F394743

General Info

Members Datasets Scaffolds Average Seq Length
299 168 598 467

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100031310|Ga0068859_1000313104
Length 521
Sequence MKCCRNSVAVFAEKPVCNRMLGDLKAIPKWKRNNNMQERDSVHHPDEFREEEQRVEDRSAGFKKELGLTDLVLTQILFIVGLPWVGVAAKQGQSHIVLWLTAILLFYLPSAFVVIYLNRAMPLEGGVYQWAKLGFNDLTGFMVAWNLWLFAILNTSEVGLQVTQYISYVVGPSGEWLNSSAWFIGGTNVVVLGTLVVITIIGLSIGKWVHKAGAVLMLAIFAAIIILPLLNLAHGSITEYHPLRLELPVMSILTFNLLGKMGFGALGGFEYVAIHAGEARDPVRSIGRSVMIAAPIVAVMFILGTSSVLALIPQNEIDLIAPIPQILSVGFGPLGAAAAIVPITIMAMLSIRLAQSSVQFGGNTRLPMVAGWDNLLPDWFTKLHVKYRTPVNSIIFVGAVTLTMGIVGLIGVGKQEAFQLLWNASGLFYSLTYLVMFAIPLFGLRNVTPPPPMWLKLAALSGFLMTLLYVALSVVPIINVESRIGFAFKVGGLILVTNLIGLLFYGLAKKKGAERKSQPLE

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 2.68
Rhizosphere 93.65
Stem 0
Stem Tuber 0
Unclassified 17.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100031310 3300005617 Bacteria 5341
2 Ga0065712_10103422 3300005290 Unclassified 1985
3 Ga0065715_10170732 3300005293 Unclassified 1545
4 Ga0065707_10012573 3300005295 Unclassified 2489
5 Ga0065707_10122371 3300005295 Bacteria 2089
6 Ga0070676_10007565 3300005328 Bacteria 5835
7 Ga0070676_10030871 3300005328 Bacteria 3059
8 Ga0070683_100029249 3300005329 Bacteria 4986
9 Ga0070690_100025514 3300005330 Unclassified 3640
10 Ga0070670_100001742 3300005331 Bacteria 17720
11 Ga0070670_100002604 3300005331 Bacteria 14912
12 Ga0070670_100007810 3300005331 Bacteria 9102
13 Ga0070670_100032898 3300005331 Bacteria 4468
14 Ga0070670_100070088 3300005331 Bacteria 3010
15 Ga0068869_100051361 3300005334 Bacteria 2991
16 Ga0070666_10009527 3300005335 Bacteria 6058
17 Ga0070666_10012613 3300005335 Bacteria 5338
18 Ga0068868_100096237 3300005338 Bacteria 2391
19 Ga0070689_100041561 3300005340 Bacteria 3530
20 Ga0070689_100044439 3300005340 Unclassified 3417
21 Ga0070661_100001466 3300005344 Bacteria 16389
22 Ga0070669_100009218 3300005353 Bacteria 7033
23 Ga0070669_100034502 3300005353 Bacteria 3663
24 Ga0070669_100135307 3300005353 Unclassified 1895
25 Ga0070675_100002727 3300005354 Bacteria 13277
26 Ga0070674_100034291 3300005356 Bacteria 3389
27 Ga0070673_100022024 3300005364 Bacteria 4631
28 Ga0070688_100044009 3300005365 Bacteria 2754
29 Ga0070659_100004509 3300005366 Bacteria 9949
30 Ga0070667_100007637 3300005367 Bacteria 8970
31 Ga0070667_100126955 3300005367 Unclassified 2223
32 Ga0070667_100155995 3300005367 Unclassified 2008
33 Ga0070703_10000334 3300005406 Bacteria 21062
34 Ga0070709_10000009 3300005434 Bacteria 178953
35 Ga0070709_10000075 3300005434 Bacteria 75453
36 Ga0070701_10007186 3300005438 Bacteria 4740
37 Ga0070701_10024307 3300005438 Bacteria 2930
38 Ga0070711_100000038 3300005439 Bacteria 85684
39 Ga0070705_100000238 3300005440 Bacteria 32601
40 Ga0070705_100026191 3300005440 Bacteria 3172
41 Ga0070705_100111529 3300005440 Bacteria 1749
42 Ga0070700_100009062 3300005441 Bacteria 5453
43 Ga0070700_100030141 3300005441 Bacteria 3239
44 Ga0070694_100002150 3300005444 Bacteria 11690
45 Ga0070663_100047612 3300005455 Bacteria 3037
46 Ga0070678_100068526 3300005456 Bacteria 2645
47 Ga0070662_100039531 3300005457 Bacteria 3355
48 Ga0070681_10005775 3300005458 Bacteria 11967
49 Ga0070681_10016154 3300005458 Bacteria 7442
50 Ga0070681_10141879 3300005458 Bacteria 2332
51 Ga0068867_100011727 3300005459 Bacteria 6189
52 Ga0068867_100017171 3300005459 Bacteria 5142
53 Ga0070685_10014342 3300005466 Bacteria 4196
54 Ga0070685_10029770 3300005466 Bacteria 3036
55 Ga0070706_100000820 3300005467 Bacteria 34294
56 Ga0070706_100117180 3300005467 Unclassified 2481
57 Ga0070707_100026447 3300005468 Bacteria 5509
58 Ga0070699_100000018 3300005518 Bacteria 190128
59 Ga0070697_100213696 3300005536 Bacteria 1643
60 Ga0068853_100014235 3300005539 Bacteria 6510
61 Ga0070672_100012794 3300005543 Bacteria 5908
62 Ga0070686_100007170 3300005544 Bacteria 6208
63 Ga0070695_100071129 3300005545 Bacteria 2277
64 Ga0070695_100083666 3300005545 Bacteria 2115
65 Ga0070696_100000011 3300005546 Bacteria 82210
66 Ga0070696_100122972 3300005546 Unclassified 1880
67 Ga0070693_100001849 3300005547 Bacteria 9667
68 Ga0070693_100007801 3300005547 Bacteria 5249
69 Ga0070665_100288375 3300005548 Unclassified 1644
70 Ga0070704_100026438 3300005549 Bacteria 3834
71 Ga0070704_100191783 3300005549 Unclassified 1643
72 Ga0068855_100021840 3300005563 Bacteria 7675
73 Ga0068855_100170677 3300005563 Bacteria 2464
74 Ga0070664_100000164 3300005564 Bacteria 45854
75 Ga0070664_100060223 3300005564 Bacteria 3232
76 Ga0068857_100038956 3300005577 Bacteria 4208
77 Ga0068854_100015368 3300005578 Bacteria 5069
78 Ga0068856_100243139 3300005614 Unclassified 1815
79 Ga0068859_100018970 3300005617 Bacteria 6908
80 Ga0068859_100026185 3300005617 Bacteria 5850
81 Ga0068859_100049364 3300005617 Bacteria 4226
82 Ga0068859_100113850 3300005617 Unclassified 2768
83 Ga0068864_100012785 3300005618 Bacteria 6940
84 Ga0068864_100020961 3300005618 Bacteria 5473
85 Ga0068864_100109951 3300005618 Bacteria 2454
86 Ga0068864_100166929 3300005618 Unclassified 2005
87 Ga0068861_100009988 3300005719 Bacteria 6573
88 Ga0068861_100017179 3300005719 Bacteria 5130
89 Ga0068861_100148060 3300005719 Unclassified 1924
90 Ga0068863_100006804 3300005841 Bacteria 11206
91 Ga0068863_100028366 3300005841 Bacteria 5345
92 Ga0068863_100260717 3300005841 Unclassified 1676
93 Ga0068858_100020817 3300005842 Bacteria 6131
94 Ga0068858_100027870 3300005842 Bacteria 5248
95 Ga0068858_100112450 3300005842 Bacteria 2543
96 Ga0068858_100119320 3300005842 Bacteria 2466
97 Ga0068860_100001923 3300005843 Bacteria 21994
98 Ga0068860_100044992 3300005843 Bacteria 4207
99 Ga0068860_100074055 3300005843 Bacteria 3237
100 Ga0068862_100036994 3300005844 Bacteria 4136
101 Ga0068862_100042602 3300005844 Bacteria 3867
102 Ga0068862_100086887 3300005844 Unclassified 2719
103 Ga0068862_100264179 3300005844 Bacteria 1572
104 Ga0081539_10018150 3300005985 Bacteria 4897
105 Ga0075364_10001627 3300006051 Bacteria 12308
106 Ga0075364_10001638 3300006051 Bacteria 12285
107 Ga0070716_100001836 3300006173 Bacteria 9618
108 Ga0075362_10019536 3300006177 Bacteria 2819
109 Ga0075367_10002569 3300006178 Bacteria 8334
110 Ga0075370_10008057 3300006353 Bacteria 5405
111 Ga0075428_100001417 3300006844 Bacteria 25545
112 Ga0075428_100191775 3300006844 Bacteria 2210
113 Ga0075433_10017762 3300006852 Bacteria 5902
114 Ga0075433_10024659 3300006852 Bacteria 5080
115 Ga0075433_10146124 3300006852 Bacteria 2102
116 Ga0075434_100019630 3300006871 Bacteria 6541
117 Ga0075434_100021797 3300006871 Bacteria 6232
118 Ga0075434_100042836 3300006871 Bacteria 4489
119 Ga0075434_100043058 3300006871 Unclassified 4476
120 Ga0075434_100057758 3300006871 Bacteria 3856
121 Ga0075434_100074255 3300006871 Unclassified 3394
122 Ga0075434_100301736 3300006871 Unclassified 1622
123 Ga0075436_100000056 3300006914 Bacteria 65961
124 Ga0075436_100001227 3300006914 Bacteria 17440
125 Ga0075436_100007708 3300006914 Bacteria 7356
126 Ga0075436_100032086 3300006914 Bacteria 3619
127 Ga0097620_100018971 3300006931 Bacteria 6908
128 Ga0097620_100026185 3300006931 Bacteria 5850
129 Ga0097620_100031309 3300006931 Bacteria 5341
130 Ga0097620_100049365 3300006931 Bacteria 4226
131 Ga0097620_100113849 3300006931 Unclassified 2768
132 Ga0075435_100002609 3300007076 Bacteria 12026
133 Ga0105240_10022681 3300009093 Bacteria 8317
134 Ga0105240_10113522 3300009093 Bacteria 3274
135 Ga0111539_10004869 3300009094 Bacteria 17485
136 Ga0111539_10033818 3300009094 Bacteria 6204
137 Ga0111539_10034787 3300009094 Bacteria 6104
138 Ga0111539_10114343 3300009094 Unclassified 3165
139 Ga0111539_10186548 3300009094 Bacteria 2422
140 Ga0111539_10424051 3300009094 Bacteria 1549
141 Ga0105245_10030796 3300009098 Bacteria 4745
142 Ga0105247_10009160 3300009101 Bacteria 6025
143 Ga0114129_10006210 3300009147 Bacteria 16948
144 Ga0114129_10007049 3300009147 Bacteria 16000
145 Ga0114129_10035945 3300009147 Bacteria 6996
146 Ga0114129_10040430 3300009147 Bacteria 6574
147 Ga0114129_10055682 3300009147 Bacteria 5542
148 Ga0114129_10084873 3300009147 Bacteria 4395
149 Ga0114129_10100893 3300009147 Bacteria 3994
150 Ga0105241_10030048 3300009174 Bacteria 4058
151 Ga0105242_10011798 3300009176 Bacteria 6725
152 Ga0105248_10068723 3300009177 Unclassified 3978
153 Ga0105237_10026776 3300009545 Bacteria 5892
154 Ga0105237_10063428 3300009545 Bacteria 3692
155 Ga0105249_10004136 3300009553 Bacteria 12536
156 Ga0105249_10029232 3300009553 Bacteria 4977
157 Ga0105249_10232600 3300009553 Bacteria 1818
158 Ga0105239_10130653 3300010375 Unclassified 2793
159 Ga0105239_10197201 3300010375 Bacteria 2255
160 Ga0157373_10046045 3300013100 Bacteria 3113
161 Ga0157369_10086385 3300013105 Bacteria 3350
162 Ga0157374_10052258 3300013296 Bacteria 3805
163 Ga0157374_10194555 3300013296 Bacteria 1984
164 Ga0163162_10155313 3300013306 Unclassified 2408
165 Ga0163162_10328802 3300013306 Unclassified 1661
166 Ga0157372_10106012 3300013307 Unclassified 3215
167 Ga0157372_10130442 3300013307 Bacteria 2892
168 Ga0163163_10003268 3300014325 Bacteria 13749
169 Ga0163163_10047725 3300014325 Unclassified 4210
170 Ga0163163_10133278 3300014325 Bacteria 2525
171 Ga0157380_10179310 3300014326 Unclassified 1860
172 Ga0157377_10027496 3300014745 Bacteria 3054
173 Ga0157379_10065125 3300014968 Unclassified 3258
174 Ga0157379_10079424 3300014968 Bacteria 2938
175 Ga0157376_10065757 3300014969 Unclassified 3063
176 Ga0163161_10010304 3300017792 Bacteria 6473
177 Ga0163161_10016210 3300017792 Bacteria 5200
178 Ga0207653_10000296 3300025885 Bacteria 28845
179 Ga0207642_10024814 3300025899 Unclassified 2416
180 Ga0207710_10009585 3300025900 Bacteria 4073
181 Ga0207680_10010496 3300025903 Bacteria 4635
182 Ga0207699_10000001 3300025906 Bacteria 695560
183 Ga0207699_10000020 3300025906 Bacteria 179154
184 Ga0207645_10003840 3300025907 Bacteria 11249
185 Ga0207645_10025031 3300025907 Bacteria 3864
186 Ga0207684_10001910 3300025910 Bacteria 21642
187 Ga0207707_10019363 3300025912 Bacteria 5941
188 Ga0207707_10092311 3300025912 Bacteria 2646
189 Ga0207695_10042573 3300025913 Bacteria 4848
190 Ga0207663_10000017 3300025916 Bacteria 145654
191 Ga0207662_10007290 3300025918 Bacteria 6012
192 Ga0207646_10048953 3300025922 Unclassified 3787
193 Ga0207646_10085122 3300025922 Bacteria 2828
194 Ga0207681_10043788 3300025923 Unclassified 2997
195 Ga0207681_10096723 3300025923 Unclassified 2120
196 Ga0207681_10178972 3300025923 Bacteria 1614
197 Ga0207650_10033250 3300025925 Bacteria 3733
198 Ga0207650_10195833 3300025925 Unclassified 1616
199 Ga0207650_10196804 3300025925 Unclassified 1613
200 Ga0207659_10002877 3300025926 Bacteria 10248
201 Ga0207706_10059197 3300025933 Bacteria 3374
202 Ga0207669_10010589 3300025937 Bacteria 4444
203 Ga0207704_10020752 3300025938 Bacteria 3483
204 Ga0207665_10009258 3300025939 Bacteria 6467
205 Ga0207665_10058112 3300025939 Bacteria 2614
206 Ga0207691_10023279 3300025940 Bacteria 5831
207 Ga0207711_10041596 3300025941 Bacteria 3914
208 Ga0207711_10058346 3300025941 Unclassified 3321
209 Ga0207711_10122207 3300025941 Unclassified 2326
210 Ga0207689_10060718 3300025942 Bacteria 3109
211 Ga0207661_10025004 3300025944 Bacteria 4534
212 Ga0207679_10017467 3300025945 Bacteria 4786
213 Ga0207679_10031922 3300025945 Bacteria 3691
214 Ga0207651_10070231 3300025960 Unclassified 2477
215 Ga0207712_10006875 3300025961 Bacteria 7180
216 Ga0207668_10056203 3300025972 Bacteria 2740
217 Ga0207640_10019072 3300025981 Bacteria 4045
218 Ga0207658_10063739 3300025986 Bacteria 2763
219 Ga0207658_10083936 3300025986 Unclassified 2450
220 Ga0207677_10132340 3300026023 Unclassified 1896
221 Ga0207703_10037261 3300026035 Bacteria 3873
222 Ga0207703_10065686 3300026035 Bacteria 2982
223 Ga0207703_10287620 3300026035 Bacteria 1495
224 Ga0207639_10003264 3300026041 Bacteria 10925
225 Ga0207639_10018976 3300026041 Bacteria 4896
226 Ga0207639_10029731 3300026041 Bacteria 4003
227 Ga0207678_10035038 3300026067 Bacteria 4370
228 Ga0207708_10013806 3300026075 Bacteria 6039
229 Ga0207708_10014129 3300026075 Bacteria 5968
230 Ga0207702_10198331 3300026078 Bacteria 1859
231 Ga0207641_10002720 3300026088 Bacteria 16134
232 Ga0207641_10079740 3300026088 Unclassified 2839
233 Ga0207641_10119383 3300026088 Unclassified 2350
234 Ga0207648_10005622 3300026089 Bacteria 12600
235 Ga0207648_10027212 3300026089 Bacteria 5079
236 Ga0207648_10051699 3300026089 Bacteria 3592
237 Ga0207676_10160838 3300026095 Bacteria 1945
238 Ga0207676_10174695 3300026095 Unclassified 1875
239 Ga0207676_10203305 3300026095 Bacteria 1752
240 Ga0207674_10049009 3300026116 Bacteria 4321
241 Ga0207675_100004263 3300026118 Bacteria 13834
242 Ga0207675_100064913 3300026118 Bacteria 3412
243 Ga0207675_100141991 3300026118 Bacteria 2281
244 Ga0207683_10015990 3300026121 Bacteria 6386
245 Ga0207428_10025987 3300027907 Bacteria 4892
246 Ga0207428_10070145 3300027907 Bacteria 2755
247 Ga0207428_10071358 3300027907 Bacteria 2728
248 Ga0268266_10241335 3300028379 Unclassified 1668
249 Ga0268265_10075387 3300028380 Bacteria 2642
250 Ga0268265_10219671 3300028380 Bacteria 1662
251 Ga0268265_10221998 3300028380 Unclassified 1654
252 Ga0268264_10001440 3300028381 Bacteria 22259
253 Ga0268264_10005978 3300028381 Bacteria 10304
254 Ga0268264_10011610 3300028381 Bacteria 7267
255 Ga0307408_100086519 3300031548 Bacteria 2356
256 Ga0307413_10018494 3300031824 Bacteria 3658
257 Ga0307410_10016890 3300031852 Bacteria 4365
258 Ga0307409_100052524 3300031995 Bacteria 3126
259 Ga0373939_0019889 3300035114 Bacteria 1817
260 Ga0373941_0018281 3300035115 Bacteria 1935
261 Ga0373961_0000401 3300035241 Bacteria 18158
262 Ga0373937_0072474 3300036401 Bacteria 3177
263 Ga0495598_0007023 3300046537 Bacteria 2565
264 Ga0495600_0016220 3300046809 Bacteria 4724
265 Ga0495615_0001824 3300048090 Bacteria 3265
266 Ga0496105_0136201 3300048908 Bacteria 2023
267 Ga0496106_0165613 3300048909 Bacteria 1750
268 Ga0496108_0033938 3300048911 Unclassified 4238
269 Ga0496109_0172635 3300048912 Bacteria 2029
270 Ga0496110_0002149 3300048913 Bacteria 14707
271 Ga0496112_0029854 3300048915 Bacteria 5274
272 Ga0496113_0053606 3300048916 Bacteria 3016
273 Ga0496114_0000030 3300048917 Bacteria 168379
274 Ga0501034_0151213 3300049571 Unclassified 2297
275 Ga0501067_0092165 3300049583 Bacteria 1682
276 Ga0501069_0135190 3300049585 Bacteria 1413
277 nmdc:mga03683_11901_c1 3300050489 Bacteria 3163
278 nmdc:mga00v17_11873_c1 3300050491 Bacteria 4794
279 nmdc:mga00v17_1714_c1 3300050491 Bacteria 11388
280 nmdc:mga0k408_9545_c1 3300050493 Bacteria 5235
281 nmdc:mga06z11_13257_c1 3300050494 Bacteria 3613
282 nmdc:mga05p37_1832_c1 3300050507 Bacteria 24795
283 nmdc:mga05p37_36472_c1 3300050507 Bacteria 6032
284 nmdc:mga05p37_423_c1 3300050507 Bacteria 45688
285 nmdc:mga05p37_87096_c1 3300050507 Bacteria 3849
286 nmdc:mga08y16_15908_c1 3300050511 Bacteria 7906
287 nmdc:mga08y16_16720_c1 3300050511 Bacteria 7720
288 nmdc:mga08y16_206125_c1 3300050511 Unclassified 2037
289 nmdc:mga0n895_152635_c1 3300050512 Bacteria 2340
290 nmdc:mga0n895_189580_c1 3300050512 Bacteria 2087
291 nmdc:mga0n895_48254_c1 3300050512 Bacteria 4167
292 nmdc:mga0n895_51460_c1 3300050512 Bacteria 4041
293 nmdc:mga0rr50_180121_c1 3300050513 Unclassified 1727
294 nmdc:mga08x19_25_c1 3300050514 Bacteria 222966
295 nmdc:mga08x19_48_c1 3300050514 Bacteria 141135
296 nmdc:mga0a205_155622_c1 3300050515 Bacteria 2184
297 nmdc:mga0a205_24399_c1 3300050515 Bacteria 5750
298 nmdc:mga0a205_73592_c1 3300050515 Unclassified 3300
299 Ga0500616_0001243 3300053153 Bacteria 25559
300 Ga0068859_100031310
301 Ga0065712_10103422
302 Ga0065715_10170732
303 Ga0065707_10012573
304 Ga0065707_10122371
305 Ga0070676_10007565
306 Ga0070676_10030871
307 Ga0070683_100029249
308 Ga0070690_100025514
309 Ga0070670_100001742
310 Ga0070670_100002604
311 Ga0070670_100007810
312 Ga0070670_100032898
313 Ga0070670_100070088
314 Ga0068869_100051361
315 Ga0070666_10009527
316 Ga0070666_10012613
317 Ga0068868_100096237
318 Ga0070689_100041561
319 Ga0070689_100044439
320 Ga0070661_100001466
321 Ga0070669_100009218
322 Ga0070669_100034502
323 Ga0070669_100135307
324 Ga0070675_100002727
325 Ga0070674_100034291
326 Ga0070673_100022024
327 Ga0070688_100044009
328 Ga0070659_100004509
329 Ga0070667_100007637
330 Ga0070667_100126955
331 Ga0070667_100155995
332 Ga0070703_10000334
333 Ga0070709_10000009
334 Ga0070709_10000075
335 Ga0070701_10007186
336 Ga0070701_10024307
337 Ga0070711_100000038
338 Ga0070705_100000238
339 Ga0070705_100026191
340 Ga0070705_100111529
341 Ga0070700_100009062
342 Ga0070700_100030141
343 Ga0070694_100002150
344 Ga0070663_100047612
345 Ga0070678_100068526
346 Ga0070662_100039531
347 Ga0070681_10005775
348 Ga0070681_10016154
349 Ga0070681_10141879
350 Ga0068867_100011727
351 Ga0068867_100017171
352 Ga0070685_10014342
353 Ga0070685_10029770
354 Ga0070706_100000820
355 Ga0070706_100117180
356 Ga0070707_100026447
357 Ga0070699_100000018
358 Ga0070697_100213696
359 Ga0068853_100014235
360 Ga0070672_100012794
361 Ga0070686_100007170
362 Ga0070695_100071129
363 Ga0070695_100083666
364 Ga0070696_100000011
365 Ga0070696_100122972
366 Ga0070693_100001849
367 Ga0070693_100007801
368 Ga0070665_100288375
369 Ga0070704_100026438
370 Ga0070704_100191783
371 Ga0068855_100021840
372 Ga0068855_100170677
373 Ga0070664_100000164
374 Ga0070664_100060223
375 Ga0068857_100038956
376 Ga0068854_100015368
377 Ga0068856_100243139
378 Ga0068859_100018970
379 Ga0068859_100026185
380 Ga0068859_100049364
381 Ga0068859_100113850
382 Ga0068864_100012785
383 Ga0068864_100020961
384 Ga0068864_100109951
385 Ga0068864_100166929
386 Ga0068861_100009988
387 Ga0068861_100017179
388 Ga0068861_100148060
389 Ga0068863_100006804
390 Ga0068863_100028366
391 Ga0068863_100260717
392 Ga0068858_100020817
393 Ga0068858_100027870
394 Ga0068858_100112450
395 Ga0068858_100119320
396 Ga0068860_100001923
397 Ga0068860_100044992
398 Ga0068860_100074055
399 Ga0068862_100036994
400 Ga0068862_100042602
401 Ga0068862_100086887
402 Ga0068862_100264179
403 Ga0081539_10018150
404 Ga0075364_10001627
405 Ga0075364_10001638
406 Ga0070716_100001836
407 Ga0075362_10019536
408 Ga0075367_10002569
409 Ga0075370_10008057
410 Ga0075428_100001417
411 Ga0075428_100191775
412 Ga0075433_10017762
413 Ga0075433_10024659
414 Ga0075433_10146124
415 Ga0075434_100019630
416 Ga0075434_100021797
417 Ga0075434_100042836
418 Ga0075434_100043058
419 Ga0075434_100057758
420 Ga0075434_100074255
421 Ga0075434_100301736
422 Ga0075436_100000056
423 Ga0075436_100001227
424 Ga0075436_100007708
425 Ga0075436_100032086
426 Ga0097620_100018971
427 Ga0097620_100026185
428 Ga0097620_100031309
429 Ga0097620_100049365
430 Ga0097620_100113849
431 Ga0075435_100002609
432 Ga0105240_10022681
433 Ga0105240_10113522
434 Ga0111539_10004869
435 Ga0111539_10033818
436 Ga0111539_10034787
437 Ga0111539_10114343
438 Ga0111539_10186548
439 Ga0111539_10424051
440 Ga0105245_10030796
441 Ga0105247_10009160
442 Ga0114129_10006210
443 Ga0114129_10007049
444 Ga0114129_10035945
445 Ga0114129_10040430
446 Ga0114129_10055682
447 Ga0114129_10084873
448 Ga0114129_10100893
449 Ga0105241_10030048
450 Ga0105242_10011798
451 Ga0105248_10068723
452 Ga0105237_10026776
453 Ga0105237_10063428
454 Ga0105249_10004136
455 Ga0105249_10029232
456 Ga0105249_10232600
457 Ga0105239_10130653
458 Ga0105239_10197201
459 Ga0157373_10046045
460 Ga0157369_10086385
461 Ga0157374_10052258
462 Ga0157374_10194555
463 Ga0163162_10155313
464 Ga0163162_10328802
465 Ga0157372_10106012
466 Ga0157372_10130442
467 Ga0163163_10003268
468 Ga0163163_10047725
469 Ga0163163_10133278
470 Ga0157380_10179310
471 Ga0157377_10027496
472 Ga0157379_10065125
473 Ga0157379_10079424
474 Ga0157376_10065757
475 Ga0163161_10010304
476 Ga0163161_10016210
477 Ga0207653_10000296
478 Ga0207642_10024814
479 Ga0207710_10009585
480 Ga0207680_10010496
481 Ga0207699_10000001
482 Ga0207699_10000020
483 Ga0207645_10003840
484 Ga0207645_10025031
485 Ga0207684_10001910
486 Ga0207707_10019363
487 Ga0207707_10092311
488 Ga0207695_10042573
489 Ga0207663_10000017
490 Ga0207662_10007290
491 Ga0207646_10048953
492 Ga0207646_10085122
493 Ga0207681_10043788
494 Ga0207681_10096723
495 Ga0207681_10178972
496 Ga0207650_10033250
497 Ga0207650_10195833
498 Ga0207650_10196804
499 Ga0207659_10002877
500 Ga0207706_10059197
501 Ga0207669_10010589
502 Ga0207704_10020752
503 Ga0207665_10009258
504 Ga0207665_10058112
505 Ga0207691_10023279
506 Ga0207711_10041596
507 Ga0207711_10058346
508 Ga0207711_10122207
509 Ga0207689_10060718
510 Ga0207661_10025004
511 Ga0207679_10017467
512 Ga0207679_10031922
513 Ga0207651_10070231
514 Ga0207712_10006875
515 Ga0207668_10056203
516 Ga0207640_10019072
517 Ga0207658_10063739
518 Ga0207658_10083936
519 Ga0207677_10132340
520 Ga0207703_10037261
521 Ga0207703_10065686
522 Ga0207703_10287620
523 Ga0207639_10003264
524 Ga0207639_10018976
525 Ga0207639_10029731
526 Ga0207678_10035038
527 Ga0207708_10013806
528 Ga0207708_10014129
529 Ga0207702_10198331
530 Ga0207641_10002720
531 Ga0207641_10079740
532 Ga0207641_10119383
533 Ga0207648_10005622
534 Ga0207648_10027212
535 Ga0207648_10051699
536 Ga0207676_10160838
537 Ga0207676_10174695
538 Ga0207676_10203305
539 Ga0207674_10049009
540 Ga0207675_100004263
541 Ga0207675_100064913
542 Ga0207675_100141991
543 Ga0207683_10015990
544 Ga0207428_10025987
545 Ga0207428_10070145
546 Ga0207428_10071358
547 Ga0268266_10241335
548 Ga0268265_10075387
549 Ga0268265_10219671
550 Ga0268265_10221998
551 Ga0268264_10001440
552 Ga0268264_10005978
553 Ga0268264_10011610
554 Ga0307408_100086519
555 Ga0307413_10018494
556 Ga0307410_10016890
557 Ga0307409_100052524
558 Ga0373939_0019889
559 Ga0373941_0018281
560 Ga0373961_0000401
561 Ga0373937_0072474
562 Ga0495598_0007023
563 Ga0495600_0016220
564 Ga0495615_0001824
565 Ga0496105_0136201
566 Ga0496106_0165613
567 Ga0496108_0033938
568 Ga0496109_0172635
569 Ga0496110_0002149
570 Ga0496112_0029854
571 Ga0496113_0053606
572 Ga0496114_0000030
573 Ga0501034_0151213
574 Ga0501067_0092165
575 Ga0501069_0135190
576 nmdc:mga03683_11901_c1
577 nmdc:mga00v17_11873_c1
578 nmdc:mga00v17_1714_c1
579 nmdc:mga0k408_9545_c1
580 nmdc:mga06z11_13257_c1
581 nmdc:mga05p37_1832_c1
582 nmdc:mga05p37_36472_c1
583 nmdc:mga05p37_423_c1
584 nmdc:mga05p37_87096_c1
585 nmdc:mga08y16_15908_c1
586 nmdc:mga08y16_16720_c1
587 nmdc:mga08y16_206125_c1
588 nmdc:mga0n895_152635_c1
589 nmdc:mga0n895_189580_c1
590 nmdc:mga0n895_48254_c1
591 nmdc:mga0n895_51460_c1
592 nmdc:mga0rr50_180121_c1
593 nmdc:mga08x19_25_c1
594 nmdc:mga08x19_48_c1
595 nmdc:mga0a205_155622_c1
596 nmdc:mga0a205_24399_c1
597 nmdc:mga0a205_73592_c1
598 Ga0500616_0001243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

66

497

0.86

PF00324

AA_permease

Amino acid permease

73

490

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dji-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8572 22 428
4dji-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.839 21 441
4djk-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8222 21 443
4djk-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8073 21 454
4dji-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.7751 21 441
ID Description Score Start End Superfamily
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8499 17 443 1.20.1740.10
af_Q2FUX9_6_464_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8189 22 424 1.20.1740.10
af_P75835_4_476_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8165 19 454 1.20.1740.10
af_P9WQM3_13_431_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8131 17 450 1.20.1740.10
af_Q9Y1A7_38_480_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8037 17 424 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A2V5J5X7-F1-model_v4 Amino acid permease 0.9673 5 451 GO:0005886
GO:0022857
AF-A0A2V6LW05-F1-model_v4 Amino acid permease 0.9618 5 451 GO:0005886
GO:0022857
AF-A0A2V8N1D8-F1-model_v4 Amino acid permease 0.9609 71 451 GO:0005886
GO:0022857
AF-A0A7V9AUU8-F1-model_v4 APC family permease 0.9608 119 451 GO:0005886
GO:0022857
AF-A0A2V8TS34-F1-model_v4 Amino acid permease 0.9571 50 442 GO:0005886
GO:0022857

Map