F394707

General Info

Members Datasets Scaffolds Average Seq Length
299 208 245 127

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101023770|Ga0070708_1010237702
Length 149
Sequence MDRVPILKIGDVLLVSIQIDLEDQTALALQEDLADRIVTTGARGVLIDISGLDIVDSFIGRMLATIASVSRVLDAETVVVGMRPAVAITLVELGLSLDGIRTALNVERGLAVLELAGRTASGYDGGAGGDFELDGASHEEGRAGHPVGA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
10 2721755523 Delftia sp. HK171 Isolate Unclassified
11 2738543012 Acidovorax sp. CF301 Isolate Unclassified
12 2738543013 Variovorax sp. BT01 Isolate Unclassified
13 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
16 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
17 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2842747753 Variovorax sp. R-72060 Isolate Unclassified
20 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
21 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
22 2855683550 Micromonospora sp. RP3T Isolate Unclassified
23 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
24 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
25 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
26 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
27 2858882152 Micromonospora noduli MED15 Isolate Nodule
28 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
29 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
30 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
31 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
32 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
33 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
34 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
35 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
36 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
37 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
38 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
39 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
40 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
41 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
42 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
43 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
44 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
45 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
46 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
49 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
177 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
200 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
201 649633069 Micromonospora sp. L5 Isolate Unclassified
202 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
203 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
204 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
205 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
206 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
207 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
208 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.94
Metatranscriptomes 0
Isolates 18.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.36
Nodule 2.34
Rhizoplane 2.01
Rhizosphere 74.25
Stem 0
Stem Tuber 0
Unclassified 14.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1013463 3300002126 Bacteria 830
2 Ga0055539_1000524 3300003752 Bacteria 11718
3 Ga0055533_1000033 3300003756 Bacteria 265716
4 Ga0055525_1001150 3300003759 Bacteria 6259
5 Ga0055530_10001833 3300003791 Bacteria 14646
6 Ga0055540_1000001 3300003792 Bacteria 466834
7 Ga0055531_10008855 3300003794 Bacteria 5230
8 Ga0065715_10143022 3300005293 Bacteria 1826
9 Ga0065715_10146737 3300005293 Bacteria 1779
10 Ga0070658_11189851 3300005327 Bacteria 663
11 Ga0070658_11615345 3300005327 Bacteria 562
12 Ga0070676_10010887 3300005328 Bacteria 4939
13 Ga0070670_100008583 3300005331 Bacteria 8716
14 Ga0070670_100059092 3300005331 Bacteria 3291
15 Ga0070677_10000532 3300005333 Bacteria 13026
16 Ga0070666_10128077 3300005335 Bacteria 1763
17 Ga0070666_11356661 3300005335 Bacteria 531
18 Ga0068868_100201879 3300005338 Bacteria 1658
19 Ga0070661_100663893 3300005344 Bacteria 847
20 Ga0070692_10607081 3300005345 Bacteria 725
21 Ga0070668_100369865 3300005347 Bacteria 1217
22 Ga0070668_100881624 3300005347 Bacteria 799
23 Ga0070669_100018762 3300005353 Bacteria 4945
24 Ga0070669_100640354 3300005353 Bacteria 894
25 Ga0070675_100001226 3300005354 Bacteria 18654
26 Ga0070671_100002269 3300005355 Bacteria 14840
27 Ga0070671_100158279 3300005355 Bacteria 1914
28 Ga0070674_100055253 3300005356 Bacteria 2749
29 Ga0070674_101104134 3300005356 Bacteria 700
30 Ga0070673_100162273 3300005364 Bacteria 1901
31 Ga0070673_100192423 3300005364 Bacteria 1753
32 Ga0070673_100239877 3300005364 Bacteria 1576
33 Ga0070659_101206636 3300005366 Bacteria 669
34 Ga0070659_101478261 3300005366 Bacteria 605
35 Ga0070667_100084105 3300005367 Bacteria 2727
36 Ga0070667_100372616 3300005367 Bacteria 1296
37 Ga0070667_100737079 3300005367 Bacteria 913
38 Ga0070667_101376785 3300005367 Bacteria 662
39 Ga0070714_100000013 3300005435 Bacteria 211756
40 Ga0070700_100000013 3300005441 Bacteria 158921
41 Ga0070708_101023770 3300005445 Bacteria 774
42 Ga0070663_100164371 3300005455 Bacteria 1711
43 Ga0070678_100008183 3300005456 Bacteria 6251
44 Ga0070678_100043701 3300005456 Bacteria 3194
45 Ga0070678_100651313 3300005456 Bacteria 945
46 Ga0070662_100036980 3300005457 Bacteria 3459
47 Ga0068867_100003616 3300005459 Bacteria 10876
48 Ga0070685_10398228 3300005466 Bacteria 953
49 Ga0070672_100011710 3300005543 Bacteria 6126
50 Ga0070672_100024565 3300005543 Bacteria 4457
51 Ga0070672_100091692 3300005543 Bacteria 2452
52 Ga0070672_100450014 3300005543 Bacteria 1109
53 Ga0070665_100079616 3300005548 Bacteria 3282
54 Ga0070665_100207935 3300005548 Bacteria 1958
55 Ga0070665_100222965 3300005548 Bacteria 1886
56 Ga0068855_100028305 3300005563 Bacteria 6703
57 Ga0070664_100060524 3300005564 Bacteria 3225
58 Ga0068854_100822906 3300005578 Bacteria 811
59 Ga0070702_101260809 3300005615 Bacteria 598
60 Ga0068852_100318908 3300005616 Bacteria 1509
61 Ga0068852_100850581 3300005616 Bacteria 928
62 Ga0068864_100008984 3300005618 Bacteria 8242
63 Ga0068866_10193245 3300005718 Bacteria 1211
64 Ga0068861_100679005 3300005719 Bacteria 955
65 Ga0068861_100770564 3300005719 Bacteria 900
66 Ga0068851_10021181 3300005834 Bacteria 3156
67 Ga0068870_10170319 3300005840 Bacteria 1299
68 Ga0068862_101701790 3300005844 Bacteria 639
69 Ga0097621_100009546 3300006237 Bacteria 7048
70 Ga0097621_100304675 3300006237 Bacteria 1408
71 Ga0068871_100013746 3300006358 Bacteria 6018
72 Ga0068871_100161972 3300006358 Bacteria 1914
73 Ga0068865_100370346 3300006881 Bacteria 1166
74 Ga0068865_101798062 3300006881 Bacteria 554
75 Ga0079104_1000007 3300006946 Bacteria 390531
76 Ga0105250_10009581 3300009092 Bacteria 4074
77 Ga0105240_12325114 3300009093 Bacteria 555
78 Ga0105245_10584753 3300009098 Bacteria 1141
79 Ga0105243_10002781 3300009148 Bacteria 14536
80 Ga0105242_12790257 3300009176 Bacteria 539
81 Ga0105248_10813518 3300009177 Bacteria 1054
82 Ga0105239_11093337 3300010375 Bacteria 918
83 Ga0157378_10515446 3300013297 Bacteria 1196
84 Ga0157375_10018984 3300013308 Bacteria 6242
85 Ga0157375_10069542 3300013308 Bacteria 3527
86 Ga0163163_11845631 3300014325 Bacteria 665
87 Ga0157380_10142640 3300014326 Bacteria 2060
88 Ga0157380_10420058 3300014326 Bacteria 1275
89 Ga0157377_10767234 3300014745 Bacteria 707
90 Ga0157379_11052760 3300014968 Bacteria 777
91 Ga0157376_10035903 3300014969 Bacteria 4012
92 Ga0182007_10070021 3300015262 Bacteria 1149
93 Ga0163161_10013057 3300017792 Bacteria 5771
94 Ga0163161_10013856 3300017792 Bacteria 5616
95 Ga0163161_10026904 3300017792 Bacteria 4078
96 Ga0163161_10145846 3300017792 Bacteria 1795
97 Ga0163161_10504811 3300017792 Bacteria 985
98 Ga0163161_10562946 3300017792 Bacteria 935
99 Ga0209674_100064 3300025226 Bacteria 265769
100 Ga0209563_100025 3300025230 Bacteria 596456
101 Ga0209563_100099 3300025230 Bacteria 153336
102 Ga0209677_100175 3300025253 Bacteria 55052
103 Ga0209050_1000145 3300025298 Bacteria 168151
104 Ga0209051_1000018 3300025303 Bacteria 527061
105 Ga0209257_1000084 3300025304 Bacteria 291502
106 Ga0207697_10022825 3300025315 Bacteria 2563
107 Ga0207697_10170652 3300025315 Bacteria 951
108 Ga0207696_1030315 3300025711 Bacteria 1644
109 Ga0207682_10000804 3300025893 Bacteria 14510
110 Ga0207682_10003073 3300025893 Bacteria 7322
111 Ga0207682_10019204 3300025893 Bacteria 2675
112 Ga0207682_10132695 3300025893 Bacteria 1113
113 Ga0207642_10167184 3300025899 Bacteria 1186
114 Ga0207688_10034171 3300025901 Bacteria 2815
115 Ga0207688_10459761 3300025901 Bacteria 794
116 Ga0207680_10046055 3300025903 Bacteria 2576
117 Ga0207680_10622363 3300025903 Bacteria 772
118 Ga0207647_10321522 3300025904 Bacteria 879
119 Ga0207645_10050584 3300025907 Bacteria 2653
120 Ga0207645_10087025 3300025907 Bacteria 2007
121 Ga0207643_10166455 3300025908 Bacteria 1328
122 Ga0207705_10076200 3300025909 Bacteria 2438
123 Ga0207705_10635369 3300025909 Bacteria 830
124 Ga0207705_10869804 3300025909 Bacteria 699
125 Ga0207657_10730168 3300025919 Bacteria 768
126 Ga0207649_10056951 3300025920 Bacteria 2442
127 Ga0207681_10002687 3300025923 Bacteria 11265
128 Ga0207681_10023843 3300025923 Bacteria 3919
129 Ga0207681_10301653 3300025923 Bacteria 1268
130 Ga0207681_10664361 3300025923 Bacteria 865
131 Ga0207650_10000667 3300025925 Bacteria 26981
132 Ga0207650_10047683 3300025925 Bacteria 3157
133 Ga0207650_10120337 3300025925 Bacteria 2043
134 Ga0207659_10002105 3300025926 Bacteria 11788
135 Ga0207659_10020753 3300025926 Bacteria 4349
136 Ga0207687_10350261 3300025927 Bacteria 1203
137 Ga0207664_10000001 3300025929 Bacteria 724213
138 Ga0207644_10074886 3300025931 Bacteria 2486
139 Ga0207690_11354449 3300025932 Bacteria 595
140 Ga0207706_10043768 3300025933 Bacteria 3967
141 Ga0207706_11467888 3300025933 Bacteria 557
142 Ga0207686_10002339 3300025934 Bacteria 10354
143 Ga0207686_10333671 3300025934 Bacteria 1137
144 Ga0207709_10000172 3300025935 Bacteria 86654
145 Ga0207709_10378087 3300025935 Bacteria 1077
146 Ga0207669_10001145 3300025937 Bacteria 11318
147 Ga0207669_10137467 3300025937 Bacteria 1690
148 Ga0207669_10439156 3300025937 Bacteria 1031
149 Ga0207669_10708399 3300025937 Bacteria 828
150 Ga0207704_10305653 3300025938 Bacteria 1220
151 Ga0207691_10007338 3300025940 Bacteria 10633
152 Ga0207691_10020956 3300025940 Bacteria 6178
153 Ga0207691_10083474 3300025940 Bacteria 2868
154 Ga0207691_10438038 3300025940 Bacteria 1113
155 Ga0207691_10440771 3300025940 Bacteria 1109
156 Ga0207711_10338587 3300025941 Bacteria 1392
157 Ga0207679_10009792 3300025945 Bacteria 6149
158 Ga0207667_10056954 3300025949 Bacteria 4104
159 Ga0207667_11433028 3300025949 Bacteria 663
160 Ga0207651_10015951 3300025960 Bacteria 4384
161 Ga0207651_10038381 3300025960 Bacteria 3148
162 Ga0207651_10260674 3300025960 Bacteria 1423
163 Ga0207651_11338386 3300025960 Bacteria 644
164 Ga0207668_10047610 3300025972 Bacteria 2937
165 Ga0207668_11646892 3300025972 Bacteria 579
166 Ga0207640_11281399 3300025981 Bacteria 654
167 Ga0207658_10116867 3300025986 Bacteria 2119
168 Ga0207658_10138061 3300025986 Bacteria 1969
169 Ga0207658_10771285 3300025986 Bacteria 872
170 Ga0207678_10056178 3300026067 Bacteria 3389
171 Ga0207678_10084616 3300026067 Bacteria 2712
172 Ga0207708_10000146 3300026075 Bacteria 56397
173 Ga0207641_10202290 3300026088 Bacteria 1832
174 Ga0207648_10008667 3300026089 Bacteria 9815
175 Ga0207648_10212113 3300026089 Bacteria 1719
176 Ga0207648_11078626 3300026089 Bacteria 753
177 Ga0207676_10193504 3300026095 Bacteria 1791
178 Ga0207675_101413590 3300026118 Bacteria 716
179 Ga0207683_10002948 3300026121 Bacteria 14846
180 Ga0207683_10010175 3300026121 Bacteria 8021
181 Ga0207683_10140301 3300026121 Bacteria 2177
182 Ga0207683_10649439 3300026121 Bacteria 977
183 Ga0207683_10656506 3300026121 Bacteria 972
184 Ga0207698_10266860 3300026142 Bacteria 1575
185 Ga0207698_10269460 3300026142 Bacteria 1569
186 Ga0207698_10297086 3300026142 Bacteria 1502
187 Ga0207698_10619755 3300026142 Bacteria 1069
188 Ga0209281_1000020 3300027111 Bacteria 575972
189 Ga0209974_10077722 3300027876 Bacteria 1138
190 Ga0268266_10267059 3300028379 Bacteria 1587
191 Ga0268266_10643611 3300028379 Bacteria 1020
192 Ga0307517_10205548 3300028786 Bacteria 1223
193 Ga0265327_10000487 3300031251 Bacteria 69944
194 Ga0265327_10320671 3300031251 Bacteria 680
195 Ga0307408_100058064 3300031548 Bacteria 2812
196 Ga0307408_100172953 3300031548 Bacteria 1726
197 Ga0265342_10088774 3300031712 Bacteria 1775
198 Ga0307405_10001995 3300031731 Bacteria 8832
199 Ga0307405_10400774 3300031731 Bacteria 1074
200 Ga0307405_10808661 3300031731 Bacteria 786
201 Ga0307413_10201227 3300031824 Bacteria 1438
202 Ga0307413_10339483 3300031824 Bacteria 1155
203 Ga0307410_10001182 3300031852 Bacteria 11532
204 Ga0307406_10031956 3300031901 Bacteria 3209
205 Ga0307407_10072632 3300031903 Bacteria 2053
206 Ga0307412_10001505 3300031911 Bacteria 12936
207 Ga0307412_11120565 3300031911 Bacteria 701
208 Ga0307409_102404538 3300031995 Bacteria 556
209 Ga0307416_100172782 3300032002 Bacteria 2014
210 Ga0307416_101466844 3300032002 Bacteria 788
211 Ga0307416_102483581 3300032002 Bacteria 617
212 Ga0307414_10043527 3300032004 Bacteria 3059
213 Ga0307411_10000810 3300032005 Bacteria 11680
214 Ga0307415_101686203 3300032126 Bacteria 611
215 Ga0307415_102119064 3300032126 Bacteria 549
216 Ga0451791_0690731 3300041451 Bacteria 802
217 Ga0451791_0823663 3300041451 Bacteria 709
218 Ga0451804_0090081 3300041463 Bacteria 776
219 Ga0451845_0318712 3300041501 Bacteria 654
220 Ga0466963_0024994 3300044694 Bacteria 3805
221 Ga0466958_0428491 3300045836 Bacteria 855
222 Ga0466967_0058564 3300045976 Bacteria 3405
223 Ga0495606_0411401 3300046507 Bacteria 702
224 Ga0495621_0000445 3300046539 Bacteria 10179
225 Ga0495621_0359206 3300046539 Bacteria 612
226 Ga0495597_0000204 3300046542 Bacteria 54418
227 Ga0495656_0000228 3300046615 Bacteria 19893
228 Ga0495676_0641080 3300047321 Bacteria 690
229 Ga0495615_0008143 3300048090 Bacteria 2015
230 Ga0495615_0009151 3300048090 Bacteria 1939
231 Ga0496100_1168148 3300048903 Bacteria 607
232 Ga0496108_0500785 3300048911 Bacteria 1061
233 Ga0496115_0358605 3300048918 Bacteria 1188
234 Ga0496117_0208726 3300048920 Bacteria 1097
235 Ga0496124_0107969 3300048927 Bacteria 2245
236 Ga0501252_006173 3300049682 Bacteria 1325
237 nmdc:mga00v17_997685_c1 3300050491 Bacteria 527
238 nmdc:mga07m45_1243_c1 3300050496 Bacteria 11563
239 nmdc:mga07m45_668878_c1 3300050496 Bacteria 598
240 Ga0500578_0000007 3300053086 Bacteria 229642
241 Ga0500646_0215729 3300053090 Bacteria 664
242 Ga0500593_000125 3300053117 Bacteria 30272
243 Ga0500573_0461327 3300053140 Bacteria 584
244 Ga0500604_0073907 3300053151 Bacteria 1091
245 Ga0500584_096535 3300053726 Bacteria 1228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015262 Ga0182007_10070021 Ga0182007_100700212 116
2 3300017792 Ga0163161_10145846 Ga0163161_101458462 117
3 3300009098 Ga0105245_10584753 Ga0105245_105847533 118
4 3300049682 Ga0501252_006173 Ga0501252_006173_909_1271 118
5 3300003752 Ga0055539_1000524 Ga0055539_100052410 119
6 3300003756 Ga0055533_1000033 Ga0055533_1000033136 119
7 3300003759 Ga0055525_1001150 Ga0055525_10011507 119
8 3300005327 Ga0070658_11615345 Ga0070658_116153452 119
9 3300006881 Ga0068865_101798062 Ga0068865_1017980622 119
10 3300009093 Ga0105240_12325114 Ga0105240_123251141 119
11 3300010375 Ga0105239_11093337 Ga0105239_110933372 119
12 3300025226 Ga0209674_100064 Ga0209674_100064113 119
13 3300025230 Ga0209563_100099 Ga0209563_100099113 119
14 3300025253 Ga0209677_100175 Ga0209677_10017524 119
15 3300025909 Ga0207705_10635369 Ga0207705_106353692 119
16 3300025919 Ga0207657_10730168 Ga0207657_107301681 119
17 3300025949 Ga0207667_11433028 Ga0207667_114330282 119
18 3300026089 Ga0207648_11078626 Ga0207648_110786262 119
19 3300046507 Ga0495606_0411401 Ga0495606_0411401_314_682 119
20 3300048918 Ga0496115_0358605 Ga0496115_0358605_620_988 119
21 3300005435 Ga0070714_100000013 Ga0070714_100000013127 120
22 3300025929 Ga0207664_10000001 Ga0207664_10000001634 120
23 3300031995 Ga0307409_102404538 Ga0307409_1024045381 120
24 iso_pu_bacteria 2643221609 2644060359 120
25 iso_pu_bacteria 2721755523 2722883123 120
26 iso_pu_bacteria 2738543012 2739242835 120
27 iso_pu_bacteria 2816332133 2816475805 120
28 iso_pu_bacteria 2839138175 2839143694 120
29 iso_pu_bacteria 2842733646 2842738906 120
30 iso_pu_bacteria 2842733646 2842739157 120
31 iso_pu_bacteria 2842747753 2842748999 120
32 iso_pu_bacteria 2857542790 2857547137 120
33 iso_pu_bacteria 2881101125 2881102297 120
34 iso_pu_bacteria 2928115317 2928117092 120
35 iso_pu_bacteria 2939631187 2939635178 120
36 iso_pu_bacteria 2738543013 2739247797 121
37 iso_pu_bacteria 2772190715 2772641271 121
38 3300044694 Ga0466963_0024994 Ga0466963_0024994_1718_2119 122
39 3300045836 Ga0466958_0428491 Ga0466958_0428491_63_464 122
40 3300045976 Ga0466967_0058564 Ga0466967_0058564_1387_1788 122
41 iso_pu_bacteria 2501939600 2501942443 122
42 iso_pu_bacteria 2622736626 2623586078 122
43 iso_pu_bacteria 2643221585 2643933521 122
44 iso_pu_bacteria 2643221592 2643972066 122
45 iso_pu_bacteria 2643221625 2644142265 122
46 iso_pu_bacteria 2643221648 2644275959 122
47 iso_pu_bacteria 2643221656 2644314770 122
48 iso_pu_bacteria 2675903059 2676480538 122
49 iso_pu_bacteria 2831935698 2831940757 122
50 iso_pu_bacteria 2832004796 2832009618 122
51 iso_pu_bacteria 2855670206 2855671714 122
52 iso_pu_bacteria 2855676851 2855683187 122
53 iso_pu_bacteria 2855683550 2855684934 122
54 iso_pu_bacteria 2856858025 2856859975 122
55 iso_pu_bacteria 2857288857 2857294288 122
56 iso_pu_bacteria 2858848962 2858852360 122
57 iso_pu_bacteria 2858882152 2858887891 122
58 iso_pu_bacteria 2858888857 2858895136 122
59 iso_pu_bacteria 2858895516 2858898875 122
60 iso_pu_bacteria 2858902515 2858904640 122
61 iso_pu_bacteria 2866065130 2866065520 122
62 iso_pu_bacteria 2867312974 2867313715 122
63 iso_pu_bacteria 2867319477 2867322461 122
64 iso_pu_bacteria 2869048445 2869054477 122
65 iso_pu_bacteria 2869061728 2869068020 122
66 iso_pu_bacteria 2869068681 2869071092 122
67 iso_pu_bacteria 2880489317 2880494180 122
68 iso_pu_bacteria 2880495981 2880498146 122
69 iso_pu_bacteria 2884994152 2884995866 122
70 iso_pu_bacteria 2929219909 2929220189 122
71 iso_pu_bacteria 2929226422 2929226723 122
72 iso_pu_bacteria 2996221748 2996226159 122
73 iso_pu_bacteria 649633069 649810458 122
74 iso_pu_bacteria 8003830390 8003832561 122
75 iso_pu_bacteria 8003856774 8003858142 122
76 iso_pu_bacteria 8003870546 8003875398 122
77 iso_pu_bacteria 8054472261 8054476499 122
78 iso_pu_bacteria 8054727385 8054728076 122
79 iso_pu_bacteria 8054734606 8054740828 122
80 iso_pu_bacteria 8055412473 8055413288 122
81 3300005293 Ga0065715_10146737 Ga0065715_101467372 123
82 3300005355 Ga0070671_100158279 Ga0070671_1001582791 123
83 3300005364 Ga0070673_100239877 Ga0070673_1002398773 123
84 3300005366 Ga0070659_101478261 Ga0070659_1014782612 123
85 3300005367 Ga0070667_100084105 Ga0070667_1000841051 123
86 3300005455 Ga0070663_100164371 Ga0070663_1001643712 123
87 3300005456 Ga0070678_100008183 Ga0070678_1000081837 123
88 3300005548 Ga0070665_100222965 Ga0070665_1002229652 123
89 3300005615 Ga0070702_101260809 Ga0070702_1012608091 123
90 3300005719 Ga0068861_100770564 Ga0068861_1007705642 123
91 3300006237 Ga0097621_100304675 Ga0097621_1003046753 123
92 3300006358 Ga0068871_100161972 Ga0068871_1001619723 123
93 3300017792 Ga0163161_10013856 Ga0163161_100138563 123
94 3300025315 Ga0207697_10170652 Ga0207697_101706522 123
95 3300025893 Ga0207682_10000804 Ga0207682_100008042 123
96 3300025907 Ga0207645_10050584 Ga0207645_100505842 123
97 3300025923 Ga0207681_10301653 Ga0207681_103016532 123
98 3300025925 Ga0207650_10120337 Ga0207650_101203373 123
99 3300025926 Ga0207659_10020753 Ga0207659_100207533 123
100 3300025927 Ga0207687_10350261 Ga0207687_103502612 123
101 3300025932 Ga0207690_11354449 Ga0207690_113544492 123
102 3300025934 Ga0207686_10333671 Ga0207686_103336712 123
103 3300025935 Ga0207709_10378087 Ga0207709_103780872 123
104 3300025937 Ga0207669_10137467 Ga0207669_101374672 123
105 3300025940 Ga0207691_10083474 Ga0207691_100834743 123
106 3300025960 Ga0207651_10260674 Ga0207651_102606743 123
107 3300025986 Ga0207658_10138061 Ga0207658_101380613 123
108 3300026067 Ga0207678_10084616 Ga0207678_100846164 123
109 3300026118 Ga0207675_101413590 Ga0207675_1014135902 123
110 3300026121 Ga0207683_10010175 Ga0207683_100101757 123
111 3300053117 Ga0500593_000125 Ga0500593_000125_8472_8843 123
112 3300005327 Ga0070658_11189851 Ga0070658_111898512 124
113 3300005331 Ga0070670_100059092 Ga0070670_1000590922 124
114 3300005335 Ga0070666_11356661 Ga0070666_113566611 124
115 3300005344 Ga0070661_100663893 Ga0070661_1006638932 124
116 3300005347 Ga0070668_100881624 Ga0070668_1008816242 124
117 3300005353 Ga0070669_100018762 Ga0070669_1000187624 124
118 3300005364 Ga0070673_100192423 Ga0070673_1001924233 124
119 3300005366 Ga0070659_101206636 Ga0070659_1012066362 124
120 3300005367 Ga0070667_100737079 Ga0070667_1007370791 124
121 3300005367 Ga0070667_101376785 Ga0070667_1013767852 124
122 3300005456 Ga0070678_100651313 Ga0070678_1006513131 124
123 3300005457 Ga0070662_100036980 Ga0070662_1000369803 124
124 3300005543 Ga0070672_100024565 Ga0070672_1000245652 124
125 3300005543 Ga0070672_100091692 Ga0070672_1000916924 124
126 3300005543 Ga0070672_100450014 Ga0070672_1004500142 124
127 3300005548 Ga0070665_100079616 Ga0070665_1000796163 124
128 3300005844 Ga0068862_101701790 Ga0068862_1017017902 124
129 3300006946 Ga0079104_1000007 Ga0079104_100000739 124
130 3300009092 Ga0105250_10009581 Ga0105250_100095812 124
131 3300009148 Ga0105243_10002781 Ga0105243_1000278110 124
132 3300009177 Ga0105248_10813518 Ga0105248_108135181 124
133 3300013297 Ga0157378_10515446 Ga0157378_105154462 124
134 3300013308 Ga0157375_10069542 Ga0157375_100695424 124
135 3300014326 Ga0157380_10420058 Ga0157380_104200582 124
136 3300014968 Ga0157379_11052760 Ga0157379_110527602 124
137 3300017792 Ga0163161_10013057 Ga0163161_100130572 124
138 3300017792 Ga0163161_10026904 Ga0163161_100269042 124
139 3300017792 Ga0163161_10504811 Ga0163161_105048112 124
140 3300017792 Ga0163161_10562946 Ga0163161_105629462 124
141 3300025711 Ga0207696_1030315 Ga0207696_10303153 124
142 3300025893 Ga0207682_10019204 Ga0207682_100192041 124
143 3300025893 Ga0207682_10132695 Ga0207682_101326952 124
144 3300025901 Ga0207688_10459761 Ga0207688_104597612 124
145 3300025903 Ga0207680_10622363 Ga0207680_106223632 124
146 3300025904 Ga0207647_10321522 Ga0207647_103215222 124
147 3300025909 Ga0207705_10869804 Ga0207705_108698042 124
148 3300025923 Ga0207681_10002687 Ga0207681_1000268713 124
149 3300025923 Ga0207681_10664361 Ga0207681_106643611 124
150 3300025925 Ga0207650_10047683 Ga0207650_100476835 124
151 3300025931 Ga0207644_10074886 Ga0207644_100748864 124
152 3300025933 Ga0207706_10043768 Ga0207706_100437683 124
153 3300025933 Ga0207706_11467888 Ga0207706_114678882 124
154 3300025934 Ga0207686_10002339 Ga0207686_100023392 124
155 3300025935 Ga0207709_10000172 Ga0207709_1000017250 124
156 3300025937 Ga0207669_10708399 Ga0207669_107083992 124
157 3300025940 Ga0207691_10020956 Ga0207691_100209566 124
158 3300025940 Ga0207691_10438038 Ga0207691_104380382 124
159 3300025940 Ga0207691_10440771 Ga0207691_104407712 124
160 3300025941 Ga0207711_10338587 Ga0207711_103385872 124
161 3300025960 Ga0207651_10038381 Ga0207651_100383814 124
162 3300025960 Ga0207651_11338386 Ga0207651_113383862 124
163 3300025972 Ga0207668_11646892 Ga0207668_116468922 124
164 3300025986 Ga0207658_10771285 Ga0207658_107712852 124
165 3300026067 Ga0207678_10056178 Ga0207678_100561782 124
166 3300026089 Ga0207648_10212113 Ga0207648_102121133 124
167 3300026121 Ga0207683_10140301 Ga0207683_101403013 124
168 3300026121 Ga0207683_10656506 Ga0207683_106565063 124
169 3300026142 Ga0207698_10266860 Ga0207698_102668602 124
170 3300027111 Ga0209281_1000020 Ga0209281_1000020458 124
171 3300028379 Ga0268266_10267059 Ga0268266_102670592 124
172 3300028379 Ga0268266_10643611 Ga0268266_106436112 124
173 3300031251 Ga0265327_10000487 Ga0265327_1000048718 124
174 3300031731 Ga0307405_10400774 Ga0307405_104007742 124
175 3300031731 Ga0307405_10808661 Ga0307405_108086612 124
176 3300032002 Ga0307416_102483581 Ga0307416_1024835812 124
177 3300041451 Ga0451791_0823663 Ga0451791_0823663_100_474 124
178 3300046539 Ga0495621_0000445 Ga0495621_0000445_1696_2070 124
179 3300046539 Ga0495621_0359206 Ga0495621_0359206_96_470 124
180 3300046542 Ga0495597_0000204 Ga0495597_0000204_19966_20340 124
181 3300046615 Ga0495656_0000228 Ga0495656_0000228_8642_9016 124
182 3300048090 Ga0495615_0008143 Ga0495615_0008143_1140_1514 124
183 3300048090 Ga0495615_0009151 Ga0495615_0009151_108_482 124
184 3300048903 Ga0496100_1168148 Ga0496100_1168148_118_492 124
185 3300048911 Ga0496108_0500785 Ga0496108_0500785_23_397 124
186 3300048920 Ga0496117_0208726 Ga0496117_0208726_280_654 124
187 3300048927 Ga0496124_0107969 Ga0496124_0107969_328_702 124
188 3300050491 nmdc:mga00v17_997685_c1 nmdc:mga00v17_997685_c1_83_457 124
189 3300002126 JGI24035J26624_1013463 JGI24035J26624_10134632 126
190 3300003791 Ga0055530_10001833 Ga0055530_100018339 126
191 3300003792 Ga0055540_1000001 Ga0055540_1000001158 126
192 3300003794 Ga0055531_10008855 Ga0055531_100088555 126
193 3300005293 Ga0065715_10143022 Ga0065715_101430223 126
194 3300005328 Ga0070676_10010887 Ga0070676_100108875 126
195 3300005331 Ga0070670_100008583 Ga0070670_1000085838 126
196 3300005333 Ga0070677_10000532 Ga0070677_100005329 126
197 3300005335 Ga0070666_10128077 Ga0070666_101280772 126
198 3300005338 Ga0068868_100201879 Ga0068868_1002018793 126
199 3300005345 Ga0070692_10607081 Ga0070692_106070811 126
200 3300005347 Ga0070668_100369865 Ga0070668_1003698651 126
201 3300005353 Ga0070669_100640354 Ga0070669_1006403542 126
202 3300005354 Ga0070675_100001226 Ga0070675_10000122614 126
203 3300005355 Ga0070671_100002269 Ga0070671_10000226914 126
204 3300005356 Ga0070674_100055253 Ga0070674_1000552534 126
205 3300005356 Ga0070674_101104134 Ga0070674_1011041342 126
206 3300005364 Ga0070673_100162273 Ga0070673_1001622733 126
207 3300005367 Ga0070667_100372616 Ga0070667_1003726163 126
208 3300005441 Ga0070700_100000013 Ga0070700_100000013145 126
209 3300005445 Ga0070708_101023770 Ga0070708_1010237702 126
210 3300005456 Ga0070678_100043701 Ga0070678_1000437014 126
211 3300005459 Ga0068867_100003616 Ga0068867_1000036165 126
212 3300005466 Ga0070685_10398228 Ga0070685_103982282 126
213 3300005543 Ga0070672_100011710 Ga0070672_1000117103 126
214 3300005548 Ga0070665_100207935 Ga0070665_1002079351 126
215 3300005563 Ga0068855_100028305 Ga0068855_1000283053 126
216 3300005564 Ga0070664_100060524 Ga0070664_1000605242 126
217 3300005578 Ga0068854_100822906 Ga0068854_1008229062 126
218 3300005616 Ga0068852_100318908 Ga0068852_1003189083 126
219 3300005616 Ga0068852_100850581 Ga0068852_1008505812 126
220 3300005618 Ga0068864_100008984 Ga0068864_1000089846 126
221 3300005718 Ga0068866_10193245 Ga0068866_101932452 126
222 3300005719 Ga0068861_100679005 Ga0068861_1006790052 126
223 3300005834 Ga0068851_10021181 Ga0068851_100211814 126
224 3300005840 Ga0068870_10170319 Ga0068870_101703192 126
225 3300006237 Ga0097621_100009546 Ga0097621_1000095462 126
226 3300006358 Ga0068871_100013746 Ga0068871_1000137464 126
227 3300006881 Ga0068865_100370346 Ga0068865_1003703463 126
228 3300009176 Ga0105242_12790257 Ga0105242_127902572 126
229 3300013308 Ga0157375_10018984 Ga0157375_100189842 126
230 3300014325 Ga0163163_11845631 Ga0163163_118456312 126
231 3300014326 Ga0157380_10142640 Ga0157380_101426403 126
232 3300014745 Ga0157377_10767234 Ga0157377_107672342 126
233 3300014969 Ga0157376_10035903 Ga0157376_100359032 126
234 3300025230 Ga0209563_100025 Ga0209563_100025105 126
235 3300025298 Ga0209050_1000145 Ga0209050_1000145109 126
236 3300025303 Ga0209051_1000018 Ga0209051_1000018294 126
237 3300025304 Ga0209257_1000084 Ga0209257_100008478 126
238 3300025315 Ga0207697_10022825 Ga0207697_100228254 126
239 3300025893 Ga0207682_10003073 Ga0207682_100030737 126
240 3300025899 Ga0207642_10167184 Ga0207642_101671843 126
241 3300025901 Ga0207688_10034171 Ga0207688_100341711 126
242 3300025903 Ga0207680_10046055 Ga0207680_100460553 126
243 3300025907 Ga0207645_10087025 Ga0207645_100870253 126
244 3300025908 Ga0207643_10166455 Ga0207643_101664553 126
245 3300025909 Ga0207705_10076200 Ga0207705_100762004 126
246 3300025920 Ga0207649_10056951 Ga0207649_100569514 126
247 3300025923 Ga0207681_10023843 Ga0207681_100238434 126
248 3300025925 Ga0207650_10000667 Ga0207650_1000066724 126
249 3300025926 Ga0207659_10002105 Ga0207659_100021055 126
250 3300025937 Ga0207669_10001145 Ga0207669_100011456 126
251 3300025937 Ga0207669_10439156 Ga0207669_104391562 126
252 3300025938 Ga0207704_10305653 Ga0207704_103056533 126
253 3300025940 Ga0207691_10007338 Ga0207691_100073385 126
254 3300025945 Ga0207679_10009792 Ga0207679_100097925 126
255 3300025949 Ga0207667_10056954 Ga0207667_100569543 126
256 3300025960 Ga0207651_10015951 Ga0207651_100159513 126
257 3300025972 Ga0207668_10047610 Ga0207668_100476103 126
258 3300025981 Ga0207640_11281399 Ga0207640_112813992 126
259 3300025986 Ga0207658_10116867 Ga0207658_101168673 126
260 3300026075 Ga0207708_10000146 Ga0207708_100001463 126
261 3300026088 Ga0207641_10202290 Ga0207641_102022902 126
262 3300026089 Ga0207648_10008667 Ga0207648_100086675 126
263 3300026095 Ga0207676_10193504 Ga0207676_101935043 126
264 3300026121 Ga0207683_10002948 Ga0207683_100029486 126
265 3300026121 Ga0207683_10649439 Ga0207683_106494393 126
266 3300026142 Ga0207698_10269460 Ga0207698_102694602 126
267 3300026142 Ga0207698_10297086 Ga0207698_102970861 126
268 3300026142 Ga0207698_10619755 Ga0207698_106197552 126
269 3300027876 Ga0209974_10077722 Ga0209974_100777222 126
270 3300028786 Ga0307517_10205548 Ga0307517_102055482 126
271 3300031251 Ga0265327_10320671 Ga0265327_103206711 126
272 3300031548 Ga0307408_100058064 Ga0307408_1000580643 126
273 3300031548 Ga0307408_100172953 Ga0307408_1001729532 126
274 3300031712 Ga0265342_10088774 Ga0265342_100887743 126
275 3300031731 Ga0307405_10001995 Ga0307405_100019959 126
276 3300031824 Ga0307413_10201227 Ga0307413_102012272 126
277 3300031824 Ga0307413_10339483 Ga0307413_103394832 126
278 3300031852 Ga0307410_10001182 Ga0307410_100011824 126
279 3300031901 Ga0307406_10031956 Ga0307406_100319562 126
280 3300031903 Ga0307407_10072632 Ga0307407_100726322 126
281 3300031911 Ga0307412_10001505 Ga0307412_1000150515 126
282 3300031911 Ga0307412_11120565 Ga0307412_111205652 126
283 3300032002 Ga0307416_100172782 Ga0307416_1001727822 126
284 3300032002 Ga0307416_101466844 Ga0307416_1014668442 126
285 3300032004 Ga0307414_10043527 Ga0307414_100435275 126
286 3300032005 Ga0307411_10000810 Ga0307411_1000081012 126
287 3300032126 Ga0307415_101686203 Ga0307415_1016862032 126
288 3300032126 Ga0307415_102119064 Ga0307415_1021190642 126
289 3300041451 Ga0451791_0690731 Ga0451791_0690731_406_786 126
290 3300041463 Ga0451804_0090081 Ga0451804_0090081_282_662 126
291 3300041501 Ga0451845_0318712 Ga0451845_0318712_150_530 126
292 3300047321 Ga0495676_0641080 Ga0495676_0641080_131_541 126
293 3300050496 nmdc:mga07m45_1243_c1 nmdc:mga07m45_1243_c1_10815_11204 126
294 3300050496 nmdc:mga07m45_668878_c1 nmdc:mga07m45_668878_c1_34_435 126
295 3300053086 Ga0500578_0000007 Ga0500578_0000007_8449_8829 126
296 3300053090 Ga0500646_0215729 Ga0500646_0215729_25_405 126
297 3300053140 Ga0500573_0461327 Ga0500573_0461327_131_511 126
298 3300053151 Ga0500604_0073907 Ga0500604_0073907_280_660 126
299 3300053726 Ga0500584_096535 Ga0500584_096535_481_861 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

3

109

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9425 2 116
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9271 2 116
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.915 2 115
3zxn-assembly1.cif.gz_A moorella thermoacetica rsbs s58e 0.9107 2 117
7b0u-assembly1.cif.gz_F stressosome complex from listeria innocua 0.8945 2 117
ID Description Score Start End Superfamily
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.888 5 117 3.30.750.24
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8736 5 117 3.30.750.24
af_B0V3V8_450_565_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8267 3 115 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8198 4 113 3.30.750.24
af_Q9I7H4_525_631_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8164 14 113 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A7V1IF52-F1-model_v4 STAS domain-containing protein 0.9737 2 124
AF-A0A419F495-F1-model_v4 STAS domain-containing protein 0.9671 1 123
AF-A0A1M5GII7-F1-model_v4 RsbT antagonist protein RsbS 0.9636 1 125
AF-A0A249SWB1-F1-model_v4 STAS domain-containing protein 0.9629 3 116
AF-A0A1G9F696-F1-model_v4 RsbT antagonist protein RsbS 0.9629 3 113

Feature Viewer

pLDDT pTM Quality
87.79 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map