081_0112744 3300049743 Bacteria 1931
259 Ga0501081_0824747 3300049743 Unclassified 698
260 Ga0501035_0270977 3300049822 Unclassified 1437
261 Ga0501045_0018171 3300049824 Bacteria 4997
262 Ga0501045_0543858 3300049824 Unclassified 862
263 nmdc:mga05p37_3423_c1 3300050507 Bacteria 18512
264 nmdc:mga05p37_38671_c1 3300050507 Bacteria 5854
265 nmdc:mga05p37_39433_c1 3300050507 Bacteria 5799
266 nmdc:mga05p37_6979_c1 3300050507 Bacteria 13310
267 nmdc:mga05p37_82910_c1 3300050507 Bacteria 3951
268 nmdc:mga09592_1063503_c1 3300050508 Bacteria 674
269 nmdc:mga09592_252824_c1 3300050508 Unclassified 1528
270 nmdc:mga09592_383772_c1 3300050508 Bacteria 1215
271 nmdc:mga0qj67_14996_c1 3300050509 Bacteria 5863
272 nmdc:mga0qj67_189985_c1 3300050509 Unclassified 1669
273 nmdc:mga0qj67_265542_c1 3300050509 Bacteria 1392
274 nmdc:mga06r32_102848_c1 3300050510 Bacteria 2805
275 nmdc:mga06r32_516759_c1 3300050510 Bacteria 1170
276 nmdc:mga08y16_1664_c1 3300050511 Bacteria 22540
277 nmdc:mga08y16_398321_c1 3300050511 Bacteria 1409
278 nmdc:mga08y16_44859_c1 3300050511 Bacteria 4633
279 nmdc:mga08y16_665271_c1 3300050511 Bacteria 1044
280 nmdc:mga08y16_919320_c1 3300050511 Bacteria 860
281 nmdc:mga0n895_13885_c1 3300050512 Bacteria 7292
282 nmdc:mga0n895_413990_c1 3300050512 Bacteria 1363
283 nmdc:mga0n895_97918_c1 3300050512 Bacteria 2939
284 nmdc:mga0rr50_249504_c1 3300050513 Unclassified 1473
285 nmdc:mga08x19_264389_c1 3300050514 Bacteria 1190
286 nmdc:mga0a205_131593_c1 3300050515 Bacteria 2402
287 nmdc:mga0a205_2602_c1 3300050515 Bacteria 15939
288 nmdc:mga0a205_76883_c2 3300050515 Bacteria 2779
289 nmdc:mga0a205_888142_c1 3300050515 Bacteria 738
290 Ga0500641_0005877 3300053096 Bacteria 4345
291 Ga0501084_0417873 3300054114 Bacteria 1134
292 Ga0501084_0712217 3300054114 Bacteria 846
293 Ga0501082_0044348 3300060353 Bacteria 3836
294 Ga0501082_0506112 3300060353 Bacteria 1056
295 Ga0530510_0003022 3300061734 Bacteria 11553
296 Ga0530510_0046989 3300061734 Bacteria 3119
297 Ga0530510_0305326 3300061734 Unclassified 1191
298 Ga0530510_0582011 3300061734 Bacteria 851
299 2672333508 2671180330 Bacteria 5521719
300 Ga0501031_0045213
301 Ga0065715_10260943
302 Ga0070683_100000094
303 Ga0070683_100113459
304 Ga0070690_100450791
305 Ga0070670_100004478
306 Ga0070670_100006909
307 Ga0070670_100008888
308 Ga0070666_10027592
309 Ga0070660_100363465
310 Ga0070661_100000392
311 Ga0070661_100001504
312 Ga0070669_100122210
313 Ga0070675_100343826
314 Ga0070675_100391707
315 Ga0070675_100746197
316 Ga0070671_100354726
317 Ga0070674_100073985
318 Ga0070673_100565707
319 Ga0070673_101224893
320 Ga0070659_100014688
321 Ga0070659_100112982
322 Ga0070659_100171796
323 Ga0070659_100184607
324 Ga0070714_100082256
325 Ga0070694_100539586
326 Ga0070663_100031649
327 Ga0070662_100101790
328 Ga0070662_100261577
329 Ga0070662_100459376
330 Ga0070681_10010817
331 Ga0070706_100104627
332 Ga0070707_100203670
333 Ga0070698_100219753
334 Ga0070699_100028109
335 Ga0070699_100556937
336 Ga0070679_100016516
337 Ga0070679_100218626
338 Ga0070684_100000166
339 Ga0070697_100292225
340 Ga0068853_100010863
341 Ga0068853_101247061
342 Ga0070672_100253459
343 Ga0070696_100446716
344 Ga0070693_100165471
345 Ga0070704_100289376
346 Ga0068855_100014652
347 Ga0070664_100000479
348 Ga0070664_100005036
349 Ga0070664_100015089
350 Ga0070664_100236971
351 Ga0068857_100000227
352 Ga0068857_100783017
353 Ga0068857_101302526
354 Ga0068854_100012371
355 Ga0068854_100282404
356 Ga0068856_100008422
357 Ga0068852_100021228
358 Ga0068864_100077797
359 Ga0068861_100131526
360 Ga0068851_10058820
361 Ga0068858_100040879
362 Ga0068858_100276739
363 Ga0068858_100806195
364 Ga0068860_100863266
365 Ga0068871_100255267
366 Ga0075428_100008684
367 Ga0075428_100009761
368 Ga0075428_100294003
369 Ga0075430_100002768
370 Ga0075430_100019465
371 Ga0075430_100224332
372 Ga0075430_100293964
373 Ga0075431_100003437
374 Ga0075431_100061459
375 Ga0075431_100314695
376 Ga0075431_100342802
377 Ga0075433_10267827
378 Ga0075433_10604122
379 Ga0075434_100014324
380 Ga0075434_100185804
381 Ga0075434_100884038
382 Ga0075429_100079968
383 Ga0075429_100282549
384 Ga0068865_100182695
385 Ga0075436_100249123
386 Ga0105240_10004875
387 Ga0111539_10417417
388 Ga0111539_10560259
389 Ga0111539_10574583
390 Ga0111539_10622201
391 Ga0111539_11180226
392 Ga0105245_10968718
393 Ga0114129_10015605
394 Ga0114129_10020336
395 Ga0114129_10122910
396 Ga0114129_10132183
397 Ga0114129_10301242
398 Ga0114129_10449200
399 Ga0105243_10658920
400 Ga0105248_10026969
401 Ga0105237_10030227
402 Ga0105238_10003371
403 Ga0105249_10258425
404 Ga0157373_10706309
405 Ga0157370_10023445
406 Ga0157369_10013881
407 Ga0157374_10315113
408 Ga0157374_10703483
409 Ga0163162_10670491
410 Ga0157372_10008257
411 Ga0157375_10445981
412 Ga0157380_10030172
413 Ga0157380_10373777
414 Ga0157380_11167291
415 Ga0157379_11004489
416 Ga0209025_1022386
417 Ga0207656_10012105
418 Ga0207688_10060094
419 Ga0207680_10160219
420 Ga0207684_10209991
421 Ga0207707_10006896
422 Ga0207649_10010919
423 Ga0207649_10010946
424 Ga0207649_10099179
425 Ga0207652_10098654
426 Ga0207652_10115635
427 Ga0207646_10158075
428 Ga0207681_10249693
429 Ga0207681_10313862
430 Ga0207694_10009032
431 Ga0207650_10003836
432 Ga0207650_10014293
433 Ga0207659_10399677
434 Ga0207687_10046792
435 Ga0207664_10063613
436 Ga0207644_10295882
437 Ga0207690_10013514
438 Ga0207690_10069385
439 Ga0207690_10078143
440 Ga0207706_10104683
441 Ga0207706_10133726
442 Ga0207706_10244106
443 Ga0207691_10065061
444 Ga0207689_10512967
445 Ga0207689_10936775
446 Ga0207661_10077528
447 Ga0207661_10090080
448 Ga0207679_10002245
449 Ga0207679_10030973
450 Ga0207679_10051895
451 Ga0207667_10046426
452 Ga0207667_10916270
453 Ga0207651_10592789
454 Ga0207712_10328890
455 Ga0207640_10010488
456 Ga0207640_10257899
457 Ga0207703_10668881
458 Ga0207703_11351357
459 Ga0207639_10007632
460 Ga0207639_10939756
461 Ga0207678_10040510
462 Ga0207708_10365302
463 Ga0207702_10004791
464 Ga0207676_10108786
465 Ga0207674_10000883
466 Ga0207674_10012122
467 Ga0207675_100047032
468 Ga0207683_10469878
469 Ga0207698_10011203
470 Ga0207698_10708875
471 Ga0207428_10027782
472 Ga0268264_10933067
473 Ga0265338_10164263
474 Ga0307408_100048640
475 Ga0307408_100615793
476 Ga0307408_101082041
477 Ga0307405_10615522
478 Ga0307405_10691255
479 Ga0307405_10837165
480 Ga0307413_10183182
481 Ga0307412_10010760
482 Ga0307412_10144111
483 Ga0307409_100260323
484 Ga0307409_100271195
485 Ga0307416_100028298
486 Ga0307416_100112819
487 Ga0307416_100115351
488 Ga0307416_100334270
489 Ga0307416_100625597
490 Ga0307411_10108351
491 Ga0307411_10158958
492 Ga0307411_10221117
493 Ga0307411_10305170
494 Ga0307415_100371457
495 Ga0307415_100373471
496 Ga0373926_0127798
497 Ga0373936_0082735
498 Ga0373946_0024439
499 Ga0373931_0239639
500 Ga0373925_0003124
501 Ga0451807_0655572
502 Ga0451851_0694502
503 Ga0439431_0015213
504 Ga0439446_0011335
505 Ga0439434_0166202
506 Ga0439435_0008402
507 Ga0439435_0112447
508 Ga0439460_0015508
509 Ga0439460_0028613
510 Ga0439460_0177453
511 Ga0451577_0030854
512 Ga0451577_0082331
513 Ga0453683_0612050
514 Ga0453684_0049442
515 Ga0453684_0406168
516 Ga0495603_0271716
517 Ga0495620_0263189
518 Ga0495674_0263468
519 Ga0496100_0729433
520 Ga0496101_0038227
521 Ga0496102_0017952
522 Ga0496104_0003182
523 Ga0496108_0046024
524 Ga0496109_0000869
525 Ga0496109_1318548
526 Ga0496110_0822686
527 Ga0496111_0007522
528 Ga0496111_0688830
529 Ga0496112_0000918
530 Ga0496112_0700923
531 Ga0496113_0014536
532 Ga0501034_0124185
533 Ga0501034_0165802
534 Ga0501036_0108720
535 Ga0501036_0546698
536 Ga0501038_0881426
537 Ga0501039_0018193
538 Ga0501040_0228508
539 Ga0501041_0156035
540 Ga0501041_0251840
541 Ga0501042_0096327
542 Ga0501048_0369675
543 Ga0501048_0389932
544 Ga0501071_0019912
545 Ga0501071_0383839
546 Ga0501072_0082110
547 Ga0501072_0085290
548 Ga0501073_0399277
549 Ga0501075_0039445
550 Ga0501075_0636980
551 Ga0501076_0023972
552 Ga0501076_0264023
553 Ga0501079_0459296
554 Ga0501080_0092071
555 Ga0501080_0116993
556 Ga0501081_0090790
557 Ga0501081_0112744
558 Ga0501081_0824747
559 Ga0501035_0270977
560 Ga0501045_0018171
561 Ga0501045_0543858
562 nmdc:mga05p37_3423_c1
563 nmdc:mga05p37_38671_c1
564 nmdc:mga05p37_39433_c1
565 nmdc:mga05p37_6979_c1
566 nmdc:mga05p37_82910_c1
567 nmdc:mga09592_1063503_c1
568 nmdc:mga09592_252824_c1
569 nmdc:mga09592_383772_c1
570 nmdc:mga0qj67_14996_c1
571 nmdc:mga0qj67_189985_c1
572 nmdc:mga0qj67_265542_c1
573 nmdc:mga06r32_102848_c1
574 nmdc:mga06r32_516759_c1
575 nmdc:mga08y16_1664_c1
576 nmdc:mga08y16_398321_c1
577 nmdc:mga08y16_44859_c1
578 nmdc:mga08y16_665271_c1
579 nmdc:mga08y16_919320_c1
580 nmdc:mga0n895_13885_c1
581 nmdc:mga0n895_413990_c1
582 nmdc:mga0n895_97918_c1
583 nmdc:mga0rr50_249504_c1
584 nmdc:mga08x19_264389_c1
585 nmdc:mga0a205_131593_c1
586 nmdc:mga0a205_2602_c1
587 nmdc:mga0a205_76883_c2
588 nmdc:mga0a205_888142_c1
589 Ga0500641_0005877
590 Ga0501084_0417873
591 Ga0501084_0712217
592 Ga0501082_0044348
593 Ga0501082_0506112
594 Ga0530510_0003022
595 Ga0530510_0046989
596 Ga0530510_0305326
597 Ga0530510_0582011
598 2672333508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

5

196

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zx8-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from thermus thermophilus 0.9509 1 185
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9455 2 176
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9397 2 187
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9396 2 187
4qt4-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, streptococcus pyogenes at 2.19 angstrom resolution shows the closed structure of the substrate binding cleft 0.9382 2 186
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9729 60 186 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9509 1 185 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.938 2 186 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9322 1 187 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.925 2 185 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A4Q3UV06-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9767 63 187 GO:0004045
AF-A0A449A5K8-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9759 1 185 GO:0004045
GO:0005737
GO:0006412
AF-A0A7C2U2S7-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9747 2 186 GO:0004045
GO:0005737
GO:0006412
AF-A0A356J193-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9739 61 187 GO:0004045
AF-A0A2V2S0Q1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9735 2 185 GO:0004045
GO:0005737
GO:0006412

Map