F394895

General Info

Members Datasets Scaffolds Average Seq Length
299 197 598 244

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10006615|Ga0265760_100066153
Length 285
Sequence MIAPPVVIHAGTVVAGCGNVSNGGNLMTENTAGQRASLTGKVALVTGSAKRLGRAVALRLAEEGADLVIHHGASHAEAQETVGEIEKLGRRAVALSADLQKVDEIRKLFVQVAKEFGRLDILVNSAANFLPASIVSTTEEIWDASLDTNLKAGFFCTQAAAPLLRRTKGAIVNFADAGGLMGWPGYIPHSISKAGVVMLTKVLAKALAPDVRVNAIAPGTITMPGDPPEWEEDFEKLAPLQRTGTPRDIADAVSYLVHAEFMTGHTLVLDGGRILGTNGAEFHVD

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.67
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 16.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10006615 3300031090 Bacteria 3317
2 rootL2_10252681 3300003322 Bacteria 2435
3 Ga0070676_10003488 3300005328 Bacteria 8203
4 Ga0070683_100271742 3300005329 Bacteria 1612
5 Ga0070683_100573561 3300005329 Bacteria 1079
6 Ga0070690_100015188 3300005330 Bacteria 4588
7 Ga0068869_100007486 3300005334 Bacteria 6986
8 Ga0070682_100228797 3300005337 Bacteria 1328
9 Ga0070660_100379810 3300005339 Bacteria 1166
10 Ga0070661_100429685 3300005344 Bacteria 1048
11 Ga0070674_100011065 3300005356 Bacteria 5475
12 Ga0070709_10018848 3300005434 Bacteria 3982
13 Ga0070709_10020531 3300005434 Bacteria 3833
14 Ga0070709_10051678 3300005434 Bacteria 2580
15 Ga0070709_10103748 3300005434 Bacteria 1899
16 Ga0070709_10357956 3300005434 Unclassified 1080
17 Ga0070714_100138622 3300005435 Bacteria 2181
18 Ga0070713_100026934 3300005436 Bacteria 4520
19 Ga0070713_100127464 3300005436 Unclassified 2241
20 Ga0070713_100260300 3300005436 Bacteria 1585
21 Ga0070710_10139960 3300005437 Bacteria 1483
22 Ga0070711_100009014 3300005439 Bacteria 6126
23 Ga0070711_100014944 3300005439 Bacteria 4905
24 Ga0070711_100027127 3300005439 Bacteria 3758
25 Ga0070711_100351477 3300005439 Bacteria 1185
26 Ga0070705_100003772 3300005440 Bacteria 7416
27 Ga0070700_100053262 3300005441 Bacteria 2525
28 Ga0070700_100191618 3300005441 Bacteria 1430
29 Ga0070694_100004484 3300005444 Bacteria 8396
30 Ga0070708_100014555 3300005445 Bacteria 6479
31 Ga0070708_100042584 3300005445 Unclassified 3987
32 Ga0070708_100158823 3300005445 Bacteria 2106
33 Ga0070678_100075298 3300005456 Bacteria 2539
34 Ga0070662_100114796 3300005457 Bacteria 2056
35 Ga0068867_100126885 3300005459 Bacteria 1978
36 Ga0070706_100001238 3300005467 Bacteria 27332
37 Ga0070706_100074284 3300005467 Unclassified 3147
38 Ga0070707_100004364 3300005468 Bacteria 13253
39 Ga0070707_100048062 3300005468 Bacteria 4086
40 Ga0070707_100086123 3300005468 Bacteria 3038
41 Ga0070707_100413702 3300005468 Unclassified 1309
42 Ga0070698_100023626 3300005471 Bacteria 6424
43 Ga0070699_100008976 3300005518 Bacteria 8659
44 Ga0070699_100065850 3300005518 Bacteria 3145
45 Ga0070679_100119082 3300005530 Bacteria 2625
46 Ga0070679_100313537 3300005530 Bacteria 1518
47 Ga0070697_100001438 3300005536 Bacteria 18114
48 Ga0070697_100001627 3300005536 Bacteria 17113
49 Ga0070697_100051125 3300005536 Bacteria 3357
50 Ga0070697_100205146 3300005536 Bacteria 1676
51 Ga0070686_100190503 3300005544 Unclassified 1463
52 Ga0070695_100004874 3300005545 Bacteria 7901
53 Ga0070695_100021306 3300005545 Bacteria 3965
54 Ga0070696_100002289 3300005546 Bacteria 12624
55 Ga0070696_100003059 3300005546 Bacteria 11109
56 Ga0070693_100001209 3300005547 Bacteria 11626
57 Ga0070693_100064590 3300005547 Bacteria 2137
58 Ga0070665_100000985 3300005548 Bacteria 36103
59 Ga0070665_100252092 3300005548 Bacteria 1766
60 Ga0070704_100012006 3300005549 Bacteria 5337
61 Ga0070664_100028478 3300005564 Bacteria 4647
62 Ga0070664_100035786 3300005564 Bacteria 4169
63 Ga0068857_100003314 3300005577 Bacteria 13388
64 Ga0068854_100001930 3300005578 Bacteria 12643
65 Ga0070702_100016316 3300005615 Bacteria 3807
66 Ga0068852_100156672 3300005616 Bacteria 2122
67 Ga0068859_100106788 3300005617 Bacteria 2859
68 Ga0068864_100029554 3300005618 Bacteria 4643
69 Ga0068866_10000165 3300005718 Bacteria 30640
70 Ga0068858_100562020 3300005842 Unclassified 1105
71 Ga0068860_100022248 3300005843 Bacteria 6136
72 Ga0068860_100218280 3300005843 Bacteria 1851
73 Ga0068860_100406054 3300005843 Bacteria 1348
74 Ga0068860_100564213 3300005843 Bacteria 1141
75 Ga0070717_10162008 3300006028 Bacteria 1941
76 Ga0070715_10053949 3300006163 Bacteria 1739
77 Ga0070716_100000398 3300006173 Bacteria 17820
78 Ga0070716_100005680 3300006173 Bacteria 6054
79 Ga0070716_100042271 3300006173 Unclassified 2544
80 Ga0070716_100115446 3300006173 Unclassified 1671
81 Ga0070712_100046466 3300006175 Bacteria 3001
82 Ga0070712_100052184 3300006175 Bacteria 2851
83 Ga0070712_100257390 3300006175 Unclassified 1397
84 Ga0097621_100049714 3300006237 Bacteria 3408
85 Ga0075434_100004991 3300006871 Bacteria 12040
86 Ga0075429_100748655 3300006880 Bacteria 856
87 Ga0068865_100001488 3300006881 Bacteria 13652
88 Ga0068865_100548533 3300006881 Bacteria 970
89 Ga0075436_100001171 3300006914 Bacteria 17773
90 Ga0075436_100313040 3300006914 Unclassified 1127
91 Ga0097620_100106789 3300006931 Bacteria 2859
92 Ga0075435_100369978 3300007076 Bacteria 1230
93 Ga0099794_10012973 3300007265 Bacteria 3616
94 Ga0099794_10088401 3300007265 Unclassified 1535
95 Ga0099794_10109470 3300007265 Unclassified 1383
96 Ga0099794_10213757 3300007265 Bacteria 989
97 Ga0099794_10218201 3300007265 Bacteria 979
98 Ga0105245_10043269 3300009098 Bacteria 4017
99 Ga0105245_10458530 3300009098 Bacteria 1284
100 Ga0105247_10132613 3300009101 Bacteria 1625
101 Ga0114129_10069529 3300009147 Bacteria 4908
102 Ga0105243_10003787 3300009148 Bacteria 12105
103 Ga0105241_10006356 3300009174 Bacteria 8710
104 Ga0105242_10001152 3300009176 Bacteria 20825
105 Ga0105242_10313288 3300009176 Bacteria 1437
106 Ga0105248_10015428 3300009177 Bacteria 8422
107 Ga0105248_10040479 3300009177 Bacteria 5223
108 Ga0105248_10850125 3300009177 Unclassified 1030
109 Ga0105237_10217826 3300009545 Bacteria 1909
110 Ga0105249_10280315 3300009553 Bacteria 1664
111 Ga0105249_11232913 3300009553 Unclassified 819
112 Ga0099796_10039488 3300010159 Bacteria 1589
113 Ga0105239_10107645 3300010375 Bacteria 3088
114 Ga0105246_10004556 3300011119 Bacteria 8435
115 Ga0157374_10165729 3300013296 Bacteria 2153
116 Ga0157378_10000505 3300013297 Bacteria 37065
117 Ga0157378_10017824 3300013297 Bacteria 6234
118 Ga0157378_10097246 3300013297 Bacteria 2683
119 Ga0157378_10329629 3300013297 Unclassified 1485
120 Ga0163162_10135193 3300013306 Bacteria 2576
121 Ga0163162_10283284 3300013306 Bacteria 1789
122 Ga0157372_10081193 3300013307 Bacteria 3670
123 Ga0157375_10097568 3300013308 Bacteria 3014
124 Ga0157375_10213093 3300013308 Bacteria 2089
125 Ga0157375_10458681 3300013308 Bacteria 1440
126 Ga0157375_10701273 3300013308 Unclassified 1166
127 Ga0163163_10472673 3300014325 Unclassified 1314
128 Ga0157380_10371610 3300014326 Bacteria 1346
129 Ga0157379_10026519 3300014968 Bacteria 5159
130 Ga0157379_10068623 3300014968 Bacteria 3169
131 Ga0157376_10055803 3300014969 Unclassified 3297
132 Ga0207692_10224366 3300025898 Unclassified 1115
133 Ga0207642_10004570 3300025899 Bacteria 4470
134 Ga0207710_10074259 3300025900 Bacteria 1565
135 Ga0207685_10087007 3300025905 Unclassified 1307
136 Ga0207699_10009400 3300025906 Bacteria 4866
137 Ga0207699_10016868 3300025906 Bacteria 3830
138 Ga0207699_10077145 3300025906 Bacteria 2055
139 Ga0207699_10181028 3300025906 Unclassified 1417
140 Ga0207699_10482350 3300025906 Bacteria 893
141 Ga0207645_10000654 3300025907 Bacteria 28792
142 Ga0207643_10007065 3300025908 Bacteria 6017
143 Ga0207684_10004503 3300025910 Bacteria 13100
144 Ga0207684_10076124 3300025910 Bacteria 2852
145 Ga0207671_10081217 3300025914 Bacteria 2431
146 Ga0207693_10045796 3300025915 Bacteria 3437
147 Ga0207693_10098772 3300025915 Bacteria 2289
148 Ga0207663_10005904 3300025916 Bacteria 6214
149 Ga0207663_10057938 3300025916 Bacteria 2443
150 Ga0207652_10028658 3300025921 Bacteria 4649
151 Ga0207646_10004154 3300025922 Bacteria 15885
152 Ga0207646_10094980 3300025922 Bacteria 2671
153 Ga0207646_10231158 3300025922 Bacteria 1671
154 Ga0207646_10346911 3300025922 Unclassified 1341
155 Ga0207687_10073221 3300025927 Bacteria 2453
156 Ga0207700_10133951 3300025928 Unclassified 2027
157 Ga0207700_10181544 3300025928 Bacteria 1762
158 Ga0207700_10184390 3300025928 Bacteria 1750
159 Ga0207706_10000244 3300025933 Bacteria 59754
160 Ga0207686_10000150 3300025934 Bacteria 53141
161 Ga0207686_10041726 3300025934 Bacteria 2800
162 Ga0207669_10003993 3300025937 Bacteria 6448
163 Ga0207704_10003675 3300025938 Bacteria 6974
164 Ga0207665_10000103 3300025939 Bacteria 55197
165 Ga0207665_10004896 3300025939 Bacteria 8924
166 Ga0207665_10062147 3300025939 Bacteria 2533
167 Ga0207665_10083738 3300025939 Bacteria 2200
168 Ga0207665_10093202 3300025939 Unclassified 2091
169 Ga0207711_10428025 3300025941 Bacteria 1231
170 Ga0207689_10004041 3300025942 Bacteria 13328
171 Ga0207661_10211028 3300025944 Bacteria 1711
172 Ga0207712_10028954 3300025961 Bacteria 3711
173 Ga0207640_10020260 3300025981 Bacteria 3947
174 Ga0207658_10258207 3300025986 Bacteria 1484
175 Ga0207703_10543977 3300026035 Unclassified 1094
176 Ga0207678_10106807 3300026067 Bacteria 2388
177 Ga0207641_10229828 3300026088 Bacteria 1723
178 Ga0207648_10000273 3300026089 Bacteria 56070
179 Ga0207676_10006035 3300026095 Bacteria 8543
180 Ga0207676_10303341 3300026095 Unclassified 1459
181 Ga0207674_10155814 3300026116 Unclassified 2239
182 Ga0207675_100038542 3300026118 Bacteria 4460
183 Ga0207683_10103934 3300026121 Bacteria 2538
184 Ga0207698_10322859 3300026142 Bacteria 1447
185 Ga0209588_1039694 3300027671 Bacteria 1518
186 Ga0209966_1043072 3300027695 Bacteria 945
187 Ga0268266_10000366 3300028379 Bacteria 69519
188 Ga0268266_10169177 3300028379 Bacteria 1983
189 Ga0268264_10014785 3300028381 Bacteria 6411
190 Ga0268264_10018693 3300028381 Bacteria 5665
191 Ga0268264_10097625 3300028381 Bacteria 2547
192 Ga0307405_10076017 3300031731 Bacteria 2177
193 Ga0307413_10038034 3300031824 Bacteria 2785
194 Ga0307413_10123621 3300031824 Bacteria 1757
195 Ga0307413_10200271 3300031824 Bacteria 1441
196 Ga0307410_10116093 3300031852 Bacteria 1944
197 Ga0307406_10092063 3300031901 Bacteria 2043
198 Ga0307406_10377909 3300031901 Bacteria 1116
199 Ga0307407_10018796 3300031903 Bacteria 3505
200 Ga0307407_10038988 3300031903 Bacteria 2638
201 Ga0307407_10051321 3300031903 Bacteria 2364
202 Ga0307409_100076964 3300031995 Bacteria 2678
203 Ga0307409_100423107 3300031995 Bacteria 1278
204 Ga0307414_10270395 3300032004 Bacteria 1423
205 Ga0307414_10595281 3300032004 Bacteria 991
206 Ga0307411_10011507 3300032005 Bacteria 4780
207 Ga0307411_10698138 3300032005 Unclassified 883
208 Ga0307510_10137906 3300033180 Unclassified 2092
209 Ga0373926_0000951 3300035083 Bacteria 8399
210 Ga0373954_0006899 3300035118 Bacteria 4958
211 Ga0373954_0049472 3300035118 Bacteria 1971
212 Ga0373956_0186499 3300035119 Bacteria 981
213 Ga0373955_0023753 3300035172 Bacteria 3127
214 Ga0373924_0018714 3300035410 Bacteria 2674
215 Ga0373931_0050296 3300035691 Bacteria 2217
216 Ga0373927_0000220 3300035695 Bacteria 45246
217 Ga0373933_0000737 3300035724 Bacteria 20016
218 Ga0373947_0001138 3300035725 Bacteria 16339
219 Ga0373937_0002826 3300036401 Bacteria 14510
220 Ga0373937_0062559 3300036401 Bacteria 3422
221 Ga0373925_0001203 3300037068 Bacteria 22810
222 Ga0450898_013307 3300042134 Bacteria 1369
223 Ga0439444_0068354 3300042437 Unclassified 756
224 Ga0451577_0000448 3300042876 Bacteria 72373
225 Ga0451577_0013691 3300042876 Bacteria 7581
226 Ga0451577_0060021 3300042876 Unclassified 3391
227 Ga0453683_0001099 3300044673 Bacteria 24797
228 Ga0453683_0245628 3300044673 Unclassified 1140
229 Ga0453684_0000696 3300044712 Bacteria 119520
230 Ga0453684_0230601 3300044712 Unclassified 2138
231 Ga0451576_0555540 3300045051 Unclassified 1206
232 Ga0495603_0020367 3300046455 Bacteria 4020
233 Ga0495629_0143601 3300046459 Unclassified 1660
234 Ga0495641_0171199 3300046461 Bacteria 972
235 Ga0495651_0189535 3300046462 Bacteria 1448
236 Ga0495651_0357413 3300046462 Bacteria 963
237 Ga0495580_0004886 3300046472 Bacteria 11207
238 Ga0495580_0183677 3300046472 Unclassified 1444
239 Ga0495580_0221453 3300046472 Unclassified 1300
240 Ga0495582_0001219 3300046473 Bacteria 14484
241 Ga0495582_0024604 3300046473 Bacteria 3296
242 Ga0495639_0004136 3300046475 Bacteria 6217
243 Ga0495639_0251962 3300046475 Bacteria 873
244 Ga0495662_0040609 3300046476 Unclassified 2247
245 Ga0495594_0060425 3300046499 Unclassified 2096
246 Ga0495594_0231512 3300046499 Bacteria 1053
247 Ga0495608_0029056 3300046511 Bacteria 3753
248 Ga0495630_0018091 3300046517 Bacteria 5172
249 Ga0495630_0053977 3300046517 Bacteria 3010
250 Ga0495666_0012109 3300046526 Bacteria 4306
251 Ga0495666_0085993 3300046526 Bacteria 1485
252 Ga0495587_0001796 3300046536 Bacteria 14340
253 Ga0495587_0017610 3300046536 Bacteria 4438
254 Ga0495667_0010809 3300046559 Bacteria 6171
255 Ga0495635_0074041 3300046663 Unclassified 2333
256 Ga0495647_0001993 3300046681 Bacteria 6375
257 Ga0495613_0154622 3300046689 Unclassified 1634
258 Ga0495624_0050814 3300046690 Bacteria 2625
259 Ga0495604_0000651 3300047317 Bacteria 29612
260 Ga0495604_0154241 3300047317 Bacteria 1628
261 Ga0495676_0153744 3300047321 Unclassified 1634
262 Ga0495675_0274408 3300047444 Bacteria 1007
263 Ga0495684_0121450 3300047471 Bacteria 1967
264 Ga0495684_0245227 3300047471 Unclassified 1305
265 Ga0495602_0007441 3300048088 Bacteria 11454
266 Ga0495614_0019148 3300048089 Unclassified 2962
267 Ga0496100_0081034 3300048903 Unclassified 2192
268 Ga0496104_0076433 3300048907 Bacteria 3190
269 Ga0496105_0438830 3300048908 Bacteria 1032
270 Ga0496109_0063407 3300048912 Bacteria 3381
271 Ga0496114_0095103 3300048917 Bacteria 2535
272 Ga0501031_0086338 3300049568 Bacteria 2046
273 Ga0501036_0098488 3300049572 Bacteria 2472
274 Ga0501037_0118598 3300049573 Bacteria 1904
275 Ga0501038_0178873 3300049574 Bacteria 1713
276 Ga0501039_0083169 3300049575 Bacteria 2493
277 Ga0501040_0128459 3300049576 Bacteria 1781
278 Ga0501041_0018913 3300049577 Bacteria 4104
279 Ga0501042_0030887 3300049578 Bacteria 3788
280 Ga0501046_0180181 3300049580 Bacteria 1580
281 Ga0501048_0055735 3300049582 Bacteria 2805
282 Ga0501071_0057396 3300049587 Bacteria 2813
283 Ga0501074_0059010 3300049590 Bacteria 2765
284 Ga0501075_0001433 3300049591 Bacteria 15505
285 Ga0501076_0005741 3300049592 Bacteria 8943
286 Ga0501077_0023693 3300049593 Bacteria 3892
287 Ga0501079_0006582 3300049741 Bacteria 8739
288 Ga0501081_0003935 3300049743 Bacteria 9521
289 Ga0501035_0060420 3300049822 Bacteria 3374
290 nmdc:mga0n895_9795_c1 3300050512 Bacteria 8415
291 nmdc:mga08x19_40281_c1 3300050514 Unclassified 2973
292 nmdc:mga08x19_563_c1 3300050514 Bacteria 24268
293 nmdc:mga08x19_71660_c1 3300050514 Bacteria 2259
294 nmdc:mga0a205_180511_c1 3300050515 Bacteria 2005
295 Ga0495601_0157300 3300053077 Bacteria 1484
296 Ga0495619_0316101 3300053085 Unclassified 1081
297 Ga0501084_0018585 3300054114 Bacteria 5784
298 Ga0501082_0009433 3300060353 Bacteria 8400
299 Ga0530510_0041907 3300061734 Bacteria 3306
300 Ga0265760_10006615
301 rootL2_10252681
302 Ga0070676_10003488
303 Ga0070683_100271742
304 Ga0070683_100573561
305 Ga0070690_100015188
306 Ga0068869_100007486
307 Ga0070682_100228797
308 Ga0070660_100379810
309 Ga0070661_100429685
310 Ga0070674_100011065
311 Ga0070709_10018848
312 Ga0070709_10020531
313 Ga0070709_10051678
314 Ga0070709_10103748
315 Ga0070709_10357956
316 Ga0070714_100138622
317 Ga0070713_100026934
318 Ga0070713_100127464
319 Ga0070713_100260300
320 Ga0070710_10139960
321 Ga0070711_100009014
322 Ga0070711_100014944
323 Ga0070711_100027127
324 Ga0070711_100351477
325 Ga0070705_100003772
326 Ga0070700_100053262
327 Ga0070700_100191618
328 Ga0070694_100004484
329 Ga0070708_100014555
330 Ga0070708_100042584
331 Ga0070708_100158823
332 Ga0070678_100075298
333 Ga0070662_100114796
334 Ga0068867_100126885
335 Ga0070706_100001238
336 Ga0070706_100074284
337 Ga0070707_100004364
338 Ga0070707_100048062
339 Ga0070707_100086123
340 Ga0070707_100413702
341 Ga0070698_100023626
342 Ga0070699_100008976
343 Ga0070699_100065850
344 Ga0070679_100119082
345 Ga0070679_100313537
346 Ga0070697_100001438
347 Ga0070697_100001627
348 Ga0070697_100051125
349 Ga0070697_100205146
350 Ga0070686_100190503
351 Ga0070695_100004874
352 Ga0070695_100021306
353 Ga0070696_100002289
354 Ga0070696_100003059
355 Ga0070693_100001209
356 Ga0070693_100064590
357 Ga0070665_100000985
358 Ga0070665_100252092
359 Ga0070704_100012006
360 Ga0070664_100028478
361 Ga0070664_100035786
362 Ga0068857_100003314
363 Ga0068854_100001930
364 Ga0070702_100016316
365 Ga0068852_100156672
366 Ga0068859_100106788
367 Ga0068864_100029554
368 Ga0068866_10000165
369 Ga0068858_100562020
370 Ga0068860_100022248
371 Ga0068860_100218280
372 Ga0068860_100406054
373 Ga0068860_100564213
374 Ga0070717_10162008
375 Ga0070715_10053949
376 Ga0070716_100000398
377 Ga0070716_100005680
378 Ga0070716_100042271
379 Ga0070716_100115446
380 Ga0070712_100046466
381 Ga0070712_100052184
382 Ga0070712_100257390
383 Ga0097621_100049714
384 Ga0075434_100004991
385 Ga0075429_100748655
386 Ga0068865_100001488
387 Ga0068865_100548533
388 Ga0075436_100001171
389 Ga0075436_100313040
390 Ga0097620_100106789
391 Ga0075435_100369978
392 Ga0099794_10012973
393 Ga0099794_10088401
394 Ga0099794_10109470
395 Ga0099794_10213757
396 Ga0099794_10218201
397 Ga0105245_10043269
398 Ga0105245_10458530
399 Ga0105247_10132613
400 Ga0114129_10069529
401 Ga0105243_10003787
402 Ga0105241_10006356
403 Ga0105242_10001152
404 Ga0105242_10313288
405 Ga0105248_10015428
406 Ga0105248_10040479
407 Ga0105248_10850125
408 Ga0105237_10217826
409 Ga0105249_10280315
410 Ga0105249_11232913
411 Ga0099796_10039488
412 Ga0105239_10107645
413 Ga0105246_10004556
414 Ga0157374_10165729
415 Ga0157378_10000505
416 Ga0157378_10017824
417 Ga0157378_10097246
418 Ga0157378_10329629
419 Ga0163162_10135193
420 Ga0163162_10283284
421 Ga0157372_10081193
422 Ga0157375_10097568
423 Ga0157375_10213093
424 Ga0157375_10458681
425 Ga0157375_10701273
426 Ga0163163_10472673
427 Ga0157380_10371610
428 Ga0157379_10026519
429 Ga0157379_10068623
430 Ga0157376_10055803
431 Ga0207692_10224366
432 Ga0207642_10004570
433 Ga0207710_10074259
434 Ga0207685_10087007
435 Ga0207699_10009400
436 Ga0207699_10016868
437 Ga0207699_10077145
438 Ga0207699_10181028
439 Ga0207699_10482350
440 Ga0207645_10000654
441 Ga0207643_10007065
442 Ga0207684_10004503
443 Ga0207684_10076124
444 Ga0207671_10081217
445 Ga0207693_10045796
446 Ga0207693_10098772
447 Ga0207663_10005904
448 Ga0207663_10057938
449 Ga0207652_10028658
450 Ga0207646_10004154
451 Ga0207646_10094980
452 Ga0207646_10231158
453 Ga0207646_10346911
454 Ga0207687_10073221
455 Ga0207700_10133951
456 Ga0207700_10181544
457 Ga0207700_10184390
458 Ga0207706_10000244
459 Ga0207686_10000150
460 Ga0207686_10041726
461 Ga0207669_10003993
462 Ga0207704_10003675
463 Ga0207665_10000103
464 Ga0207665_10004896
465 Ga0207665_10062147
466 Ga0207665_10083738
467 Ga0207665_10093202
468 Ga0207711_10428025
469 Ga0207689_10004041
470 Ga0207661_10211028
471 Ga0207712_10028954
472 Ga0207640_10020260
473 Ga0207658_10258207
474 Ga0207703_10543977
475 Ga0207678_10106807
476 Ga0207641_10229828
477 Ga0207648_10000273
478 Ga0207676_10006035
479 Ga0207676_10303341
480 Ga0207674_10155814
481 Ga0207675_100038542
482 Ga0207683_10103934
483 Ga0207698_10322859
484 Ga0209588_1039694
485 Ga0209966_1043072
486 Ga0268266_10000366
487 Ga0268266_10169177
488 Ga0268264_10014785
489 Ga0268264_10018693
490 Ga0268264_10097625
491 Ga0307405_10076017
492 Ga0307413_10038034
493 Ga0307413_10123621
494 Ga0307413_10200271
495 Ga0307410_10116093
496 Ga0307406_10092063
497 Ga0307406_10377909
498 Ga0307407_10018796
499 Ga0307407_10038988
500 Ga0307407_10051321
501 Ga0307409_100076964
502 Ga0307409_100423107
503 Ga0307414_10270395
504 Ga0307414_10595281
505 Ga0307411_10011507
506 Ga0307411_10698138
507 Ga0307510_10137906
508 Ga0373926_0000951
509 Ga0373954_0006899
510 Ga0373954_0049472
511 Ga0373956_0186499
512 Ga0373955_0023753
513 Ga0373924_0018714
514 Ga0373931_0050296
515 Ga0373927_0000220
516 Ga0373933_0000737
517 Ga0373947_0001138
518 Ga0373937_0002826
519 Ga0373937_0062559
520 Ga0373925_0001203
521 Ga0450898_013307
522 Ga0439444_0068354
523 Ga0451577_0000448
524 Ga0451577_0013691
525 Ga0451577_0060021
526 Ga0453683_0001099
527 Ga0453683_0245628
528 Ga0453684_0000696
529 Ga0453684_0230601
530 Ga0451576_0555540
531 Ga0495603_0020367
532 Ga0495629_0143601
533 Ga0495641_0171199
534 Ga0495651_0189535
535 Ga0495651_0357413
536 Ga0495580_0004886
537 Ga0495580_0183677
538 Ga0495580_0221453
539 Ga0495582_0001219
540 Ga0495582_0024604
541 Ga0495639_0004136
542 Ga0495639_0251962
543 Ga0495662_0040609
544 Ga0495594_0060425
545 Ga0495594_0231512
546 Ga0495608_0029056
547 Ga0495630_0018091
548 Ga0495630_0053977
549 Ga0495666_0012109
550 Ga0495666_0085993
551 Ga0495587_0001796
552 Ga0495587_0017610
553 Ga0495667_0010809
554 Ga0495635_0074041
555 Ga0495647_0001993
556 Ga0495613_0154622
557 Ga0495624_0050814
558 Ga0495604_0000651
559 Ga0495604_0154241
560 Ga0495676_0153744
561 Ga0495675_0274408
562 Ga0495684_0121450
563 Ga0495684_0245227
564 Ga0495602_0007441
565 Ga0495614_0019148
566 Ga0496100_0081034
567 Ga0496104_0076433
568 Ga0496105_0438830
569 Ga0496109_0063407
570 Ga0496114_0095103
571 Ga0501031_0086338
572 Ga0501036_0098488
573 Ga0501037_0118598
574 Ga0501038_0178873
575 Ga0501039_0083169
576 Ga0501040_0128459
577 Ga0501041_0018913
578 Ga0501042_0030887
579 Ga0501046_0180181
580 Ga0501048_0055735
581 Ga0501071_0057396
582 Ga0501074_0059010
583 Ga0501075_0001433
584 Ga0501076_0005741
585 Ga0501077_0023693
586 Ga0501079_0006582
587 Ga0501081_0003935
588 Ga0501035_0060420
589 nmdc:mga0n895_9795_c1
590 nmdc:mga08x19_40281_c1
591 nmdc:mga08x19_563_c1
592 nmdc:mga08x19_71660_c1
593 nmdc:mga0a205_180511_c1
594 Ga0495601_0157300
595 Ga0495619_0316101
596 Ga0501084_0018585
597 Ga0501082_0009433
598 Ga0530510_0041907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

232

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

273

0.91

PF08659

KR

KR domain

41

204

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.95 1 241
3osu-assembly1.cif.gz_A crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.948 4 241
7do5-assembly2.cif.gz_G crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase(apo-form) 0.9472 2 238
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.947 4 241
3osu-assembly1.cif.gz_B crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus 0.9434 6 241
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9497 3 184 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9463 5 241 3.40.50.720
af_Q19843_28_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9453 1 183 3.40.50.720
4lvuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9361 2 241 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9361 3 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q7XW50-F1-model_v4 Short-chain dehydrogenase 0.9872 1 161
AF-A0A524HHS5-F1-model_v4 SDR family oxidoreductase 0.9855 1 240
AF-A0A524PG83-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9773 1 184
AF-A0A841GWA9-F1-model_v4 Pteridine reductase (EC 1.5.1.33) 0.9764 4 240 GO:0016491
AF-A0A847I682-F1-model_v4 SDR family oxidoreductase 0.9763 1 240

Map