F394688
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 196 | 294 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_101456189|Ga0070674_1014561892 |
| Length | 169 |
| Sequence | MLLNLKKNDMEKQKSNTADRELLLTRILDAPIELVWEVWTKPEHIALWWGPDGFTNTIQEMDVQPDGEWSLVMHGPDGTDYRNKSIFKEIIPYKKIVYDHISGPRFLATIEFESRGNQTFISWHMLFESAEQFIQVVKTFKADEGLKQNIEKLNAYLKGVHILSKSERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 4 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 5 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 139 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 149 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 183 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 184 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 185 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 186 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 188 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 189 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 190 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 191 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 192 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 193 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 194 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 195 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 0 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.68 |
| Nodule | 0 |
| Rhizoplane | 2.34 |
| Rhizosphere | 88.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10025489 | 3300001979 | Bacteria | 1992 |
| 2 | JGI24737J22298_10002536 | 3300001990 | Bacteria | 6483 |
| 3 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 4 | rootH1_10016978 | 3300003316 | Bacteria | 25561 |
| 5 | rootH1_10139342 | 3300003316 | Bacteria | 6598 |
| 6 | rootH1_10022278 | 3300003323 | Bacteria | 6215 |
| 7 | rootH1_10063468 | 3300003323 | Bacteria | 2950 |
| 8 | rootH1_10228994 | 3300003323 | Bacteria | 1405 |
| 9 | rootH1_10238662 | 3300003323 | Bacteria | 1254 |
| 10 | Ga0055529_1006788 | 3300003763 | Bacteria | 1580 |
| 11 | Ga0065714_10016816 | 3300005288 | Bacteria | 2054 |
| 12 | Ga0065714_10071629 | 3300005288 | Bacteria | 3531 |
| 13 | Ga0065704_10113901 | 3300005289 | Bacteria | 1903 |
| 14 | Ga0065707_10182253 | 3300005295 | Bacteria | 1411 |
| 15 | Ga0070658_10024945 | 3300005327 | Unclassified | 4794 |
| 16 | Ga0070676_10000193 | 3300005328 | Bacteria | 25377 |
| 17 | Ga0070690_100314397 | 3300005330 | Bacteria | 1127 |
| 18 | Ga0070690_100592500 | 3300005330 | Bacteria | 840 |
| 19 | Ga0070670_100030433 | 3300005331 | Unclassified | 4649 |
| 20 | Ga0070677_10001275 | 3300005333 | Bacteria | 8066 |
| 21 | Ga0068869_100240589 | 3300005334 | Unclassified | 1442 |
| 22 | Ga0070666_10010136 | 3300005335 | Bacteria | 5886 |
| 23 | Ga0070666_10020724 | 3300005335 | Unclassified | 4253 |
| 24 | Ga0070666_10075775 | 3300005335 | Bacteria | 2294 |
| 25 | Ga0070680_100177489 | 3300005336 | Bacteria | 1793 |
| 26 | Ga0068868_100000428 | 3300005338 | Bacteria | 28195 |
| 27 | Ga0068868_100398237 | 3300005338 | Bacteria | 1188 |
| 28 | Ga0070689_100131623 | 3300005340 | Unclassified | 2006 |
| 29 | Ga0070687_100371152 | 3300005343 | Bacteria | 929 |
| 30 | Ga0070668_100009543 | 3300005347 | Bacteria | 7201 |
| 31 | Ga0070668_100472967 | 3300005347 | Unclassified | 1081 |
| 32 | Ga0070669_100344692 | 3300005353 | Bacteria | 1208 |
| 33 | Ga0070675_100008568 | 3300005354 | Bacteria | 7940 |
| 34 | Ga0070675_100100963 | 3300005354 | Bacteria | 2430 |
| 35 | Ga0070675_100242499 | 3300005354 | Bacteria | 1575 |
| 36 | Ga0070674_100176923 | 3300005356 | Unclassified | 1631 |
| 37 | Ga0070674_100189444 | 3300005356 | Unclassified | 1581 |
| 38 | Ga0070674_101456189 | 3300005356 | Bacteria | 614 |
| 39 | Ga0070673_100000498 | 3300005364 | Bacteria | 20956 |
| 40 | Ga0070673_100141058 | 3300005364 | Unclassified | 2033 |
| 41 | Ga0070688_100945222 | 3300005365 | Unclassified | 682 |
| 42 | Ga0070667_100000376 | 3300005367 | Bacteria | 48890 |
| 43 | Ga0070667_100028993 | 3300005367 | Bacteria | 4609 |
| 44 | Ga0070667_100112851 | 3300005367 | Bacteria | 2358 |
| 45 | Ga0070667_101971457 | 3300005367 | Bacteria | 550 |
| 46 | Ga0070708_100268236 | 3300005445 | Bacteria | 1605 |
| 47 | Ga0070662_100007733 | 3300005457 | Bacteria | 6978 |
| 48 | Ga0068867_100018840 | 3300005459 | Unclassified | 4910 |
| 49 | Ga0068867_100054455 | 3300005459 | Bacteria | 2956 |
| 50 | Ga0070679_100161869 | 3300005530 | Bacteria | 2212 |
| 51 | Ga0068853_100787891 | 3300005539 | Bacteria | 910 |
| 52 | Ga0070672_100000053 | 3300005543 | Bacteria | 51215 |
| 53 | Ga0070672_100387325 | 3300005543 | Unclassified | 1196 |
| 54 | Ga0070672_100439175 | 3300005543 | Bacteria | 1123 |
| 55 | Ga0070672_100738395 | 3300005543 | Unclassified | 863 |
| 56 | Ga0070686_100005833 | 3300005544 | Bacteria | 6824 |
| 57 | Ga0070686_100129965 | 3300005544 | Bacteria | 1740 |
| 58 | Ga0070665_100023188 | 3300005548 | Bacteria | 6252 |
| 59 | Ga0068855_100017500 | 3300005563 | Bacteria | 8619 |
| 60 | Ga0068855_100077176 | 3300005563 | Unclassified | 3865 |
| 61 | Ga0068855_100122469 | 3300005563 | Unclassified | 2976 |
| 62 | Ga0070664_100277522 | 3300005564 | Bacteria | 1511 |
| 63 | Ga0068857_100171586 | 3300005577 | Bacteria | 1972 |
| 64 | Ga0068856_100033652 | 3300005614 | Bacteria | 5018 |
| 65 | Ga0070702_100106968 | 3300005615 | Bacteria | 1726 |
| 66 | Ga0068852_100016956 | 3300005616 | Bacteria | 5699 |
| 67 | Ga0068859_100001552 | 3300005617 | Bacteria | 23438 |
| 68 | Ga0068859_100081555 | 3300005617 | Bacteria | 3277 |
| 69 | Ga0068859_100219556 | 3300005617 | Bacteria | 1988 |
| 70 | Ga0068864_100001685 | 3300005618 | Bacteria | 18165 |
| 71 | Ga0068864_100169911 | 3300005618 | Bacteria | 1987 |
| 72 | Ga0068864_101395499 | 3300005618 | Bacteria | 702 |
| 73 | Ga0068866_10127097 | 3300005718 | Bacteria | 1444 |
| 74 | Ga0068866_10807496 | 3300005718 | Bacteria | 653 |
| 75 | Ga0068861_100450067 | 3300005719 | Bacteria | 1154 |
| 76 | Ga0068851_10010820 | 3300005834 | Bacteria | 4263 |
| 77 | Ga0068863_100050996 | 3300005841 | Unclassified | 3922 |
| 78 | Ga0068863_100240476 | 3300005841 | Bacteria | 1747 |
| 79 | Ga0068863_101003403 | 3300005841 | Unclassified | 837 |
| 80 | Ga0068858_100020680 | 3300005842 | Bacteria | 6147 |
| 81 | Ga0068858_100083183 | 3300005842 | Unclassified | 2976 |
| 82 | Ga0068860_100000052 | 3300005843 | Bacteria | 207351 |
| 83 | Ga0068860_100026233 | 3300005843 | Bacteria | 5617 |
| 84 | Ga0068860_100160584 | 3300005843 | Unclassified | 2167 |
| 85 | Ga0068862_100153314 | 3300005844 | Bacteria | 2052 |
| 86 | Ga0068862_100193918 | 3300005844 | Unclassified | 1829 |
| 87 | Ga0075366_10010302 | 3300006195 | Bacteria | 5245 |
| 88 | Ga0097621_100008458 | 3300006237 | Bacteria | 7415 |
| 89 | Ga0097621_100047636 | 3300006237 | Unclassified | 3474 |
| 90 | Ga0097621_100065084 | 3300006237 | Bacteria | 2999 |
| 91 | Ga0068871_100009934 | 3300006358 | Bacteria | 6913 |
| 92 | Ga0068871_100089281 | 3300006358 | Unclassified | 2565 |
| 93 | Ga0068871_100106903 | 3300006358 | Bacteria | 2349 |
| 94 | Ga0075428_100075437 | 3300006844 | Unclassified | 3682 |
| 95 | Ga0075431_101686769 | 3300006847 | Bacteria | 591 |
| 96 | Ga0068865_100007029 | 3300006881 | Bacteria | 6908 |
| 97 | Ga0068865_100017595 | 3300006881 | Bacteria | 4599 |
| 98 | Ga0097620_100001552 | 3300006931 | Bacteria | 23438 |
| 99 | Ga0097620_100081555 | 3300006931 | Bacteria | 3277 |
| 100 | Ga0097620_100219554 | 3300006931 | Bacteria | 1988 |
| 101 | Ga0105250_10357418 | 3300009092 | Unclassified | 641 |
| 102 | Ga0105240_10027258 | 3300009093 | Bacteria | 7482 |
| 103 | Ga0105240_10047666 | 3300009093 | Bacteria | 5421 |
| 104 | Ga0105240_10596115 | 3300009093 | Bacteria | 1217 |
| 105 | Ga0105245_10043754 | 3300009098 | Bacteria | 3994 |
| 106 | Ga0105245_10978608 | 3300009098 | Bacteria | 890 |
| 107 | Ga0105247_10031790 | 3300009101 | Unclassified | 3205 |
| 108 | Ga0105247_10124711 | 3300009101 | Bacteria | 1672 |
| 109 | Ga0114129_11850880 | 3300009147 | Bacteria | 733 |
| 110 | Ga0105241_10043008 | 3300009174 | Unclassified | 3420 |
| 111 | Ga0105242_10013628 | 3300009176 | Bacteria | 6291 |
| 112 | Ga0105242_10723792 | 3300009176 | Bacteria | 976 |
| 113 | Ga0105248_10050833 | 3300009177 | Bacteria | 4650 |
| 114 | Ga0105238_10097463 | 3300009551 | Bacteria | 2926 |
| 115 | Ga0105249_10015028 | 3300009553 | Bacteria | 6849 |
| 116 | Ga0105249_10468184 | 3300009553 | Bacteria | 1301 |
| 117 | Ga0105239_10004970 | 3300010375 | Bacteria | 15702 |
| 118 | Ga0105239_10021564 | 3300010375 | Bacteria | 7103 |
| 119 | Ga0105239_10027099 | 3300010375 | Bacteria | 6308 |
| 120 | Ga0105239_10166309 | 3300010375 | Bacteria | 2466 |
| 121 | Ga0157371_10015276 | 3300013102 | Bacteria | 5765 |
| 122 | Ga0157371_10425948 | 3300013102 | Unclassified | 973 |
| 123 | Ga0157370_10186302 | 3300013104 | Bacteria | 1927 |
| 124 | Ga0157370_10251191 | 3300013104 | Bacteria | 1636 |
| 125 | Ga0157369_10202925 | 3300013105 | Bacteria | 2081 |
| 126 | Ga0157374_10019983 | 3300013296 | Bacteria | 5938 |
| 127 | Ga0157378_10021350 | 3300013297 | Bacteria | 5693 |
| 128 | Ga0157378_10061885 | 3300013297 | Unclassified | 3342 |
| 129 | Ga0157378_10505696 | 3300013297 | Bacteria | 1208 |
| 130 | Ga0157378_11688261 | 3300013297 | Bacteria | 680 |
| 131 | Ga0163162_10000428 | 3300013306 | Bacteria | 38750 |
| 132 | Ga0163162_10021340 | 3300013306 | Bacteria | 6377 |
| 133 | Ga0163162_10087172 | 3300013306 | Bacteria | 3200 |
| 134 | Ga0163162_11496585 | 3300013306 | Unclassified | 769 |
| 135 | Ga0157372_10002755 | 3300013307 | Bacteria | 19002 |
| 136 | Ga0157372_10037755 | 3300013307 | Bacteria | 5328 |
| 137 | Ga0157375_10157829 | 3300013308 | Bacteria | 2408 |
| 138 | Ga0157375_10428783 | 3300013308 | Bacteria | 1488 |
| 139 | Ga0163163_10018483 | 3300014325 | Bacteria | 6527 |
| 140 | Ga0163163_10125336 | 3300014325 | Unclassified | 2606 |
| 141 | Ga0157380_10126999 | 3300014326 | Bacteria | 2169 |
| 142 | Ga0157377_10407024 | 3300014745 | Bacteria | 928 |
| 143 | Ga0157379_10021550 | 3300014968 | Bacteria | 5706 |
| 144 | Ga0157379_10401793 | 3300014968 | Bacteria | 1260 |
| 145 | Ga0157379_11799030 | 3300014968 | Bacteria | 602 |
| 146 | Ga0157376_10076615 | 3300014969 | Bacteria | 2858 |
| 147 | Ga0157376_10129715 | 3300014969 | Bacteria | 2248 |
| 148 | Ga0157376_10751730 | 3300014969 | Bacteria | 984 |
| 149 | Ga0182005_1151527 | 3300015265 | Bacteria | 675 |
| 150 | Ga0163161_10011110 | 3300017792 | Bacteria | 6238 |
| 151 | Ga0163161_10125275 | 3300017792 | Bacteria | 1934 |
| 152 | Ga0163161_10215281 | 3300017792 | Bacteria | 1485 |
| 153 | Ga0209026_1028687 | 3300025250 | Bacteria | 831 |
| 154 | Ga0209026_1030838 | 3300025250 | Bacteria | 795 |
| 155 | Ga0209455_1007318 | 3300025272 | Bacteria | 3134 |
| 156 | Ga0207697_10011890 | 3300025315 | Unclassified | 3668 |
| 157 | Ga0207656_10003871 | 3300025321 | Bacteria | 5189 |
| 158 | Ga0207682_10090490 | 3300025893 | Bacteria | 1326 |
| 159 | Ga0207642_10101223 | 3300025899 | Bacteria | 1447 |
| 160 | Ga0207710_10012068 | 3300025900 | Unclassified | 3631 |
| 161 | Ga0207680_10000593 | 3300025903 | Bacteria | 17084 |
| 162 | Ga0207680_10027560 | 3300025903 | Bacteria | 3165 |
| 163 | Ga0207680_10079837 | 3300025903 | Bacteria | 2053 |
| 164 | Ga0207647_10067610 | 3300025904 | Bacteria | 2165 |
| 165 | Ga0207685_10442939 | 3300025905 | Bacteria | 674 |
| 166 | Ga0207645_10000863 | 3300025907 | Bacteria | 25194 |
| 167 | Ga0207643_10520510 | 3300025908 | Bacteria | 762 |
| 168 | Ga0207705_10022807 | 3300025909 | Unclassified | 4463 |
| 169 | Ga0207695_10641062 | 3300025913 | Bacteria | 943 |
| 170 | Ga0207671_10197974 | 3300025914 | Unclassified | 1568 |
| 171 | Ga0207660_10869188 | 3300025917 | Bacteria | 736 |
| 172 | Ga0207652_10153554 | 3300025921 | Bacteria | 2062 |
| 173 | Ga0207681_10668087 | 3300025923 | Bacteria | 862 |
| 174 | Ga0207650_10372982 | 3300025925 | Bacteria | 1177 |
| 175 | Ga0207659_10048928 | 3300025926 | Bacteria | 2997 |
| 176 | Ga0207659_10160080 | 3300025926 | Bacteria | 1766 |
| 177 | Ga0207659_10457319 | 3300025926 | Bacteria | 1076 |
| 178 | Ga0207644_10083784 | 3300025931 | Unclassified | 2362 |
| 179 | Ga0207706_10001034 | 3300025933 | Bacteria | 28280 |
| 180 | Ga0207686_10387238 | 3300025934 | Bacteria | 1062 |
| 181 | Ga0207686_10561783 | 3300025934 | Bacteria | 893 |
| 182 | Ga0207670_10146851 | 3300025936 | Unclassified | 1745 |
| 183 | Ga0207670_10533987 | 3300025936 | Unclassified | 956 |
| 184 | Ga0207669_10346963 | 3300025937 | Bacteria | 1145 |
| 185 | Ga0207704_10003694 | 3300025938 | Bacteria | 6962 |
| 186 | Ga0207704_10035978 | 3300025938 | Bacteria | 2844 |
| 187 | Ga0207704_10915036 | 3300025938 | Bacteria | 738 |
| 188 | Ga0207691_10000012 | 3300025940 | Bacteria | 147942 |
| 189 | Ga0207691_10001692 | 3300025940 | Bacteria | 21777 |
| 190 | Ga0207691_11419016 | 3300025940 | Bacteria | 570 |
| 191 | Ga0207711_10106350 | 3300025941 | Unclassified | 2490 |
| 192 | Ga0207689_10254676 | 3300025942 | Bacteria | 1452 |
| 193 | Ga0207689_10255926 | 3300025942 | Bacteria | 1448 |
| 194 | Ga0207667_10123365 | 3300025949 | Unclassified | 2669 |
| 195 | Ga0207651_10000580 | 3300025960 | Bacteria | 15361 |
| 196 | Ga0207651_10208384 | 3300025960 | Bacteria | 1572 |
| 197 | Ga0207712_10010639 | 3300025961 | Bacteria | 5841 |
| 198 | Ga0207668_10014181 | 3300025972 | Bacteria | 4929 |
| 199 | Ga0207668_10367075 | 3300025972 | Bacteria | 1208 |
| 200 | Ga0207640_11261574 | 3300025981 | Bacteria | 659 |
| 201 | Ga0207658_10000954 | 3300025986 | Bacteria | 23879 |
| 202 | Ga0207658_10098105 | 3300025986 | Bacteria | 2289 |
| 203 | Ga0207658_10115532 | 3300025986 | Unclassified | 2130 |
| 204 | Ga0207677_10006126 | 3300026023 | Bacteria | 6568 |
| 205 | Ga0207677_10400790 | 3300026023 | Bacteria | 1163 |
| 206 | Ga0207703_10034672 | 3300026035 | Unclassified | 4006 |
| 207 | Ga0207703_10035909 | 3300026035 | Unclassified | 3941 |
| 208 | Ga0207639_10322405 | 3300026041 | Bacteria | 1372 |
| 209 | Ga0207702_10191832 | 3300026078 | Bacteria | 1888 |
| 210 | Ga0207641_10007808 | 3300026088 | Bacteria | 8888 |
| 211 | Ga0207641_10207976 | 3300026088 | Bacteria | 1808 |
| 212 | Ga0207641_10220741 | 3300026088 | Unclassified | 1757 |
| 213 | Ga0207648_10001236 | 3300026089 | Bacteria | 28701 |
| 214 | Ga0207648_10026621 | 3300026089 | Bacteria | 5137 |
| 215 | Ga0207676_10019666 | 3300026095 | Unclassified | 4930 |
| 216 | Ga0207674_10168572 | 3300026116 | Bacteria | 2143 |
| 217 | Ga0207698_10292452 | 3300026142 | Unclassified | 1512 |
| 218 | Ga0207698_10604382 | 3300026142 | Bacteria | 1082 |
| 219 | Ga0268266_10001883 | 3300028379 | Bacteria | 23702 |
| 220 | Ga0268265_10530715 | 3300028380 | Bacteria | 1114 |
| 221 | Ga0268264_10000831 | 3300028381 | Bacteria | 33127 |
| 222 | Ga0268264_10010880 | 3300028381 | Bacteria | 7518 |
| 223 | Ga0268264_10494977 | 3300028381 | Bacteria | 1191 |
| 224 | Ga0307515_10001436 | 3300028794 | Bacteria | 53821 |
| 225 | Ga0265327_10476032 | 3300031251 | Bacteria | 539 |
| 226 | Ga0307513_10379340 | 3300031456 | Bacteria | 1154 |
| 227 | Ga0307509_10064148 | 3300031507 | Bacteria | 3865 |
| 228 | Ga0307509_10463339 | 3300031507 | Bacteria | 959 |
| 229 | Ga0307408_100232156 | 3300031548 | Bacteria | 1512 |
| 230 | Ga0265314_10147196 | 3300031711 | Bacteria | 1449 |
| 231 | Ga0307405_10405107 | 3300031731 | Bacteria | 1069 |
| 232 | Ga0307413_10074163 | 3300031824 | Bacteria | 2154 |
| 233 | Ga0307407_10081387 | 3300031903 | Bacteria | 1960 |
| 234 | Ga0307416_100115833 | 3300032002 | Bacteria | 2374 |
| 235 | Ga0373941_0003470 | 3300035115 | Bacteria | 3573 |
| 236 | Ga0373925_0658973 | 3300037068 | Unclassified | 863 |
| 237 | Ga0451847_0172560 | 3300041503 | Bacteria | 802 |
| 238 | Ga0439431_0017467 | 3300041997 | Unclassified | 1688 |
| 239 | Ga0495638_0000026 | 3300046460 | Bacteria | 347061 |
| 240 | Ga0495651_0052344 | 3300046462 | Bacteria | 3145 |
| 241 | Ga0495650_0000132 | 3300046471 | Bacteria | 174226 |
| 242 | Ga0495606_0000100 | 3300046507 | Bacteria | 147592 |
| 243 | Ga0495608_0113697 | 3300046511 | Bacteria | 1739 |
| 244 | Ga0495610_0002138 | 3300046512 | Bacteria | 16818 |
| 245 | Ga0495610_0117828 | 3300046512 | Bacteria | 1168 |
| 246 | Ga0495616_0023549 | 3300046513 | Bacteria | 3311 |
| 247 | Ga0495631_0007869 | 3300046518 | Bacteria | 5400 |
| 248 | Ga0495652_0070284 | 3300046529 | Bacteria | 2927 |
| 249 | Ga0495609_0065756 | 3300046538 | Bacteria | 1598 |
| 250 | Ga0495633_0000263 | 3300046558 | Bacteria | 62381 |
| 251 | Ga0495633_0000583 | 3300046558 | Bacteria | 35346 |
| 252 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 253 | Ga0495625_0020137 | 3300046660 | Bacteria | 5155 |
| 254 | Ga0495625_0023180 | 3300046660 | Bacteria | 4744 |
| 255 | Ga0495625_0032397 | 3300046660 | Bacteria | 3874 |
| 256 | Ga0495659_0082645 | 3300046664 | Bacteria | 1222 |
| 257 | Ga0495661_0004241 | 3300046665 | Bacteria | 10421 |
| 258 | Ga0495661_0047622 | 3300046665 | Bacteria | 2609 |
| 259 | Ga0495588_0038794 | 3300046674 | Bacteria | 2424 |
| 260 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 261 | Ga0495636_0000086 | 3300047318 | Bacteria | 39542 |
| 262 | Ga0495672_0101849 | 3300047320 | Bacteria | 1556 |
| 263 | Ga0495687_000422 | 3300047443 | Bacteria | 52393 |
| 264 | Ga0495679_051708 | 3300047446 | Bacteria | 1231 |
| 265 | Ga0495673_0040617 | 3300047469 | Bacteria | 2100 |
| 266 | Ga0495686_0002954 | 3300047472 | Bacteria | 15197 |
| 267 | Ga0495686_0032338 | 3300047472 | Bacteria | 3386 |
| 268 | Ga0495686_0036937 | 3300047472 | Bacteria | 3133 |
| 269 | Ga0496104_1669589 | 3300048907 | Unclassified | 540 |
| 270 | Ga0496107_0598012 | 3300048910 | Bacteria | 815 |
| 271 | Ga0496108_0260142 | 3300048911 | Bacteria | 1510 |
| 272 | Ga0496109_0079969 | 3300048912 | Unclassified | 3012 |
| 273 | Ga0496109_0227885 | 3300048912 | Unclassified | 1753 |
| 274 | Ga0496114_0020045 | 3300048917 | Bacteria | 5425 |
| 275 | Ga0495678_021541 | 3300049459 | Bacteria | 2836 |
| 276 | Ga0501067_0004754 | 3300049583 | Bacteria | 7519 |
| 277 | Ga0501068_0003802 | 3300049584 | Bacteria | 8183 |
| 278 | Ga0501075_0031955 | 3300049591 | Bacteria | 3910 |
| 279 | Ga0501077_0004925 | 3300049593 | Bacteria | 8108 |
| 280 | Ga0501202_036809 | 3300049652 | Bacteria | 1043 |
| 281 | Ga0501217_138878 | 3300049661 | Unclassified | 718 |
| 282 | Ga0501256_039675 | 3300049685 | Unclassified | 556 |
| 283 | Ga0501225_0028503 | 3300049705 | Unclassified | 1535 |
| 284 | Ga0501080_0015384 | 3300049742 | Bacteria | 7052 |
| 285 | Ga0501268_150276 | 3300049765 | Unclassified | 537 |
| 286 | nmdc:mga0k408_959_c1 | 3300050493 | Bacteria | 15846 |
| 287 | Ga0500608_004047 | 3300053122 | Bacteria | 5614 |
| 288 | Ga0500628_047797 | 3300053129 | Bacteria | 1004 |
| 289 | Ga0500652_218802 | 3300053131 | Bacteria | 766 |
| 290 | Ga0500559_0565479 | 3300053136 | Unclassified | 518 |
| 291 | Ga0500577_0000325 | 3300053142 | Bacteria | 12392 |
| 292 | Ga0500616_0000004 | 3300053153 | Bacteria | 1002714 |
| 293 | Ga0500622_0009608 | 3300053156 | Bacteria | 5346 |
| 294 | Ga0501082_0000228 | 3300060353 | Bacteria | 49003 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053136 | Ga0500559_0565479 | Ga0500559_0565479_96_506 | 136 |
| 2 | 3300049583 | Ga0501067_0004754 | Ga0501067_0004754_5513_5953 | 146 |
| 3 | 3300049584 | Ga0501068_0003802 | Ga0501068_0003802_222_662 | 146 |
| 4 | 3300049591 | Ga0501075_0031955 | Ga0501075_0031955_417_857 | 146 |
| 5 | 3300049593 | Ga0501077_0004925 | Ga0501077_0004925_5534_5974 | 146 |
| 6 | 3300049742 | Ga0501080_0015384 | Ga0501080_0015384_4449_4889 | 146 |
| 7 | 3300060353 | Ga0501082_0000228 | Ga0501082_0000228_46417_46857 | 146 |
| 8 | 3300041997 | Ga0439431_0017467 | Ga0439431_0017467_665_1135 | 149 |
| 9 | iso_pu_bacteria | 2738541278 | 2738729164 | 149 |
| 10 | 3300005543 | Ga0070672_100738395 | Ga0070672_1007383952 | 150 |
| 11 | 3300013308 | Ga0157375_10428783 | Ga0157375_104287833 | 150 |
| 12 | 3300031251 | Ga0265327_10476032 | Ga0265327_104760321 | 150 |
| 13 | iso_pu_bacteria | 2599185184 | 2599477090 | 150 |
| 14 | iso_pu_bacteria | 2928078545 | 2928079002 | 150 |
| 15 | iso_pu_bacteria | 2928147474 | 2928148627 | 150 |
| 16 | iso_pu_bacteria | 2932082852 | 2932085652 | 150 |
| 17 | 3300005445 | Ga0070708_100268236 | Ga0070708_1002682362 | 151 |
| 18 | 3300005617 | Ga0068859_100001552 | Ga0068859_1000015527 | 151 |
| 19 | 3300006931 | Ga0097620_100001552 | Ga0097620_1000015527 | 151 |
| 20 | 3300014968 | Ga0157379_11799030 | Ga0157379_117990301 | 151 |
| 21 | 3300046660 | Ga0495625_0032397 | Ga0495625_0032397_2305_2760 | 151 |
| 22 | 3300005288 | Ga0065714_10016816 | Ga0065714_100168162 | 152 |
| 23 | 3300005327 | Ga0070658_10024945 | Ga0070658_100249455 | 152 |
| 24 | 3300005328 | Ga0070676_10000193 | Ga0070676_100001934 | 152 |
| 25 | 3300005330 | Ga0070690_100314397 | Ga0070690_1003143972 | 152 |
| 26 | 3300005335 | Ga0070666_10010136 | Ga0070666_100101364 | 152 |
| 27 | 3300005338 | Ga0068868_100000428 | Ga0068868_1000004286 | 152 |
| 28 | 3300005347 | Ga0070668_100009543 | Ga0070668_1000095434 | 152 |
| 29 | 3300005354 | Ga0070675_100100963 | Ga0070675_1001009632 | 152 |
| 30 | 3300005356 | Ga0070674_100189444 | Ga0070674_1001894442 | 152 |
| 31 | 3300005364 | Ga0070673_100000498 | Ga0070673_1000004984 | 152 |
| 32 | 3300005367 | Ga0070667_100000376 | Ga0070667_10000037642 | 152 |
| 33 | 3300005457 | Ga0070662_100007733 | Ga0070662_1000077335 | 152 |
| 34 | 3300005459 | Ga0068867_100018840 | Ga0068867_1000188404 | 152 |
| 35 | 3300005543 | Ga0070672_100000053 | Ga0070672_10000005314 | 152 |
| 36 | 3300005544 | Ga0070686_100129965 | Ga0070686_1001299653 | 152 |
| 37 | 3300005548 | Ga0070665_100023188 | Ga0070665_1000231884 | 152 |
| 38 | 3300005563 | Ga0068855_100077176 | Ga0068855_1000771762 | 152 |
| 39 | 3300005616 | Ga0068852_100016956 | Ga0068852_1000169563 | 152 |
| 40 | 3300005617 | Ga0068859_100081555 | Ga0068859_1000815552 | 152 |
| 41 | 3300005618 | Ga0068864_100001685 | Ga0068864_1000016854 | 152 |
| 42 | 3300005834 | Ga0068851_10010820 | Ga0068851_100108204 | 152 |
| 43 | 3300005841 | Ga0068863_100050996 | Ga0068863_1000509964 | 152 |
| 44 | 3300005842 | Ga0068858_100020680 | Ga0068858_1000206804 | 152 |
| 45 | 3300005843 | Ga0068860_100160584 | Ga0068860_1001605843 | 152 |
| 46 | 3300006237 | Ga0097621_100047636 | Ga0097621_1000476364 | 152 |
| 47 | 3300006358 | Ga0068871_100089281 | Ga0068871_1000892813 | 152 |
| 48 | 3300006881 | Ga0068865_100007029 | Ga0068865_1000070294 | 152 |
| 49 | 3300006931 | Ga0097620_100081555 | Ga0097620_1000815552 | 152 |
| 50 | 3300009093 | Ga0105240_10027258 | Ga0105240_100272584 | 152 |
| 51 | 3300009098 | Ga0105245_10043754 | Ga0105245_100437543 | 152 |
| 52 | 3300009098 | Ga0105245_10978608 | Ga0105245_109786082 | 152 |
| 53 | 3300009101 | Ga0105247_10031790 | Ga0105247_100317904 | 152 |
| 54 | 3300009176 | Ga0105242_10013628 | Ga0105242_100136288 | 152 |
| 55 | 3300009177 | Ga0105248_10050833 | Ga0105248_100508336 | 152 |
| 56 | 3300009551 | Ga0105238_10097463 | Ga0105238_100974633 | 152 |
| 57 | 3300009553 | Ga0105249_10015028 | Ga0105249_100150284 | 152 |
| 58 | 3300010375 | Ga0105239_10027099 | Ga0105239_100270995 | 152 |
| 59 | 3300013296 | Ga0157374_10019983 | Ga0157374_100199834 | 152 |
| 60 | 3300013297 | Ga0157378_10061885 | Ga0157378_100618855 | 152 |
| 61 | 3300013306 | Ga0163162_10021340 | Ga0163162_100213404 | 152 |
| 62 | 3300013307 | Ga0157372_10037755 | Ga0157372_100377554 | 152 |
| 63 | 3300014325 | Ga0163163_10018483 | Ga0163163_100184834 | 152 |
| 64 | 3300014968 | Ga0157379_10021550 | Ga0157379_100215504 | 152 |
| 65 | 3300017792 | Ga0163161_10011110 | Ga0163161_100111103 | 152 |
| 66 | 3300025250 | Ga0209026_1030838 | Ga0209026_10308382 | 152 |
| 67 | 3300025315 | Ga0207697_10011890 | Ga0207697_100118902 | 152 |
| 68 | 3300025321 | Ga0207656_10003871 | Ga0207656_100038713 | 152 |
| 69 | 3300025903 | Ga0207680_10000593 | Ga0207680_100005934 | 152 |
| 70 | 3300025907 | Ga0207645_10000863 | Ga0207645_1000086313 | 152 |
| 71 | 3300025909 | Ga0207705_10022807 | Ga0207705_100228073 | 152 |
| 72 | 3300025926 | Ga0207659_10457319 | Ga0207659_104573192 | 152 |
| 73 | 3300025933 | Ga0207706_10001034 | Ga0207706_1000103418 | 152 |
| 74 | 3300025934 | Ga0207686_10387238 | Ga0207686_103872382 | 152 |
| 75 | 3300025936 | Ga0207670_10533987 | Ga0207670_105339871 | 152 |
| 76 | 3300025937 | Ga0207669_10346963 | Ga0207669_103469632 | 152 |
| 77 | 3300025938 | Ga0207704_10003694 | Ga0207704_100036946 | 152 |
| 78 | 3300025940 | Ga0207691_10000012 | Ga0207691_10000012125 | 152 |
| 79 | 3300025941 | Ga0207711_10106350 | Ga0207711_101063503 | 152 |
| 80 | 3300025949 | Ga0207667_10123365 | Ga0207667_101233652 | 152 |
| 81 | 3300025960 | Ga0207651_10000580 | Ga0207651_1000058014 | 152 |
| 82 | 3300025960 | Ga0207651_10208384 | Ga0207651_102083841 | 152 |
| 83 | 3300025961 | Ga0207712_10010639 | Ga0207712_100106393 | 152 |
| 84 | 3300025972 | Ga0207668_10014181 | Ga0207668_100141814 | 152 |
| 85 | 3300025986 | Ga0207658_10000954 | Ga0207658_100009544 | 152 |
| 86 | 3300026023 | Ga0207677_10006126 | Ga0207677_100061264 | 152 |
| 87 | 3300026035 | Ga0207703_10035909 | Ga0207703_100359092 | 152 |
| 88 | 3300026088 | Ga0207641_10007808 | Ga0207641_100078085 | 152 |
| 89 | 3300026089 | Ga0207648_10001236 | Ga0207648_100012363 | 152 |
| 90 | 3300026095 | Ga0207676_10019666 | Ga0207676_100196664 | 152 |
| 91 | 3300026142 | Ga0207698_10604382 | Ga0207698_106043822 | 152 |
| 92 | 3300028379 | Ga0268266_10001883 | Ga0268266_100018836 | 152 |
| 93 | 3300028381 | Ga0268264_10010880 | Ga0268264_100108803 | 152 |
| 94 | 3300028794 | Ga0307515_10001436 | Ga0307515_1000143620 | 152 |
| 95 | 3300031507 | Ga0307509_10064148 | Ga0307509_100641485 | 152 |
| 96 | 3300046518 | Ga0495631_0007869 | Ga0495631_0007869_1833_2291 | 152 |
| 97 | 3300046558 | Ga0495633_0000263 | Ga0495633_0000263_56186_56644 | 152 |
| 98 | 3300046664 | Ga0495659_0082645 | Ga0495659_0082645_123_590 | 152 |
| 99 | 3300046674 | Ga0495588_0038794 | Ga0495588_0038794_663_1130 | 152 |
| 100 | 3300047472 | Ga0495686_0002954 | Ga0495686_0002954_3621_4079 | 152 |
| 101 | 3300047472 | Ga0495686_0036937 | Ga0495686_0036937_609_1067 | 152 |
| 102 | 3300048910 | Ga0496107_0598012 | Ga0496107_0598012_347_805 | 152 |
| 103 | 3300048911 | Ga0496108_0260142 | Ga0496108_0260142_896_1354 | 152 |
| 104 | 3300048912 | Ga0496109_0079969 | Ga0496109_0079969_2391_2849 | 152 |
| 105 | 3300048912 | Ga0496109_0227885 | Ga0496109_0227885_177_659 | 152 |
| 106 | 3300053122 | Ga0500608_004047 | Ga0500608_004047_1015_1473 | 152 |
| 107 | 3300053131 | Ga0500652_218802 | Ga0500652_218802_244_702 | 152 |
| 108 | 3300053142 | Ga0500577_0000325 | Ga0500577_0000325_9598_10065 | 152 |
| 109 | 3300003316 | rootH1_10139342 | rootH1_101393427 | 153 |
| 110 | 3300003323 | rootH1_10238662 | rootH1_102386622 | 153 |
| 111 | 3300003763 | Ga0055529_1006788 | Ga0055529_10067882 | 153 |
| 112 | 3300005331 | Ga0070670_100030433 | Ga0070670_1000304335 | 153 |
| 113 | 3300005353 | Ga0070669_100344692 | Ga0070669_1003446921 | 153 |
| 114 | 3300005367 | Ga0070667_100112851 | Ga0070667_1001128513 | 153 |
| 115 | 3300005367 | Ga0070667_101971457 | Ga0070667_1019714571 | 153 |
| 116 | 3300005563 | Ga0068855_100122469 | Ga0068855_1001224694 | 153 |
| 117 | 3300005577 | Ga0068857_100171586 | Ga0068857_1001715863 | 153 |
| 118 | 3300006237 | Ga0097621_100008458 | Ga0097621_1000084589 | 153 |
| 119 | 3300006358 | Ga0068871_100009934 | Ga0068871_1000099349 | 153 |
| 120 | 3300006881 | Ga0068865_100017595 | Ga0068865_1000175953 | 153 |
| 121 | 3300009093 | Ga0105240_10047666 | Ga0105240_100476664 | 153 |
| 122 | 3300009174 | Ga0105241_10043008 | Ga0105241_100430083 | 153 |
| 123 | 3300010375 | Ga0105239_10004970 | Ga0105239_1000497011 | 153 |
| 124 | 3300013102 | Ga0157371_10425948 | Ga0157371_104259482 | 153 |
| 125 | 3300013104 | Ga0157370_10186302 | Ga0157370_101863025 | 153 |
| 126 | 3300013297 | Ga0157378_10505696 | Ga0157378_105056962 | 153 |
| 127 | 3300014969 | Ga0157376_10076615 | Ga0157376_100766153 | 153 |
| 128 | 3300014969 | Ga0157376_10129715 | Ga0157376_101297152 | 153 |
| 129 | 3300015265 | Ga0182005_1151527 | Ga0182005_11515272 | 153 |
| 130 | 3300025250 | Ga0209026_1028687 | Ga0209026_10286872 | 153 |
| 131 | 3300025272 | Ga0209455_1007318 | Ga0209455_10073183 | 153 |
| 132 | 3300025914 | Ga0207671_10197974 | Ga0207671_101979742 | 153 |
| 133 | 3300025923 | Ga0207681_10668087 | Ga0207681_106680872 | 153 |
| 134 | 3300025925 | Ga0207650_10372982 | Ga0207650_103729822 | 153 |
| 135 | 3300025938 | Ga0207704_10035978 | Ga0207704_100359783 | 153 |
| 136 | 3300025986 | Ga0207658_10098105 | Ga0207658_100981053 | 153 |
| 137 | 3300026116 | Ga0207674_10168572 | Ga0207674_101685723 | 153 |
| 138 | 3300031507 | Ga0307509_10463339 | Ga0307509_104633392 | 153 |
| 139 | 3300031548 | Ga0307408_100232156 | Ga0307408_1002321562 | 153 |
| 140 | 3300031731 | Ga0307405_10405107 | Ga0307405_104051071 | 153 |
| 141 | 3300031824 | Ga0307413_10074163 | Ga0307413_100741632 | 153 |
| 142 | 3300031903 | Ga0307407_10081387 | Ga0307407_100813872 | 153 |
| 143 | 3300032002 | Ga0307416_100115833 | Ga0307416_1001158331 | 153 |
| 144 | 3300046462 | Ga0495651_0052344 | Ga0495651_0052344_1507_1968 | 153 |
| 145 | 3300046511 | Ga0495608_0113697 | Ga0495608_0113697_55_516 | 153 |
| 146 | 3300046529 | Ga0495652_0070284 | Ga0495652_0070284_2042_2503 | 153 |
| 147 | 3300046660 | Ga0495625_0023180 | Ga0495625_0023180_2825_3304 | 153 |
| 148 | 3300049652 | Ga0501202_036809 | Ga0501202_036809_292_759 | 153 |
| 149 | 3300049661 | Ga0501217_138878 | Ga0501217_138878_201_668 | 153 |
| 150 | 3300049685 | Ga0501256_039675 | Ga0501256_039675_15_485 | 153 |
| 151 | 3300049705 | Ga0501225_0028503 | Ga0501225_0028503_62_529 | 153 |
| 152 | 3300049765 | Ga0501268_150276 | Ga0501268_150276_55_525 | 153 |
| 153 | 3300001979 | JGI24740J21852_10025489 | JGI24740J21852_100254892 | 154 |
| 154 | 3300001990 | JGI24737J22298_10002536 | JGI24737J22298_100025366 | 154 |
| 155 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_10000006282 | 154 |
| 156 | 3300003316 | rootH1_10016978 | rootH1_100169789 | 154 |
| 157 | 3300003323 | rootH1_10022278 | rootH1_100222785 | 154 |
| 158 | 3300003323 | rootH1_10063468 | rootH1_100634683 | 154 |
| 159 | 3300003323 | rootH1_10228994 | rootH1_102289942 | 154 |
| 160 | 3300005288 | Ga0065714_10071629 | Ga0065714_100716294 | 154 |
| 161 | 3300005289 | Ga0065704_10113901 | Ga0065704_101139012 | 154 |
| 162 | 3300005295 | Ga0065707_10182253 | Ga0065707_101822533 | 154 |
| 163 | 3300005330 | Ga0070690_100592500 | Ga0070690_1005925002 | 154 |
| 164 | 3300005333 | Ga0070677_10001275 | Ga0070677_100012756 | 154 |
| 165 | 3300005334 | Ga0068869_100240589 | Ga0068869_1002405892 | 154 |
| 166 | 3300005335 | Ga0070666_10020724 | Ga0070666_100207242 | 154 |
| 167 | 3300005335 | Ga0070666_10075775 | Ga0070666_100757753 | 154 |
| 168 | 3300005336 | Ga0070680_100177489 | Ga0070680_1001774893 | 154 |
| 169 | 3300005338 | Ga0068868_100398237 | Ga0068868_1003982372 | 154 |
| 170 | 3300005340 | Ga0070689_100131623 | Ga0070689_1001316232 | 154 |
| 171 | 3300005343 | Ga0070687_100371152 | Ga0070687_1003711522 | 154 |
| 172 | 3300005347 | Ga0070668_100472967 | Ga0070668_1004729672 | 154 |
| 173 | 3300005354 | Ga0070675_100008568 | Ga0070675_1000085683 | 154 |
| 174 | 3300005354 | Ga0070675_100242499 | Ga0070675_1002424993 | 154 |
| 175 | 3300005356 | Ga0070674_100176923 | Ga0070674_1001769232 | 154 |
| 176 | 3300005356 | Ga0070674_101456189 | Ga0070674_1014561892 | 154 |
| 177 | 3300005364 | Ga0070673_100141058 | Ga0070673_1001410583 | 154 |
| 178 | 3300005365 | Ga0070688_100945222 | Ga0070688_1009452221 | 154 |
| 179 | 3300005367 | Ga0070667_100028993 | Ga0070667_1000289934 | 154 |
| 180 | 3300005459 | Ga0068867_100054455 | Ga0068867_1000544553 | 154 |
| 181 | 3300005530 | Ga0070679_100161869 | Ga0070679_1001618693 | 154 |
| 182 | 3300005539 | Ga0068853_100787891 | Ga0068853_1007878912 | 154 |
| 183 | 3300005543 | Ga0070672_100387325 | Ga0070672_1003873252 | 154 |
| 184 | 3300005543 | Ga0070672_100439175 | Ga0070672_1004391752 | 154 |
| 185 | 3300005544 | Ga0070686_100005833 | Ga0070686_1000058337 | 154 |
| 186 | 3300005563 | Ga0068855_100017500 | Ga0068855_1000175006 | 154 |
| 187 | 3300005564 | Ga0070664_100277522 | Ga0070664_1002775222 | 154 |
| 188 | 3300005614 | Ga0068856_100033652 | Ga0068856_1000336526 | 154 |
| 189 | 3300005615 | Ga0070702_100106968 | Ga0070702_1001069683 | 154 |
| 190 | 3300005617 | Ga0068859_100219556 | Ga0068859_1002195564 | 154 |
| 191 | 3300005618 | Ga0068864_100169911 | Ga0068864_1001699114 | 154 |
| 192 | 3300005618 | Ga0068864_101395499 | Ga0068864_1013954992 | 154 |
| 193 | 3300005718 | Ga0068866_10127097 | Ga0068866_101270971 | 154 |
| 194 | 3300005718 | Ga0068866_10807496 | Ga0068866_108074961 | 154 |
| 195 | 3300005719 | Ga0068861_100450067 | Ga0068861_1004500672 | 154 |
| 196 | 3300005841 | Ga0068863_100240476 | Ga0068863_1002404762 | 154 |
| 197 | 3300005841 | Ga0068863_101003403 | Ga0068863_1010034032 | 154 |
| 198 | 3300005842 | Ga0068858_100083183 | Ga0068858_1000831836 | 154 |
| 199 | 3300005843 | Ga0068860_100000052 | Ga0068860_10000005216 | 154 |
| 200 | 3300005843 | Ga0068860_100026233 | Ga0068860_1000262332 | 154 |
| 201 | 3300005844 | Ga0068862_100153314 | Ga0068862_1001533143 | 154 |
| 202 | 3300005844 | Ga0068862_100193918 | Ga0068862_1001939183 | 154 |
| 203 | 3300006195 | Ga0075366_10010302 | Ga0075366_100103027 | 154 |
| 204 | 3300006237 | Ga0097621_100065084 | Ga0097621_1000650844 | 154 |
| 205 | 3300006358 | Ga0068871_100106903 | Ga0068871_1001069032 | 154 |
| 206 | 3300006844 | Ga0075428_100075437 | Ga0075428_1000754371 | 154 |
| 207 | 3300006847 | Ga0075431_101686769 | Ga0075431_1016867692 | 154 |
| 208 | 3300006931 | Ga0097620_100219554 | Ga0097620_1002195544 | 154 |
| 209 | 3300009092 | Ga0105250_10357418 | Ga0105250_103574182 | 154 |
| 210 | 3300009093 | Ga0105240_10596115 | Ga0105240_105961152 | 154 |
| 211 | 3300009101 | Ga0105247_10124711 | Ga0105247_101247113 | 154 |
| 212 | 3300009147 | Ga0114129_11850880 | Ga0114129_118508802 | 154 |
| 213 | 3300009176 | Ga0105242_10723792 | Ga0105242_107237922 | 154 |
| 214 | 3300009553 | Ga0105249_10468184 | Ga0105249_104681841 | 154 |
| 215 | 3300010375 | Ga0105239_10021564 | Ga0105239_100215647 | 154 |
| 216 | 3300010375 | Ga0105239_10166309 | Ga0105239_101663094 | 154 |
| 217 | 3300013102 | Ga0157371_10015276 | Ga0157371_100152765 | 154 |
| 218 | 3300013104 | Ga0157370_10251191 | Ga0157370_102511912 | 154 |
| 219 | 3300013105 | Ga0157369_10202925 | Ga0157369_102029254 | 154 |
| 220 | 3300013297 | Ga0157378_10021350 | Ga0157378_100213506 | 154 |
| 221 | 3300013297 | Ga0157378_11688261 | Ga0157378_116882612 | 154 |
| 222 | 3300013306 | Ga0163162_10000428 | Ga0163162_1000042813 | 154 |
| 223 | 3300013306 | Ga0163162_10087172 | Ga0163162_100871724 | 154 |
| 224 | 3300013306 | Ga0163162_11496585 | Ga0163162_114965851 | 154 |
| 225 | 3300013307 | Ga0157372_10002755 | Ga0157372_100027556 | 154 |
| 226 | 3300013308 | Ga0157375_10157829 | Ga0157375_101578292 | 154 |
| 227 | 3300014325 | Ga0163163_10125336 | Ga0163163_101253362 | 154 |
| 228 | 3300014326 | Ga0157380_10126999 | Ga0157380_101269992 | 154 |
| 229 | 3300014745 | Ga0157377_10407024 | Ga0157377_104070242 | 154 |
| 230 | 3300014968 | Ga0157379_10401793 | Ga0157379_104017932 | 154 |
| 231 | 3300014969 | Ga0157376_10751730 | Ga0157376_107517302 | 154 |
| 232 | 3300017792 | Ga0163161_10125275 | Ga0163161_101252752 | 154 |
| 233 | 3300017792 | Ga0163161_10215281 | Ga0163161_102152813 | 154 |
| 234 | 3300025893 | Ga0207682_10090490 | Ga0207682_100904901 | 154 |
| 235 | 3300025899 | Ga0207642_10101223 | Ga0207642_101012233 | 154 |
| 236 | 3300025900 | Ga0207710_10012068 | Ga0207710_100120682 | 154 |
| 237 | 3300025903 | Ga0207680_10027560 | Ga0207680_100275602 | 154 |
| 238 | 3300025903 | Ga0207680_10079837 | Ga0207680_100798371 | 154 |
| 239 | 3300025904 | Ga0207647_10067610 | Ga0207647_100676103 | 154 |
| 240 | 3300025905 | Ga0207685_10442939 | Ga0207685_104429391 | 154 |
| 241 | 3300025908 | Ga0207643_10520510 | Ga0207643_105205102 | 154 |
| 242 | 3300025913 | Ga0207695_10641062 | Ga0207695_106410622 | 154 |
| 243 | 3300025917 | Ga0207660_10869188 | Ga0207660_108691881 | 154 |
| 244 | 3300025921 | Ga0207652_10153554 | Ga0207652_101535542 | 154 |
| 245 | 3300025926 | Ga0207659_10048928 | Ga0207659_100489282 | 154 |
| 246 | 3300025926 | Ga0207659_10160080 | Ga0207659_101600802 | 154 |
| 247 | 3300025931 | Ga0207644_10083784 | Ga0207644_100837842 | 154 |
| 248 | 3300025934 | Ga0207686_10561783 | Ga0207686_105617832 | 154 |
| 249 | 3300025936 | Ga0207670_10146851 | Ga0207670_101468512 | 154 |
| 250 | 3300025938 | Ga0207704_10915036 | Ga0207704_109150361 | 154 |
| 251 | 3300025940 | Ga0207691_10001692 | Ga0207691_1000169213 | 154 |
| 252 | 3300025940 | Ga0207691_11419016 | Ga0207691_114190162 | 154 |
| 253 | 3300025942 | Ga0207689_10254676 | Ga0207689_102546761 | 154 |
| 254 | 3300025942 | Ga0207689_10255926 | Ga0207689_102559262 | 154 |
| 255 | 3300025972 | Ga0207668_10367075 | Ga0207668_103670752 | 154 |
| 256 | 3300025981 | Ga0207640_11261574 | Ga0207640_112615741 | 154 |
| 257 | 3300025986 | Ga0207658_10115532 | Ga0207658_101155322 | 154 |
| 258 | 3300026023 | Ga0207677_10400790 | Ga0207677_104007902 | 154 |
| 259 | 3300026035 | Ga0207703_10034672 | Ga0207703_100346722 | 154 |
| 260 | 3300026041 | Ga0207639_10322405 | Ga0207639_103224051 | 154 |
| 261 | 3300026078 | Ga0207702_10191832 | Ga0207702_101918322 | 154 |
| 262 | 3300026088 | Ga0207641_10207976 | Ga0207641_102079763 | 154 |
| 263 | 3300026088 | Ga0207641_10220741 | Ga0207641_102207412 | 154 |
| 264 | 3300026089 | Ga0207648_10026621 | Ga0207648_100266215 | 154 |
| 265 | 3300026142 | Ga0207698_10292452 | Ga0207698_102924523 | 154 |
| 266 | 3300028380 | Ga0268265_10530715 | Ga0268265_105307152 | 154 |
| 267 | 3300028381 | Ga0268264_10000831 | Ga0268264_1000083111 | 154 |
| 268 | 3300028381 | Ga0268264_10494977 | Ga0268264_104949772 | 154 |
| 269 | 3300031456 | Ga0307513_10379340 | Ga0307513_103793402 | 154 |
| 270 | 3300031711 | Ga0265314_10147196 | Ga0265314_101471962 | 154 |
| 271 | 3300035115 | Ga0373941_0003470 | Ga0373941_0003470_985_1452 | 154 |
| 272 | 3300037068 | Ga0373925_0658973 | Ga0373925_0658973_163_627 | 154 |
| 273 | 3300041503 | Ga0451847_0172560 | Ga0451847_0172560_149_616 | 154 |
| 274 | 3300046460 | Ga0495638_0000026 | Ga0495638_0000026_71191_71664 | 154 |
| 275 | 3300046471 | Ga0495650_0000132 | Ga0495650_0000132_24487_24951 | 154 |
| 276 | 3300046507 | Ga0495606_0000100 | Ga0495606_0000100_19109_19579 | 154 |
| 277 | 3300046512 | Ga0495610_0002138 | Ga0495610_0002138_14459_14932 | 154 |
| 278 | 3300046512 | Ga0495610_0117828 | Ga0495610_0117828_315_779 | 154 |
| 279 | 3300046513 | Ga0495616_0023549 | Ga0495616_0023549_2692_3165 | 154 |
| 280 | 3300046538 | Ga0495609_0065756 | Ga0495609_0065756_789_1253 | 154 |
| 281 | 3300046558 | Ga0495633_0000583 | Ga0495633_0000583_13739_14212 | 154 |
| 282 | 3300046660 | Ga0495625_0000036 | Ga0495625_0000036_143442_143915 | 154 |
| 283 | 3300046660 | Ga0495625_0020137 | Ga0495625_0020137_1989_2453 | 154 |
| 284 | 3300046665 | Ga0495661_0004241 | Ga0495661_0004241_3370_3843 | 154 |
| 285 | 3300046665 | Ga0495661_0047622 | Ga0495661_0047622_1852_2325 | 154 |
| 286 | 3300046694 | Ga0495649_0000017 | Ga0495649_0000017_77801_78274 | 154 |
| 287 | 3300047318 | Ga0495636_0000086 | Ga0495636_0000086_2486_2959 | 154 |
| 288 | 3300047320 | Ga0495672_0101849 | Ga0495672_0101849_945_1409 | 154 |
| 289 | 3300047443 | Ga0495687_000422 | Ga0495687_000422_20983_21450 | 154 |
| 290 | 3300047446 | Ga0495679_051708 | Ga0495679_051708_654_1127 | 154 |
| 291 | 3300047469 | Ga0495673_0040617 | Ga0495673_0040617_1520_1993 | 154 |
| 292 | 3300047472 | Ga0495686_0032338 | Ga0495686_0032338_709_1173 | 154 |
| 293 | 3300048907 | Ga0496104_1669589 | Ga0496104_1669589_17_502 | 154 |
| 294 | 3300048917 | Ga0496114_0020045 | Ga0496114_0020045_4127_4612 | 154 |
| 295 | 3300049459 | Ga0495678_021541 | Ga0495678_021541_535_1008 | 154 |
| 296 | 3300050493 | nmdc:mga0k408_959_c1 | nmdc:mga0k408_959_c1_4908_5381 | 154 |
| 297 | 3300053129 | Ga0500628_047797 | Ga0500628_047797_61_531 | 154 |
| 298 | 3300053153 | Ga0500616_0000004 | Ga0500616_0000004_163644_164117 | 154 |
| 299 | 3300053156 | Ga0500622_0009608 | Ga0500622_0009608_2951_3418 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9094 | 12 | 146 |
| 2ldk-assembly1.cif.gz_A | solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 | 0.9058 | 5 | 150 |
| 1xuv-assembly2.cif.gz_B-2 | x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. | 0.9009 | 5 | 153 |
| 1xfs-assembly1.cif.gz_A | x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. | 0.8972 | 9 | 154 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.8966 | 11 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9074 | 12 | 146 | 3.30.530.20 |
| 2ldkA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9058 | 5 | 150 | 3.30.530.20 |
| af_Q2G1U9_1_155_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.901 | 11 | 148 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8809 | 5 | 152 | 3.30.530.20 |
| 3uidB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8774 | 5 | 151 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D4PX47-F1-model_v4 | SRPBCC domain-containing protein | 0.9882 | 5 | 150 |
|
| AF-A0A329N0P9-F1-model_v4 | Polyketide cyclase | 0.9823 | 10 | 153 |
|
| AF-A0A2V6QP18-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9815 | 9 | 154 |
|
| AF-A0A1H0XCZ7-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9805 | 5 | 150 |
|
| AF-A0A2V6QNA5-F1-model_v4 | ATPase | 0.9766 | 8 | 154 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar