F394707
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 208 | 245 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_101023770|Ga0070708_1010237702 |
| Length | 149 |
| Sequence | MDRVPILKIGDVLLVSIQIDLEDQTALALQEDLADRIVTTGARGVLIDISGLDIVDSFIGRMLATIASVSRVLDAETVVVGMRPAVAITLVELGLSLDGIRTALNVERGLAVLELAGRTASGYDGGAGGDFELDGASHEEGRAGHPVGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 3 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 9 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 10 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 11 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 12 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 13 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 14 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 15 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 16 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 17 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 18 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 19 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 20 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 21 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 22 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 23 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 24 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 25 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 26 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 27 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 28 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 29 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 30 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 31 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 32 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 33 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 34 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 35 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 36 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 37 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 38 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 39 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 40 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 41 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 42 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 43 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 44 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 45 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 46 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 193 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 195 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 196 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 197 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 198 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 199 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 200 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 201 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 202 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 203 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 204 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 205 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 206 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 207 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 208 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.94 |
| Metatranscriptomes | 0 |
| Isolates | 18.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.36 |
| Nodule | 2.34 |
| Rhizoplane | 2.01 |
| Rhizosphere | 74.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24035J26624_1013463 | 3300002126 | Bacteria | 830 |
| 2 | Ga0055539_1000524 | 3300003752 | Bacteria | 11718 |
| 3 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 4 | Ga0055525_1001150 | 3300003759 | Bacteria | 6259 |
| 5 | Ga0055530_10001833 | 3300003791 | Bacteria | 14646 |
| 6 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 7 | Ga0055531_10008855 | 3300003794 | Bacteria | 5230 |
| 8 | Ga0065715_10143022 | 3300005293 | Bacteria | 1826 |
| 9 | Ga0065715_10146737 | 3300005293 | Bacteria | 1779 |
| 10 | Ga0070658_11189851 | 3300005327 | Bacteria | 663 |
| 11 | Ga0070658_11615345 | 3300005327 | Bacteria | 562 |
| 12 | Ga0070676_10010887 | 3300005328 | Bacteria | 4939 |
| 13 | Ga0070670_100008583 | 3300005331 | Bacteria | 8716 |
| 14 | Ga0070670_100059092 | 3300005331 | Bacteria | 3291 |
| 15 | Ga0070677_10000532 | 3300005333 | Bacteria | 13026 |
| 16 | Ga0070666_10128077 | 3300005335 | Bacteria | 1763 |
| 17 | Ga0070666_11356661 | 3300005335 | Bacteria | 531 |
| 18 | Ga0068868_100201879 | 3300005338 | Bacteria | 1658 |
| 19 | Ga0070661_100663893 | 3300005344 | Bacteria | 847 |
| 20 | Ga0070692_10607081 | 3300005345 | Bacteria | 725 |
| 21 | Ga0070668_100369865 | 3300005347 | Bacteria | 1217 |
| 22 | Ga0070668_100881624 | 3300005347 | Bacteria | 799 |
| 23 | Ga0070669_100018762 | 3300005353 | Bacteria | 4945 |
| 24 | Ga0070669_100640354 | 3300005353 | Bacteria | 894 |
| 25 | Ga0070675_100001226 | 3300005354 | Bacteria | 18654 |
| 26 | Ga0070671_100002269 | 3300005355 | Bacteria | 14840 |
| 27 | Ga0070671_100158279 | 3300005355 | Bacteria | 1914 |
| 28 | Ga0070674_100055253 | 3300005356 | Bacteria | 2749 |
| 29 | Ga0070674_101104134 | 3300005356 | Bacteria | 700 |
| 30 | Ga0070673_100162273 | 3300005364 | Bacteria | 1901 |
| 31 | Ga0070673_100192423 | 3300005364 | Bacteria | 1753 |
| 32 | Ga0070673_100239877 | 3300005364 | Bacteria | 1576 |
| 33 | Ga0070659_101206636 | 3300005366 | Bacteria | 669 |
| 34 | Ga0070659_101478261 | 3300005366 | Bacteria | 605 |
| 35 | Ga0070667_100084105 | 3300005367 | Bacteria | 2727 |
| 36 | Ga0070667_100372616 | 3300005367 | Bacteria | 1296 |
| 37 | Ga0070667_100737079 | 3300005367 | Bacteria | 913 |
| 38 | Ga0070667_101376785 | 3300005367 | Bacteria | 662 |
| 39 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 40 | Ga0070700_100000013 | 3300005441 | Bacteria | 158921 |
| 41 | Ga0070708_101023770 | 3300005445 | Bacteria | 774 |
| 42 | Ga0070663_100164371 | 3300005455 | Bacteria | 1711 |
| 43 | Ga0070678_100008183 | 3300005456 | Bacteria | 6251 |
| 44 | Ga0070678_100043701 | 3300005456 | Bacteria | 3194 |
| 45 | Ga0070678_100651313 | 3300005456 | Bacteria | 945 |
| 46 | Ga0070662_100036980 | 3300005457 | Bacteria | 3459 |
| 47 | Ga0068867_100003616 | 3300005459 | Bacteria | 10876 |
| 48 | Ga0070685_10398228 | 3300005466 | Bacteria | 953 |
| 49 | Ga0070672_100011710 | 3300005543 | Bacteria | 6126 |
| 50 | Ga0070672_100024565 | 3300005543 | Bacteria | 4457 |
| 51 | Ga0070672_100091692 | 3300005543 | Bacteria | 2452 |
| 52 | Ga0070672_100450014 | 3300005543 | Bacteria | 1109 |
| 53 | Ga0070665_100079616 | 3300005548 | Bacteria | 3282 |
| 54 | Ga0070665_100207935 | 3300005548 | Bacteria | 1958 |
| 55 | Ga0070665_100222965 | 3300005548 | Bacteria | 1886 |
| 56 | Ga0068855_100028305 | 3300005563 | Bacteria | 6703 |
| 57 | Ga0070664_100060524 | 3300005564 | Bacteria | 3225 |
| 58 | Ga0068854_100822906 | 3300005578 | Bacteria | 811 |
| 59 | Ga0070702_101260809 | 3300005615 | Bacteria | 598 |
| 60 | Ga0068852_100318908 | 3300005616 | Bacteria | 1509 |
| 61 | Ga0068852_100850581 | 3300005616 | Bacteria | 928 |
| 62 | Ga0068864_100008984 | 3300005618 | Bacteria | 8242 |
| 63 | Ga0068866_10193245 | 3300005718 | Bacteria | 1211 |
| 64 | Ga0068861_100679005 | 3300005719 | Bacteria | 955 |
| 65 | Ga0068861_100770564 | 3300005719 | Bacteria | 900 |
| 66 | Ga0068851_10021181 | 3300005834 | Bacteria | 3156 |
| 67 | Ga0068870_10170319 | 3300005840 | Bacteria | 1299 |
| 68 | Ga0068862_101701790 | 3300005844 | Bacteria | 639 |
| 69 | Ga0097621_100009546 | 3300006237 | Bacteria | 7048 |
| 70 | Ga0097621_100304675 | 3300006237 | Bacteria | 1408 |
| 71 | Ga0068871_100013746 | 3300006358 | Bacteria | 6018 |
| 72 | Ga0068871_100161972 | 3300006358 | Bacteria | 1914 |
| 73 | Ga0068865_100370346 | 3300006881 | Bacteria | 1166 |
| 74 | Ga0068865_101798062 | 3300006881 | Bacteria | 554 |
| 75 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 76 | Ga0105250_10009581 | 3300009092 | Bacteria | 4074 |
| 77 | Ga0105240_12325114 | 3300009093 | Bacteria | 555 |
| 78 | Ga0105245_10584753 | 3300009098 | Bacteria | 1141 |
| 79 | Ga0105243_10002781 | 3300009148 | Bacteria | 14536 |
| 80 | Ga0105242_12790257 | 3300009176 | Bacteria | 539 |
| 81 | Ga0105248_10813518 | 3300009177 | Bacteria | 1054 |
| 82 | Ga0105239_11093337 | 3300010375 | Bacteria | 918 |
| 83 | Ga0157378_10515446 | 3300013297 | Bacteria | 1196 |
| 84 | Ga0157375_10018984 | 3300013308 | Bacteria | 6242 |
| 85 | Ga0157375_10069542 | 3300013308 | Bacteria | 3527 |
| 86 | Ga0163163_11845631 | 3300014325 | Bacteria | 665 |
| 87 | Ga0157380_10142640 | 3300014326 | Bacteria | 2060 |
| 88 | Ga0157380_10420058 | 3300014326 | Bacteria | 1275 |
| 89 | Ga0157377_10767234 | 3300014745 | Bacteria | 707 |
| 90 | Ga0157379_11052760 | 3300014968 | Bacteria | 777 |
| 91 | Ga0157376_10035903 | 3300014969 | Bacteria | 4012 |
| 92 | Ga0182007_10070021 | 3300015262 | Bacteria | 1149 |
| 93 | Ga0163161_10013057 | 3300017792 | Bacteria | 5771 |
| 94 | Ga0163161_10013856 | 3300017792 | Bacteria | 5616 |
| 95 | Ga0163161_10026904 | 3300017792 | Bacteria | 4078 |
| 96 | Ga0163161_10145846 | 3300017792 | Bacteria | 1795 |
| 97 | Ga0163161_10504811 | 3300017792 | Bacteria | 985 |
| 98 | Ga0163161_10562946 | 3300017792 | Bacteria | 935 |
| 99 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 100 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 101 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 102 | Ga0209677_100175 | 3300025253 | Bacteria | 55052 |
| 103 | Ga0209050_1000145 | 3300025298 | Bacteria | 168151 |
| 104 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 105 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 106 | Ga0207697_10022825 | 3300025315 | Bacteria | 2563 |
| 107 | Ga0207697_10170652 | 3300025315 | Bacteria | 951 |
| 108 | Ga0207696_1030315 | 3300025711 | Bacteria | 1644 |
| 109 | Ga0207682_10000804 | 3300025893 | Bacteria | 14510 |
| 110 | Ga0207682_10003073 | 3300025893 | Bacteria | 7322 |
| 111 | Ga0207682_10019204 | 3300025893 | Bacteria | 2675 |
| 112 | Ga0207682_10132695 | 3300025893 | Bacteria | 1113 |
| 113 | Ga0207642_10167184 | 3300025899 | Bacteria | 1186 |
| 114 | Ga0207688_10034171 | 3300025901 | Bacteria | 2815 |
| 115 | Ga0207688_10459761 | 3300025901 | Bacteria | 794 |
| 116 | Ga0207680_10046055 | 3300025903 | Bacteria | 2576 |
| 117 | Ga0207680_10622363 | 3300025903 | Bacteria | 772 |
| 118 | Ga0207647_10321522 | 3300025904 | Bacteria | 879 |
| 119 | Ga0207645_10050584 | 3300025907 | Bacteria | 2653 |
| 120 | Ga0207645_10087025 | 3300025907 | Bacteria | 2007 |
| 121 | Ga0207643_10166455 | 3300025908 | Bacteria | 1328 |
| 122 | Ga0207705_10076200 | 3300025909 | Bacteria | 2438 |
| 123 | Ga0207705_10635369 | 3300025909 | Bacteria | 830 |
| 124 | Ga0207705_10869804 | 3300025909 | Bacteria | 699 |
| 125 | Ga0207657_10730168 | 3300025919 | Bacteria | 768 |
| 126 | Ga0207649_10056951 | 3300025920 | Bacteria | 2442 |
| 127 | Ga0207681_10002687 | 3300025923 | Bacteria | 11265 |
| 128 | Ga0207681_10023843 | 3300025923 | Bacteria | 3919 |
| 129 | Ga0207681_10301653 | 3300025923 | Bacteria | 1268 |
| 130 | Ga0207681_10664361 | 3300025923 | Bacteria | 865 |
| 131 | Ga0207650_10000667 | 3300025925 | Bacteria | 26981 |
| 132 | Ga0207650_10047683 | 3300025925 | Bacteria | 3157 |
| 133 | Ga0207650_10120337 | 3300025925 | Bacteria | 2043 |
| 134 | Ga0207659_10002105 | 3300025926 | Bacteria | 11788 |
| 135 | Ga0207659_10020753 | 3300025926 | Bacteria | 4349 |
| 136 | Ga0207687_10350261 | 3300025927 | Bacteria | 1203 |
| 137 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 138 | Ga0207644_10074886 | 3300025931 | Bacteria | 2486 |
| 139 | Ga0207690_11354449 | 3300025932 | Bacteria | 595 |
| 140 | Ga0207706_10043768 | 3300025933 | Bacteria | 3967 |
| 141 | Ga0207706_11467888 | 3300025933 | Bacteria | 557 |
| 142 | Ga0207686_10002339 | 3300025934 | Bacteria | 10354 |
| 143 | Ga0207686_10333671 | 3300025934 | Bacteria | 1137 |
| 144 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 145 | Ga0207709_10378087 | 3300025935 | Bacteria | 1077 |
| 146 | Ga0207669_10001145 | 3300025937 | Bacteria | 11318 |
| 147 | Ga0207669_10137467 | 3300025937 | Bacteria | 1690 |
| 148 | Ga0207669_10439156 | 3300025937 | Bacteria | 1031 |
| 149 | Ga0207669_10708399 | 3300025937 | Bacteria | 828 |
| 150 | Ga0207704_10305653 | 3300025938 | Bacteria | 1220 |
| 151 | Ga0207691_10007338 | 3300025940 | Bacteria | 10633 |
| 152 | Ga0207691_10020956 | 3300025940 | Bacteria | 6178 |
| 153 | Ga0207691_10083474 | 3300025940 | Bacteria | 2868 |
| 154 | Ga0207691_10438038 | 3300025940 | Bacteria | 1113 |
| 155 | Ga0207691_10440771 | 3300025940 | Bacteria | 1109 |
| 156 | Ga0207711_10338587 | 3300025941 | Bacteria | 1392 |
| 157 | Ga0207679_10009792 | 3300025945 | Bacteria | 6149 |
| 158 | Ga0207667_10056954 | 3300025949 | Bacteria | 4104 |
| 159 | Ga0207667_11433028 | 3300025949 | Bacteria | 663 |
| 160 | Ga0207651_10015951 | 3300025960 | Bacteria | 4384 |
| 161 | Ga0207651_10038381 | 3300025960 | Bacteria | 3148 |
| 162 | Ga0207651_10260674 | 3300025960 | Bacteria | 1423 |
| 163 | Ga0207651_11338386 | 3300025960 | Bacteria | 644 |
| 164 | Ga0207668_10047610 | 3300025972 | Bacteria | 2937 |
| 165 | Ga0207668_11646892 | 3300025972 | Bacteria | 579 |
| 166 | Ga0207640_11281399 | 3300025981 | Bacteria | 654 |
| 167 | Ga0207658_10116867 | 3300025986 | Bacteria | 2119 |
| 168 | Ga0207658_10138061 | 3300025986 | Bacteria | 1969 |
| 169 | Ga0207658_10771285 | 3300025986 | Bacteria | 872 |
| 170 | Ga0207678_10056178 | 3300026067 | Bacteria | 3389 |
| 171 | Ga0207678_10084616 | 3300026067 | Bacteria | 2712 |
| 172 | Ga0207708_10000146 | 3300026075 | Bacteria | 56397 |
| 173 | Ga0207641_10202290 | 3300026088 | Bacteria | 1832 |
| 174 | Ga0207648_10008667 | 3300026089 | Bacteria | 9815 |
| 175 | Ga0207648_10212113 | 3300026089 | Bacteria | 1719 |
| 176 | Ga0207648_11078626 | 3300026089 | Bacteria | 753 |
| 177 | Ga0207676_10193504 | 3300026095 | Bacteria | 1791 |
| 178 | Ga0207675_101413590 | 3300026118 | Bacteria | 716 |
| 179 | Ga0207683_10002948 | 3300026121 | Bacteria | 14846 |
| 180 | Ga0207683_10010175 | 3300026121 | Bacteria | 8021 |
| 181 | Ga0207683_10140301 | 3300026121 | Bacteria | 2177 |
| 182 | Ga0207683_10649439 | 3300026121 | Bacteria | 977 |
| 183 | Ga0207683_10656506 | 3300026121 | Bacteria | 972 |
| 184 | Ga0207698_10266860 | 3300026142 | Bacteria | 1575 |
| 185 | Ga0207698_10269460 | 3300026142 | Bacteria | 1569 |
| 186 | Ga0207698_10297086 | 3300026142 | Bacteria | 1502 |
| 187 | Ga0207698_10619755 | 3300026142 | Bacteria | 1069 |
| 188 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 189 | Ga0209974_10077722 | 3300027876 | Bacteria | 1138 |
| 190 | Ga0268266_10267059 | 3300028379 | Bacteria | 1587 |
| 191 | Ga0268266_10643611 | 3300028379 | Bacteria | 1020 |
| 192 | Ga0307517_10205548 | 3300028786 | Bacteria | 1223 |
| 193 | Ga0265327_10000487 | 3300031251 | Bacteria | 69944 |
| 194 | Ga0265327_10320671 | 3300031251 | Bacteria | 680 |
| 195 | Ga0307408_100058064 | 3300031548 | Bacteria | 2812 |
| 196 | Ga0307408_100172953 | 3300031548 | Bacteria | 1726 |
| 197 | Ga0265342_10088774 | 3300031712 | Bacteria | 1775 |
| 198 | Ga0307405_10001995 | 3300031731 | Bacteria | 8832 |
| 199 | Ga0307405_10400774 | 3300031731 | Bacteria | 1074 |
| 200 | Ga0307405_10808661 | 3300031731 | Bacteria | 786 |
| 201 | Ga0307413_10201227 | 3300031824 | Bacteria | 1438 |
| 202 | Ga0307413_10339483 | 3300031824 | Bacteria | 1155 |
| 203 | Ga0307410_10001182 | 3300031852 | Bacteria | 11532 |
| 204 | Ga0307406_10031956 | 3300031901 | Bacteria | 3209 |
| 205 | Ga0307407_10072632 | 3300031903 | Bacteria | 2053 |
| 206 | Ga0307412_10001505 | 3300031911 | Bacteria | 12936 |
| 207 | Ga0307412_11120565 | 3300031911 | Bacteria | 701 |
| 208 | Ga0307409_102404538 | 3300031995 | Bacteria | 556 |
| 209 | Ga0307416_100172782 | 3300032002 | Bacteria | 2014 |
| 210 | Ga0307416_101466844 | 3300032002 | Bacteria | 788 |
| 211 | Ga0307416_102483581 | 3300032002 | Bacteria | 617 |
| 212 | Ga0307414_10043527 | 3300032004 | Bacteria | 3059 |
| 213 | Ga0307411_10000810 | 3300032005 | Bacteria | 11680 |
| 214 | Ga0307415_101686203 | 3300032126 | Bacteria | 611 |
| 215 | Ga0307415_102119064 | 3300032126 | Bacteria | 549 |
| 216 | Ga0451791_0690731 | 3300041451 | Bacteria | 802 |
| 217 | Ga0451791_0823663 | 3300041451 | Bacteria | 709 |
| 218 | Ga0451804_0090081 | 3300041463 | Bacteria | 776 |
| 219 | Ga0451845_0318712 | 3300041501 | Bacteria | 654 |
| 220 | Ga0466963_0024994 | 3300044694 | Bacteria | 3805 |
| 221 | Ga0466958_0428491 | 3300045836 | Bacteria | 855 |
| 222 | Ga0466967_0058564 | 3300045976 | Bacteria | 3405 |
| 223 | Ga0495606_0411401 | 3300046507 | Bacteria | 702 |
| 224 | Ga0495621_0000445 | 3300046539 | Bacteria | 10179 |
| 225 | Ga0495621_0359206 | 3300046539 | Bacteria | 612 |
| 226 | Ga0495597_0000204 | 3300046542 | Bacteria | 54418 |
| 227 | Ga0495656_0000228 | 3300046615 | Bacteria | 19893 |
| 228 | Ga0495676_0641080 | 3300047321 | Bacteria | 690 |
| 229 | Ga0495615_0008143 | 3300048090 | Bacteria | 2015 |
| 230 | Ga0495615_0009151 | 3300048090 | Bacteria | 1939 |
| 231 | Ga0496100_1168148 | 3300048903 | Bacteria | 607 |
| 232 | Ga0496108_0500785 | 3300048911 | Bacteria | 1061 |
| 233 | Ga0496115_0358605 | 3300048918 | Bacteria | 1188 |
| 234 | Ga0496117_0208726 | 3300048920 | Bacteria | 1097 |
| 235 | Ga0496124_0107969 | 3300048927 | Bacteria | 2245 |
| 236 | Ga0501252_006173 | 3300049682 | Bacteria | 1325 |
| 237 | nmdc:mga00v17_997685_c1 | 3300050491 | Bacteria | 527 |
| 238 | nmdc:mga07m45_1243_c1 | 3300050496 | Bacteria | 11563 |
| 239 | nmdc:mga07m45_668878_c1 | 3300050496 | Bacteria | 598 |
| 240 | Ga0500578_0000007 | 3300053086 | Bacteria | 229642 |
| 241 | Ga0500646_0215729 | 3300053090 | Bacteria | 664 |
| 242 | Ga0500593_000125 | 3300053117 | Bacteria | 30272 |
| 243 | Ga0500573_0461327 | 3300053140 | Bacteria | 584 |
| 244 | Ga0500604_0073907 | 3300053151 | Bacteria | 1091 |
| 245 | Ga0500584_096535 | 3300053726 | Bacteria | 1228 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300015262 | Ga0182007_10070021 | Ga0182007_100700212 | 116 |
| 2 | 3300017792 | Ga0163161_10145846 | Ga0163161_101458462 | 117 |
| 3 | 3300009098 | Ga0105245_10584753 | Ga0105245_105847533 | 118 |
| 4 | 3300049682 | Ga0501252_006173 | Ga0501252_006173_909_1271 | 118 |
| 5 | 3300003752 | Ga0055539_1000524 | Ga0055539_100052410 | 119 |
| 6 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033136 | 119 |
| 7 | 3300003759 | Ga0055525_1001150 | Ga0055525_10011507 | 119 |
| 8 | 3300005327 | Ga0070658_11615345 | Ga0070658_116153452 | 119 |
| 9 | 3300006881 | Ga0068865_101798062 | Ga0068865_1017980622 | 119 |
| 10 | 3300009093 | Ga0105240_12325114 | Ga0105240_123251141 | 119 |
| 11 | 3300010375 | Ga0105239_11093337 | Ga0105239_110933372 | 119 |
| 12 | 3300025226 | Ga0209674_100064 | Ga0209674_100064113 | 119 |
| 13 | 3300025230 | Ga0209563_100099 | Ga0209563_100099113 | 119 |
| 14 | 3300025253 | Ga0209677_100175 | Ga0209677_10017524 | 119 |
| 15 | 3300025909 | Ga0207705_10635369 | Ga0207705_106353692 | 119 |
| 16 | 3300025919 | Ga0207657_10730168 | Ga0207657_107301681 | 119 |
| 17 | 3300025949 | Ga0207667_11433028 | Ga0207667_114330282 | 119 |
| 18 | 3300026089 | Ga0207648_11078626 | Ga0207648_110786262 | 119 |
| 19 | 3300046507 | Ga0495606_0411401 | Ga0495606_0411401_314_682 | 119 |
| 20 | 3300048918 | Ga0496115_0358605 | Ga0496115_0358605_620_988 | 119 |
| 21 | 3300005435 | Ga0070714_100000013 | Ga0070714_100000013127 | 120 |
| 22 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001634 | 120 |
| 23 | 3300031995 | Ga0307409_102404538 | Ga0307409_1024045381 | 120 |
| 24 | iso_pu_bacteria | 2643221609 | 2644060359 | 120 |
| 25 | iso_pu_bacteria | 2721755523 | 2722883123 | 120 |
| 26 | iso_pu_bacteria | 2738543012 | 2739242835 | 120 |
| 27 | iso_pu_bacteria | 2816332133 | 2816475805 | 120 |
| 28 | iso_pu_bacteria | 2839138175 | 2839143694 | 120 |
| 29 | iso_pu_bacteria | 2842733646 | 2842738906 | 120 |
| 30 | iso_pu_bacteria | 2842733646 | 2842739157 | 120 |
| 31 | iso_pu_bacteria | 2842747753 | 2842748999 | 120 |
| 32 | iso_pu_bacteria | 2857542790 | 2857547137 | 120 |
| 33 | iso_pu_bacteria | 2881101125 | 2881102297 | 120 |
| 34 | iso_pu_bacteria | 2928115317 | 2928117092 | 120 |
| 35 | iso_pu_bacteria | 2939631187 | 2939635178 | 120 |
| 36 | iso_pu_bacteria | 2738543013 | 2739247797 | 121 |
| 37 | iso_pu_bacteria | 2772190715 | 2772641271 | 121 |
| 38 | 3300044694 | Ga0466963_0024994 | Ga0466963_0024994_1718_2119 | 122 |
| 39 | 3300045836 | Ga0466958_0428491 | Ga0466958_0428491_63_464 | 122 |
| 40 | 3300045976 | Ga0466967_0058564 | Ga0466967_0058564_1387_1788 | 122 |
| 41 | iso_pu_bacteria | 2501939600 | 2501942443 | 122 |
| 42 | iso_pu_bacteria | 2622736626 | 2623586078 | 122 |
| 43 | iso_pu_bacteria | 2643221585 | 2643933521 | 122 |
| 44 | iso_pu_bacteria | 2643221592 | 2643972066 | 122 |
| 45 | iso_pu_bacteria | 2643221625 | 2644142265 | 122 |
| 46 | iso_pu_bacteria | 2643221648 | 2644275959 | 122 |
| 47 | iso_pu_bacteria | 2643221656 | 2644314770 | 122 |
| 48 | iso_pu_bacteria | 2675903059 | 2676480538 | 122 |
| 49 | iso_pu_bacteria | 2831935698 | 2831940757 | 122 |
| 50 | iso_pu_bacteria | 2832004796 | 2832009618 | 122 |
| 51 | iso_pu_bacteria | 2855670206 | 2855671714 | 122 |
| 52 | iso_pu_bacteria | 2855676851 | 2855683187 | 122 |
| 53 | iso_pu_bacteria | 2855683550 | 2855684934 | 122 |
| 54 | iso_pu_bacteria | 2856858025 | 2856859975 | 122 |
| 55 | iso_pu_bacteria | 2857288857 | 2857294288 | 122 |
| 56 | iso_pu_bacteria | 2858848962 | 2858852360 | 122 |
| 57 | iso_pu_bacteria | 2858882152 | 2858887891 | 122 |
| 58 | iso_pu_bacteria | 2858888857 | 2858895136 | 122 |
| 59 | iso_pu_bacteria | 2858895516 | 2858898875 | 122 |
| 60 | iso_pu_bacteria | 2858902515 | 2858904640 | 122 |
| 61 | iso_pu_bacteria | 2866065130 | 2866065520 | 122 |
| 62 | iso_pu_bacteria | 2867312974 | 2867313715 | 122 |
| 63 | iso_pu_bacteria | 2867319477 | 2867322461 | 122 |
| 64 | iso_pu_bacteria | 2869048445 | 2869054477 | 122 |
| 65 | iso_pu_bacteria | 2869061728 | 2869068020 | 122 |
| 66 | iso_pu_bacteria | 2869068681 | 2869071092 | 122 |
| 67 | iso_pu_bacteria | 2880489317 | 2880494180 | 122 |
| 68 | iso_pu_bacteria | 2880495981 | 2880498146 | 122 |
| 69 | iso_pu_bacteria | 2884994152 | 2884995866 | 122 |
| 70 | iso_pu_bacteria | 2929219909 | 2929220189 | 122 |
| 71 | iso_pu_bacteria | 2929226422 | 2929226723 | 122 |
| 72 | iso_pu_bacteria | 2996221748 | 2996226159 | 122 |
| 73 | iso_pu_bacteria | 649633069 | 649810458 | 122 |
| 74 | iso_pu_bacteria | 8003830390 | 8003832561 | 122 |
| 75 | iso_pu_bacteria | 8003856774 | 8003858142 | 122 |
| 76 | iso_pu_bacteria | 8003870546 | 8003875398 | 122 |
| 77 | iso_pu_bacteria | 8054472261 | 8054476499 | 122 |
| 78 | iso_pu_bacteria | 8054727385 | 8054728076 | 122 |
| 79 | iso_pu_bacteria | 8054734606 | 8054740828 | 122 |
| 80 | iso_pu_bacteria | 8055412473 | 8055413288 | 122 |
| 81 | 3300005293 | Ga0065715_10146737 | Ga0065715_101467372 | 123 |
| 82 | 3300005355 | Ga0070671_100158279 | Ga0070671_1001582791 | 123 |
| 83 | 3300005364 | Ga0070673_100239877 | Ga0070673_1002398773 | 123 |
| 84 | 3300005366 | Ga0070659_101478261 | Ga0070659_1014782612 | 123 |
| 85 | 3300005367 | Ga0070667_100084105 | Ga0070667_1000841051 | 123 |
| 86 | 3300005455 | Ga0070663_100164371 | Ga0070663_1001643712 | 123 |
| 87 | 3300005456 | Ga0070678_100008183 | Ga0070678_1000081837 | 123 |
| 88 | 3300005548 | Ga0070665_100222965 | Ga0070665_1002229652 | 123 |
| 89 | 3300005615 | Ga0070702_101260809 | Ga0070702_1012608091 | 123 |
| 90 | 3300005719 | Ga0068861_100770564 | Ga0068861_1007705642 | 123 |
| 91 | 3300006237 | Ga0097621_100304675 | Ga0097621_1003046753 | 123 |
| 92 | 3300006358 | Ga0068871_100161972 | Ga0068871_1001619723 | 123 |
| 93 | 3300017792 | Ga0163161_10013856 | Ga0163161_100138563 | 123 |
| 94 | 3300025315 | Ga0207697_10170652 | Ga0207697_101706522 | 123 |
| 95 | 3300025893 | Ga0207682_10000804 | Ga0207682_100008042 | 123 |
| 96 | 3300025907 | Ga0207645_10050584 | Ga0207645_100505842 | 123 |
| 97 | 3300025923 | Ga0207681_10301653 | Ga0207681_103016532 | 123 |
| 98 | 3300025925 | Ga0207650_10120337 | Ga0207650_101203373 | 123 |
| 99 | 3300025926 | Ga0207659_10020753 | Ga0207659_100207533 | 123 |
| 100 | 3300025927 | Ga0207687_10350261 | Ga0207687_103502612 | 123 |
| 101 | 3300025932 | Ga0207690_11354449 | Ga0207690_113544492 | 123 |
| 102 | 3300025934 | Ga0207686_10333671 | Ga0207686_103336712 | 123 |
| 103 | 3300025935 | Ga0207709_10378087 | Ga0207709_103780872 | 123 |
| 104 | 3300025937 | Ga0207669_10137467 | Ga0207669_101374672 | 123 |
| 105 | 3300025940 | Ga0207691_10083474 | Ga0207691_100834743 | 123 |
| 106 | 3300025960 | Ga0207651_10260674 | Ga0207651_102606743 | 123 |
| 107 | 3300025986 | Ga0207658_10138061 | Ga0207658_101380613 | 123 |
| 108 | 3300026067 | Ga0207678_10084616 | Ga0207678_100846164 | 123 |
| 109 | 3300026118 | Ga0207675_101413590 | Ga0207675_1014135902 | 123 |
| 110 | 3300026121 | Ga0207683_10010175 | Ga0207683_100101757 | 123 |
| 111 | 3300053117 | Ga0500593_000125 | Ga0500593_000125_8472_8843 | 123 |
| 112 | 3300005327 | Ga0070658_11189851 | Ga0070658_111898512 | 124 |
| 113 | 3300005331 | Ga0070670_100059092 | Ga0070670_1000590922 | 124 |
| 114 | 3300005335 | Ga0070666_11356661 | Ga0070666_113566611 | 124 |
| 115 | 3300005344 | Ga0070661_100663893 | Ga0070661_1006638932 | 124 |
| 116 | 3300005347 | Ga0070668_100881624 | Ga0070668_1008816242 | 124 |
| 117 | 3300005353 | Ga0070669_100018762 | Ga0070669_1000187624 | 124 |
| 118 | 3300005364 | Ga0070673_100192423 | Ga0070673_1001924233 | 124 |
| 119 | 3300005366 | Ga0070659_101206636 | Ga0070659_1012066362 | 124 |
| 120 | 3300005367 | Ga0070667_100737079 | Ga0070667_1007370791 | 124 |
| 121 | 3300005367 | Ga0070667_101376785 | Ga0070667_1013767852 | 124 |
| 122 | 3300005456 | Ga0070678_100651313 | Ga0070678_1006513131 | 124 |
| 123 | 3300005457 | Ga0070662_100036980 | Ga0070662_1000369803 | 124 |
| 124 | 3300005543 | Ga0070672_100024565 | Ga0070672_1000245652 | 124 |
| 125 | 3300005543 | Ga0070672_100091692 | Ga0070672_1000916924 | 124 |
| 126 | 3300005543 | Ga0070672_100450014 | Ga0070672_1004500142 | 124 |
| 127 | 3300005548 | Ga0070665_100079616 | Ga0070665_1000796163 | 124 |
| 128 | 3300005844 | Ga0068862_101701790 | Ga0068862_1017017902 | 124 |
| 129 | 3300006946 | Ga0079104_1000007 | Ga0079104_100000739 | 124 |
| 130 | 3300009092 | Ga0105250_10009581 | Ga0105250_100095812 | 124 |
| 131 | 3300009148 | Ga0105243_10002781 | Ga0105243_1000278110 | 124 |
| 132 | 3300009177 | Ga0105248_10813518 | Ga0105248_108135181 | 124 |
| 133 | 3300013297 | Ga0157378_10515446 | Ga0157378_105154462 | 124 |
| 134 | 3300013308 | Ga0157375_10069542 | Ga0157375_100695424 | 124 |
| 135 | 3300014326 | Ga0157380_10420058 | Ga0157380_104200582 | 124 |
| 136 | 3300014968 | Ga0157379_11052760 | Ga0157379_110527602 | 124 |
| 137 | 3300017792 | Ga0163161_10013057 | Ga0163161_100130572 | 124 |
| 138 | 3300017792 | Ga0163161_10026904 | Ga0163161_100269042 | 124 |
| 139 | 3300017792 | Ga0163161_10504811 | Ga0163161_105048112 | 124 |
| 140 | 3300017792 | Ga0163161_10562946 | Ga0163161_105629462 | 124 |
| 141 | 3300025711 | Ga0207696_1030315 | Ga0207696_10303153 | 124 |
| 142 | 3300025893 | Ga0207682_10019204 | Ga0207682_100192041 | 124 |
| 143 | 3300025893 | Ga0207682_10132695 | Ga0207682_101326952 | 124 |
| 144 | 3300025901 | Ga0207688_10459761 | Ga0207688_104597612 | 124 |
| 145 | 3300025903 | Ga0207680_10622363 | Ga0207680_106223632 | 124 |
| 146 | 3300025904 | Ga0207647_10321522 | Ga0207647_103215222 | 124 |
| 147 | 3300025909 | Ga0207705_10869804 | Ga0207705_108698042 | 124 |
| 148 | 3300025923 | Ga0207681_10002687 | Ga0207681_1000268713 | 124 |
| 149 | 3300025923 | Ga0207681_10664361 | Ga0207681_106643611 | 124 |
| 150 | 3300025925 | Ga0207650_10047683 | Ga0207650_100476835 | 124 |
| 151 | 3300025931 | Ga0207644_10074886 | Ga0207644_100748864 | 124 |
| 152 | 3300025933 | Ga0207706_10043768 | Ga0207706_100437683 | 124 |
| 153 | 3300025933 | Ga0207706_11467888 | Ga0207706_114678882 | 124 |
| 154 | 3300025934 | Ga0207686_10002339 | Ga0207686_100023392 | 124 |
| 155 | 3300025935 | Ga0207709_10000172 | Ga0207709_1000017250 | 124 |
| 156 | 3300025937 | Ga0207669_10708399 | Ga0207669_107083992 | 124 |
| 157 | 3300025940 | Ga0207691_10020956 | Ga0207691_100209566 | 124 |
| 158 | 3300025940 | Ga0207691_10438038 | Ga0207691_104380382 | 124 |
| 159 | 3300025940 | Ga0207691_10440771 | Ga0207691_104407712 | 124 |
| 160 | 3300025941 | Ga0207711_10338587 | Ga0207711_103385872 | 124 |
| 161 | 3300025960 | Ga0207651_10038381 | Ga0207651_100383814 | 124 |
| 162 | 3300025960 | Ga0207651_11338386 | Ga0207651_113383862 | 124 |
| 163 | 3300025972 | Ga0207668_11646892 | Ga0207668_116468922 | 124 |
| 164 | 3300025986 | Ga0207658_10771285 | Ga0207658_107712852 | 124 |
| 165 | 3300026067 | Ga0207678_10056178 | Ga0207678_100561782 | 124 |
| 166 | 3300026089 | Ga0207648_10212113 | Ga0207648_102121133 | 124 |
| 167 | 3300026121 | Ga0207683_10140301 | Ga0207683_101403013 | 124 |
| 168 | 3300026121 | Ga0207683_10656506 | Ga0207683_106565063 | 124 |
| 169 | 3300026142 | Ga0207698_10266860 | Ga0207698_102668602 | 124 |
| 170 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020458 | 124 |
| 171 | 3300028379 | Ga0268266_10267059 | Ga0268266_102670592 | 124 |
| 172 | 3300028379 | Ga0268266_10643611 | Ga0268266_106436112 | 124 |
| 173 | 3300031251 | Ga0265327_10000487 | Ga0265327_1000048718 | 124 |
| 174 | 3300031731 | Ga0307405_10400774 | Ga0307405_104007742 | 124 |
| 175 | 3300031731 | Ga0307405_10808661 | Ga0307405_108086612 | 124 |
| 176 | 3300032002 | Ga0307416_102483581 | Ga0307416_1024835812 | 124 |
| 177 | 3300041451 | Ga0451791_0823663 | Ga0451791_0823663_100_474 | 124 |
| 178 | 3300046539 | Ga0495621_0000445 | Ga0495621_0000445_1696_2070 | 124 |
| 179 | 3300046539 | Ga0495621_0359206 | Ga0495621_0359206_96_470 | 124 |
| 180 | 3300046542 | Ga0495597_0000204 | Ga0495597_0000204_19966_20340 | 124 |
| 181 | 3300046615 | Ga0495656_0000228 | Ga0495656_0000228_8642_9016 | 124 |
| 182 | 3300048090 | Ga0495615_0008143 | Ga0495615_0008143_1140_1514 | 124 |
| 183 | 3300048090 | Ga0495615_0009151 | Ga0495615_0009151_108_482 | 124 |
| 184 | 3300048903 | Ga0496100_1168148 | Ga0496100_1168148_118_492 | 124 |
| 185 | 3300048911 | Ga0496108_0500785 | Ga0496108_0500785_23_397 | 124 |
| 186 | 3300048920 | Ga0496117_0208726 | Ga0496117_0208726_280_654 | 124 |
| 187 | 3300048927 | Ga0496124_0107969 | Ga0496124_0107969_328_702 | 124 |
| 188 | 3300050491 | nmdc:mga00v17_997685_c1 | nmdc:mga00v17_997685_c1_83_457 | 124 |
| 189 | 3300002126 | JGI24035J26624_1013463 | JGI24035J26624_10134632 | 126 |
| 190 | 3300003791 | Ga0055530_10001833 | Ga0055530_100018339 | 126 |
| 191 | 3300003792 | Ga0055540_1000001 | Ga0055540_1000001158 | 126 |
| 192 | 3300003794 | Ga0055531_10008855 | Ga0055531_100088555 | 126 |
| 193 | 3300005293 | Ga0065715_10143022 | Ga0065715_101430223 | 126 |
| 194 | 3300005328 | Ga0070676_10010887 | Ga0070676_100108875 | 126 |
| 195 | 3300005331 | Ga0070670_100008583 | Ga0070670_1000085838 | 126 |
| 196 | 3300005333 | Ga0070677_10000532 | Ga0070677_100005329 | 126 |
| 197 | 3300005335 | Ga0070666_10128077 | Ga0070666_101280772 | 126 |
| 198 | 3300005338 | Ga0068868_100201879 | Ga0068868_1002018793 | 126 |
| 199 | 3300005345 | Ga0070692_10607081 | Ga0070692_106070811 | 126 |
| 200 | 3300005347 | Ga0070668_100369865 | Ga0070668_1003698651 | 126 |
| 201 | 3300005353 | Ga0070669_100640354 | Ga0070669_1006403542 | 126 |
| 202 | 3300005354 | Ga0070675_100001226 | Ga0070675_10000122614 | 126 |
| 203 | 3300005355 | Ga0070671_100002269 | Ga0070671_10000226914 | 126 |
| 204 | 3300005356 | Ga0070674_100055253 | Ga0070674_1000552534 | 126 |
| 205 | 3300005356 | Ga0070674_101104134 | Ga0070674_1011041342 | 126 |
| 206 | 3300005364 | Ga0070673_100162273 | Ga0070673_1001622733 | 126 |
| 207 | 3300005367 | Ga0070667_100372616 | Ga0070667_1003726163 | 126 |
| 208 | 3300005441 | Ga0070700_100000013 | Ga0070700_100000013145 | 126 |
| 209 | 3300005445 | Ga0070708_101023770 | Ga0070708_1010237702 | 126 |
| 210 | 3300005456 | Ga0070678_100043701 | Ga0070678_1000437014 | 126 |
| 211 | 3300005459 | Ga0068867_100003616 | Ga0068867_1000036165 | 126 |
| 212 | 3300005466 | Ga0070685_10398228 | Ga0070685_103982282 | 126 |
| 213 | 3300005543 | Ga0070672_100011710 | Ga0070672_1000117103 | 126 |
| 214 | 3300005548 | Ga0070665_100207935 | Ga0070665_1002079351 | 126 |
| 215 | 3300005563 | Ga0068855_100028305 | Ga0068855_1000283053 | 126 |
| 216 | 3300005564 | Ga0070664_100060524 | Ga0070664_1000605242 | 126 |
| 217 | 3300005578 | Ga0068854_100822906 | Ga0068854_1008229062 | 126 |
| 218 | 3300005616 | Ga0068852_100318908 | Ga0068852_1003189083 | 126 |
| 219 | 3300005616 | Ga0068852_100850581 | Ga0068852_1008505812 | 126 |
| 220 | 3300005618 | Ga0068864_100008984 | Ga0068864_1000089846 | 126 |
| 221 | 3300005718 | Ga0068866_10193245 | Ga0068866_101932452 | 126 |
| 222 | 3300005719 | Ga0068861_100679005 | Ga0068861_1006790052 | 126 |
| 223 | 3300005834 | Ga0068851_10021181 | Ga0068851_100211814 | 126 |
| 224 | 3300005840 | Ga0068870_10170319 | Ga0068870_101703192 | 126 |
| 225 | 3300006237 | Ga0097621_100009546 | Ga0097621_1000095462 | 126 |
| 226 | 3300006358 | Ga0068871_100013746 | Ga0068871_1000137464 | 126 |
| 227 | 3300006881 | Ga0068865_100370346 | Ga0068865_1003703463 | 126 |
| 228 | 3300009176 | Ga0105242_12790257 | Ga0105242_127902572 | 126 |
| 229 | 3300013308 | Ga0157375_10018984 | Ga0157375_100189842 | 126 |
| 230 | 3300014325 | Ga0163163_11845631 | Ga0163163_118456312 | 126 |
| 231 | 3300014326 | Ga0157380_10142640 | Ga0157380_101426403 | 126 |
| 232 | 3300014745 | Ga0157377_10767234 | Ga0157377_107672342 | 126 |
| 233 | 3300014969 | Ga0157376_10035903 | Ga0157376_100359032 | 126 |
| 234 | 3300025230 | Ga0209563_100025 | Ga0209563_100025105 | 126 |
| 235 | 3300025298 | Ga0209050_1000145 | Ga0209050_1000145109 | 126 |
| 236 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018294 | 126 |
| 237 | 3300025304 | Ga0209257_1000084 | Ga0209257_100008478 | 126 |
| 238 | 3300025315 | Ga0207697_10022825 | Ga0207697_100228254 | 126 |
| 239 | 3300025893 | Ga0207682_10003073 | Ga0207682_100030737 | 126 |
| 240 | 3300025899 | Ga0207642_10167184 | Ga0207642_101671843 | 126 |
| 241 | 3300025901 | Ga0207688_10034171 | Ga0207688_100341711 | 126 |
| 242 | 3300025903 | Ga0207680_10046055 | Ga0207680_100460553 | 126 |
| 243 | 3300025907 | Ga0207645_10087025 | Ga0207645_100870253 | 126 |
| 244 | 3300025908 | Ga0207643_10166455 | Ga0207643_101664553 | 126 |
| 245 | 3300025909 | Ga0207705_10076200 | Ga0207705_100762004 | 126 |
| 246 | 3300025920 | Ga0207649_10056951 | Ga0207649_100569514 | 126 |
| 247 | 3300025923 | Ga0207681_10023843 | Ga0207681_100238434 | 126 |
| 248 | 3300025925 | Ga0207650_10000667 | Ga0207650_1000066724 | 126 |
| 249 | 3300025926 | Ga0207659_10002105 | Ga0207659_100021055 | 126 |
| 250 | 3300025937 | Ga0207669_10001145 | Ga0207669_100011456 | 126 |
| 251 | 3300025937 | Ga0207669_10439156 | Ga0207669_104391562 | 126 |
| 252 | 3300025938 | Ga0207704_10305653 | Ga0207704_103056533 | 126 |
| 253 | 3300025940 | Ga0207691_10007338 | Ga0207691_100073385 | 126 |
| 254 | 3300025945 | Ga0207679_10009792 | Ga0207679_100097925 | 126 |
| 255 | 3300025949 | Ga0207667_10056954 | Ga0207667_100569543 | 126 |
| 256 | 3300025960 | Ga0207651_10015951 | Ga0207651_100159513 | 126 |
| 257 | 3300025972 | Ga0207668_10047610 | Ga0207668_100476103 | 126 |
| 258 | 3300025981 | Ga0207640_11281399 | Ga0207640_112813992 | 126 |
| 259 | 3300025986 | Ga0207658_10116867 | Ga0207658_101168673 | 126 |
| 260 | 3300026075 | Ga0207708_10000146 | Ga0207708_100001463 | 126 |
| 261 | 3300026088 | Ga0207641_10202290 | Ga0207641_102022902 | 126 |
| 262 | 3300026089 | Ga0207648_10008667 | Ga0207648_100086675 | 126 |
| 263 | 3300026095 | Ga0207676_10193504 | Ga0207676_101935043 | 126 |
| 264 | 3300026121 | Ga0207683_10002948 | Ga0207683_100029486 | 126 |
| 265 | 3300026121 | Ga0207683_10649439 | Ga0207683_106494393 | 126 |
| 266 | 3300026142 | Ga0207698_10269460 | Ga0207698_102694602 | 126 |
| 267 | 3300026142 | Ga0207698_10297086 | Ga0207698_102970861 | 126 |
| 268 | 3300026142 | Ga0207698_10619755 | Ga0207698_106197552 | 126 |
| 269 | 3300027876 | Ga0209974_10077722 | Ga0209974_100777222 | 126 |
| 270 | 3300028786 | Ga0307517_10205548 | Ga0307517_102055482 | 126 |
| 271 | 3300031251 | Ga0265327_10320671 | Ga0265327_103206711 | 126 |
| 272 | 3300031548 | Ga0307408_100058064 | Ga0307408_1000580643 | 126 |
| 273 | 3300031548 | Ga0307408_100172953 | Ga0307408_1001729532 | 126 |
| 274 | 3300031712 | Ga0265342_10088774 | Ga0265342_100887743 | 126 |
| 275 | 3300031731 | Ga0307405_10001995 | Ga0307405_100019959 | 126 |
| 276 | 3300031824 | Ga0307413_10201227 | Ga0307413_102012272 | 126 |
| 277 | 3300031824 | Ga0307413_10339483 | Ga0307413_103394832 | 126 |
| 278 | 3300031852 | Ga0307410_10001182 | Ga0307410_100011824 | 126 |
| 279 | 3300031901 | Ga0307406_10031956 | Ga0307406_100319562 | 126 |
| 280 | 3300031903 | Ga0307407_10072632 | Ga0307407_100726322 | 126 |
| 281 | 3300031911 | Ga0307412_10001505 | Ga0307412_1000150515 | 126 |
| 282 | 3300031911 | Ga0307412_11120565 | Ga0307412_111205652 | 126 |
| 283 | 3300032002 | Ga0307416_100172782 | Ga0307416_1001727822 | 126 |
| 284 | 3300032002 | Ga0307416_101466844 | Ga0307416_1014668442 | 126 |
| 285 | 3300032004 | Ga0307414_10043527 | Ga0307414_100435275 | 126 |
| 286 | 3300032005 | Ga0307411_10000810 | Ga0307411_1000081012 | 126 |
| 287 | 3300032126 | Ga0307415_101686203 | Ga0307415_1016862032 | 126 |
| 288 | 3300032126 | Ga0307415_102119064 | Ga0307415_1021190642 | 126 |
| 289 | 3300041451 | Ga0451791_0690731 | Ga0451791_0690731_406_786 | 126 |
| 290 | 3300041463 | Ga0451804_0090081 | Ga0451804_0090081_282_662 | 126 |
| 291 | 3300041501 | Ga0451845_0318712 | Ga0451845_0318712_150_530 | 126 |
| 292 | 3300047321 | Ga0495676_0641080 | Ga0495676_0641080_131_541 | 126 |
| 293 | 3300050496 | nmdc:mga07m45_1243_c1 | nmdc:mga07m45_1243_c1_10815_11204 | 126 |
| 294 | 3300050496 | nmdc:mga07m45_668878_c1 | nmdc:mga07m45_668878_c1_34_435 | 126 |
| 295 | 3300053086 | Ga0500578_0000007 | Ga0500578_0000007_8449_8829 | 126 |
| 296 | 3300053090 | Ga0500646_0215729 | Ga0500646_0215729_25_405 | 126 |
| 297 | 3300053140 | Ga0500573_0461327 | Ga0500573_0461327_131_511 | 126 |
| 298 | 3300053151 | Ga0500604_0073907 | Ga0500604_0073907_280_660 | 126 |
| 299 | 3300053726 | Ga0500584_096535 | Ga0500584_096535_481_861 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jhk-assembly1.cif.gz_A | crystal structure of bacillus subtilis rsbs | 0.9425 | 2 | 116 |
| 6jhk-assembly1.cif.gz_A | crystal structure of bacillus subtilis rsbs | 0.9271 | 2 | 116 |
| 6qcm-assembly1.cif.gz_d | cryo em structure of the listeria stressosome | 0.915 | 2 | 115 |
| 3zxn-assembly1.cif.gz_A | moorella thermoacetica rsbs s58e | 0.9107 | 2 | 117 |
| 7b0u-assembly1.cif.gz_F | stressosome complex from listeria innocua | 0.8945 | 2 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vy9B00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.888 | 5 | 117 | 3.30.750.24 |
| 2vy9B00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8736 | 5 | 117 | 3.30.750.24 |
| af_B0V3V8_450_565_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8267 | 3 | 115 | 3.30.750.24 |
| 1tidD00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8198 | 4 | 113 | 3.30.750.24 |
| af_Q9I7H4_525_631_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8164 | 14 | 113 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V1IF52-F1-model_v4 | STAS domain-containing protein | 0.9737 | 2 | 124 |
|
| AF-A0A419F495-F1-model_v4 | STAS domain-containing protein | 0.9671 | 1 | 123 |
|
| AF-A0A1M5GII7-F1-model_v4 | RsbT antagonist protein RsbS | 0.9636 | 1 | 125 |
|
| AF-A0A249SWB1-F1-model_v4 | STAS domain-containing protein | 0.9629 | 3 | 116 |
|
| AF-A0A1G9F696-F1-model_v4 | RsbT antagonist protein RsbS | 0.9629 | 3 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar