F394688

General Info

Members Datasets Scaffolds Average Seq Length
299 196 294 155

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_101456189|Ga0070674_1014561892
Length 169
Sequence MLLNLKKNDMEKQKSNTADRELLLTRILDAPIELVWEVWTKPEHIALWWGPDGFTNTIQEMDVQPDGEWSLVMHGPDGTDYRNKSIFKEIIPYKKIVYDHISGPRFLATIEFESRGNQTFISWHMLFESAEQFIQVVKTFKADEGLKQNIEKLNAYLKGVHILSKSERR

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.68
Nodule 0
Rhizoplane 2.34
Rhizosphere 88.63
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10025489 3300001979 Bacteria 1992
2 JGI24737J22298_10002536 3300001990 Bacteria 6483
3 JGI24735J21928_10000006 3300002067 Bacteria 339303
4 rootH1_10016978 3300003316 Bacteria 25561
5 rootH1_10139342 3300003316 Bacteria 6598
6 rootH1_10022278 3300003323 Bacteria 6215
7 rootH1_10063468 3300003323 Bacteria 2950
8 rootH1_10228994 3300003323 Bacteria 1405
9 rootH1_10238662 3300003323 Bacteria 1254
10 Ga0055529_1006788 3300003763 Bacteria 1580
11 Ga0065714_10016816 3300005288 Bacteria 2054
12 Ga0065714_10071629 3300005288 Bacteria 3531
13 Ga0065704_10113901 3300005289 Bacteria 1903
14 Ga0065707_10182253 3300005295 Bacteria 1411
15 Ga0070658_10024945 3300005327 Unclassified 4794
16 Ga0070676_10000193 3300005328 Bacteria 25377
17 Ga0070690_100314397 3300005330 Bacteria 1127
18 Ga0070690_100592500 3300005330 Bacteria 840
19 Ga0070670_100030433 3300005331 Unclassified 4649
20 Ga0070677_10001275 3300005333 Bacteria 8066
21 Ga0068869_100240589 3300005334 Unclassified 1442
22 Ga0070666_10010136 3300005335 Bacteria 5886
23 Ga0070666_10020724 3300005335 Unclassified 4253
24 Ga0070666_10075775 3300005335 Bacteria 2294
25 Ga0070680_100177489 3300005336 Bacteria 1793
26 Ga0068868_100000428 3300005338 Bacteria 28195
27 Ga0068868_100398237 3300005338 Bacteria 1188
28 Ga0070689_100131623 3300005340 Unclassified 2006
29 Ga0070687_100371152 3300005343 Bacteria 929
30 Ga0070668_100009543 3300005347 Bacteria 7201
31 Ga0070668_100472967 3300005347 Unclassified 1081
32 Ga0070669_100344692 3300005353 Bacteria 1208
33 Ga0070675_100008568 3300005354 Bacteria 7940
34 Ga0070675_100100963 3300005354 Bacteria 2430
35 Ga0070675_100242499 3300005354 Bacteria 1575
36 Ga0070674_100176923 3300005356 Unclassified 1631
37 Ga0070674_100189444 3300005356 Unclassified 1581
38 Ga0070674_101456189 3300005356 Bacteria 614
39 Ga0070673_100000498 3300005364 Bacteria 20956
40 Ga0070673_100141058 3300005364 Unclassified 2033
41 Ga0070688_100945222 3300005365 Unclassified 682
42 Ga0070667_100000376 3300005367 Bacteria 48890
43 Ga0070667_100028993 3300005367 Bacteria 4609
44 Ga0070667_100112851 3300005367 Bacteria 2358
45 Ga0070667_101971457 3300005367 Bacteria 550
46 Ga0070708_100268236 3300005445 Bacteria 1605
47 Ga0070662_100007733 3300005457 Bacteria 6978
48 Ga0068867_100018840 3300005459 Unclassified 4910
49 Ga0068867_100054455 3300005459 Bacteria 2956
50 Ga0070679_100161869 3300005530 Bacteria 2212
51 Ga0068853_100787891 3300005539 Bacteria 910
52 Ga0070672_100000053 3300005543 Bacteria 51215
53 Ga0070672_100387325 3300005543 Unclassified 1196
54 Ga0070672_100439175 3300005543 Bacteria 1123
55 Ga0070672_100738395 3300005543 Unclassified 863
56 Ga0070686_100005833 3300005544 Bacteria 6824
57 Ga0070686_100129965 3300005544 Bacteria 1740
58 Ga0070665_100023188 3300005548 Bacteria 6252
59 Ga0068855_100017500 3300005563 Bacteria 8619
60 Ga0068855_100077176 3300005563 Unclassified 3865
61 Ga0068855_100122469 3300005563 Unclassified 2976
62 Ga0070664_100277522 3300005564 Bacteria 1511
63 Ga0068857_100171586 3300005577 Bacteria 1972
64 Ga0068856_100033652 3300005614 Bacteria 5018
65 Ga0070702_100106968 3300005615 Bacteria 1726
66 Ga0068852_100016956 3300005616 Bacteria 5699
67 Ga0068859_100001552 3300005617 Bacteria 23438
68 Ga0068859_100081555 3300005617 Bacteria 3277
69 Ga0068859_100219556 3300005617 Bacteria 1988
70 Ga0068864_100001685 3300005618 Bacteria 18165
71 Ga0068864_100169911 3300005618 Bacteria 1987
72 Ga0068864_101395499 3300005618 Bacteria 702
73 Ga0068866_10127097 3300005718 Bacteria 1444
74 Ga0068866_10807496 3300005718 Bacteria 653
75 Ga0068861_100450067 3300005719 Bacteria 1154
76 Ga0068851_10010820 3300005834 Bacteria 4263
77 Ga0068863_100050996 3300005841 Unclassified 3922
78 Ga0068863_100240476 3300005841 Bacteria 1747
79 Ga0068863_101003403 3300005841 Unclassified 837
80 Ga0068858_100020680 3300005842 Bacteria 6147
81 Ga0068858_100083183 3300005842 Unclassified 2976
82 Ga0068860_100000052 3300005843 Bacteria 207351
83 Ga0068860_100026233 3300005843 Bacteria 5617
84 Ga0068860_100160584 3300005843 Unclassified 2167
85 Ga0068862_100153314 3300005844 Bacteria 2052
86 Ga0068862_100193918 3300005844 Unclassified 1829
87 Ga0075366_10010302 3300006195 Bacteria 5245
88 Ga0097621_100008458 3300006237 Bacteria 7415
89 Ga0097621_100047636 3300006237 Unclassified 3474
90 Ga0097621_100065084 3300006237 Bacteria 2999
91 Ga0068871_100009934 3300006358 Bacteria 6913
92 Ga0068871_100089281 3300006358 Unclassified 2565
93 Ga0068871_100106903 3300006358 Bacteria 2349
94 Ga0075428_100075437 3300006844 Unclassified 3682
95 Ga0075431_101686769 3300006847 Bacteria 591
96 Ga0068865_100007029 3300006881 Bacteria 6908
97 Ga0068865_100017595 3300006881 Bacteria 4599
98 Ga0097620_100001552 3300006931 Bacteria 23438
99 Ga0097620_100081555 3300006931 Bacteria 3277
100 Ga0097620_100219554 3300006931 Bacteria 1988
101 Ga0105250_10357418 3300009092 Unclassified 641
102 Ga0105240_10027258 3300009093 Bacteria 7482
103 Ga0105240_10047666 3300009093 Bacteria 5421
104 Ga0105240_10596115 3300009093 Bacteria 1217
105 Ga0105245_10043754 3300009098 Bacteria 3994
106 Ga0105245_10978608 3300009098 Bacteria 890
107 Ga0105247_10031790 3300009101 Unclassified 3205
108 Ga0105247_10124711 3300009101 Bacteria 1672
109 Ga0114129_11850880 3300009147 Bacteria 733
110 Ga0105241_10043008 3300009174 Unclassified 3420
111 Ga0105242_10013628 3300009176 Bacteria 6291
112 Ga0105242_10723792 3300009176 Bacteria 976
113 Ga0105248_10050833 3300009177 Bacteria 4650
114 Ga0105238_10097463 3300009551 Bacteria 2926
115 Ga0105249_10015028 3300009553 Bacteria 6849
116 Ga0105249_10468184 3300009553 Bacteria 1301
117 Ga0105239_10004970 3300010375 Bacteria 15702
118 Ga0105239_10021564 3300010375 Bacteria 7103
119 Ga0105239_10027099 3300010375 Bacteria 6308
120 Ga0105239_10166309 3300010375 Bacteria 2466
121 Ga0157371_10015276 3300013102 Bacteria 5765
122 Ga0157371_10425948 3300013102 Unclassified 973
123 Ga0157370_10186302 3300013104 Bacteria 1927
124 Ga0157370_10251191 3300013104 Bacteria 1636
125 Ga0157369_10202925 3300013105 Bacteria 2081
126 Ga0157374_10019983 3300013296 Bacteria 5938
127 Ga0157378_10021350 3300013297 Bacteria 5693
128 Ga0157378_10061885 3300013297 Unclassified 3342
129 Ga0157378_10505696 3300013297 Bacteria 1208
130 Ga0157378_11688261 3300013297 Bacteria 680
131 Ga0163162_10000428 3300013306 Bacteria 38750
132 Ga0163162_10021340 3300013306 Bacteria 6377
133 Ga0163162_10087172 3300013306 Bacteria 3200
134 Ga0163162_11496585 3300013306 Unclassified 769
135 Ga0157372_10002755 3300013307 Bacteria 19002
136 Ga0157372_10037755 3300013307 Bacteria 5328
137 Ga0157375_10157829 3300013308 Bacteria 2408
138 Ga0157375_10428783 3300013308 Bacteria 1488
139 Ga0163163_10018483 3300014325 Bacteria 6527
140 Ga0163163_10125336 3300014325 Unclassified 2606
141 Ga0157380_10126999 3300014326 Bacteria 2169
142 Ga0157377_10407024 3300014745 Bacteria 928
143 Ga0157379_10021550 3300014968 Bacteria 5706
144 Ga0157379_10401793 3300014968 Bacteria 1260
145 Ga0157379_11799030 3300014968 Bacteria 602
146 Ga0157376_10076615 3300014969 Bacteria 2858
147 Ga0157376_10129715 3300014969 Bacteria 2248
148 Ga0157376_10751730 3300014969 Bacteria 984
149 Ga0182005_1151527 3300015265 Bacteria 675
150 Ga0163161_10011110 3300017792 Bacteria 6238
151 Ga0163161_10125275 3300017792 Bacteria 1934
152 Ga0163161_10215281 3300017792 Bacteria 1485
153 Ga0209026_1028687 3300025250 Bacteria 831
154 Ga0209026_1030838 3300025250 Bacteria 795
155 Ga0209455_1007318 3300025272 Bacteria 3134
156 Ga0207697_10011890 3300025315 Unclassified 3668
157 Ga0207656_10003871 3300025321 Bacteria 5189
158 Ga0207682_10090490 3300025893 Bacteria 1326
159 Ga0207642_10101223 3300025899 Bacteria 1447
160 Ga0207710_10012068 3300025900 Unclassified 3631
161 Ga0207680_10000593 3300025903 Bacteria 17084
162 Ga0207680_10027560 3300025903 Bacteria 3165
163 Ga0207680_10079837 3300025903 Bacteria 2053
164 Ga0207647_10067610 3300025904 Bacteria 2165
165 Ga0207685_10442939 3300025905 Bacteria 674
166 Ga0207645_10000863 3300025907 Bacteria 25194
167 Ga0207643_10520510 3300025908 Bacteria 762
168 Ga0207705_10022807 3300025909 Unclassified 4463
169 Ga0207695_10641062 3300025913 Bacteria 943
170 Ga0207671_10197974 3300025914 Unclassified 1568
171 Ga0207660_10869188 3300025917 Bacteria 736
172 Ga0207652_10153554 3300025921 Bacteria 2062
173 Ga0207681_10668087 3300025923 Bacteria 862
174 Ga0207650_10372982 3300025925 Bacteria 1177
175 Ga0207659_10048928 3300025926 Bacteria 2997
176 Ga0207659_10160080 3300025926 Bacteria 1766
177 Ga0207659_10457319 3300025926 Bacteria 1076
178 Ga0207644_10083784 3300025931 Unclassified 2362
179 Ga0207706_10001034 3300025933 Bacteria 28280
180 Ga0207686_10387238 3300025934 Bacteria 1062
181 Ga0207686_10561783 3300025934 Bacteria 893
182 Ga0207670_10146851 3300025936 Unclassified 1745
183 Ga0207670_10533987 3300025936 Unclassified 956
184 Ga0207669_10346963 3300025937 Bacteria 1145
185 Ga0207704_10003694 3300025938 Bacteria 6962
186 Ga0207704_10035978 3300025938 Bacteria 2844
187 Ga0207704_10915036 3300025938 Bacteria 738
188 Ga0207691_10000012 3300025940 Bacteria 147942
189 Ga0207691_10001692 3300025940 Bacteria 21777
190 Ga0207691_11419016 3300025940 Bacteria 570
191 Ga0207711_10106350 3300025941 Unclassified 2490
192 Ga0207689_10254676 3300025942 Bacteria 1452
193 Ga0207689_10255926 3300025942 Bacteria 1448
194 Ga0207667_10123365 3300025949 Unclassified 2669
195 Ga0207651_10000580 3300025960 Bacteria 15361
196 Ga0207651_10208384 3300025960 Bacteria 1572
197 Ga0207712_10010639 3300025961 Bacteria 5841
198 Ga0207668_10014181 3300025972 Bacteria 4929
199 Ga0207668_10367075 3300025972 Bacteria 1208
200 Ga0207640_11261574 3300025981 Bacteria 659
201 Ga0207658_10000954 3300025986 Bacteria 23879
202 Ga0207658_10098105 3300025986 Bacteria 2289
203 Ga0207658_10115532 3300025986 Unclassified 2130
204 Ga0207677_10006126 3300026023 Bacteria 6568
205 Ga0207677_10400790 3300026023 Bacteria 1163
206 Ga0207703_10034672 3300026035 Unclassified 4006
207 Ga0207703_10035909 3300026035 Unclassified 3941
208 Ga0207639_10322405 3300026041 Bacteria 1372
209 Ga0207702_10191832 3300026078 Bacteria 1888
210 Ga0207641_10007808 3300026088 Bacteria 8888
211 Ga0207641_10207976 3300026088 Bacteria 1808
212 Ga0207641_10220741 3300026088 Unclassified 1757
213 Ga0207648_10001236 3300026089 Bacteria 28701
214 Ga0207648_10026621 3300026089 Bacteria 5137
215 Ga0207676_10019666 3300026095 Unclassified 4930
216 Ga0207674_10168572 3300026116 Bacteria 2143
217 Ga0207698_10292452 3300026142 Unclassified 1512
218 Ga0207698_10604382 3300026142 Bacteria 1082
219 Ga0268266_10001883 3300028379 Bacteria 23702
220 Ga0268265_10530715 3300028380 Bacteria 1114
221 Ga0268264_10000831 3300028381 Bacteria 33127
222 Ga0268264_10010880 3300028381 Bacteria 7518
223 Ga0268264_10494977 3300028381 Bacteria 1191
224 Ga0307515_10001436 3300028794 Bacteria 53821
225 Ga0265327_10476032 3300031251 Bacteria 539
226 Ga0307513_10379340 3300031456 Bacteria 1154
227 Ga0307509_10064148 3300031507 Bacteria 3865
228 Ga0307509_10463339 3300031507 Bacteria 959
229 Ga0307408_100232156 3300031548 Bacteria 1512
230 Ga0265314_10147196 3300031711 Bacteria 1449
231 Ga0307405_10405107 3300031731 Bacteria 1069
232 Ga0307413_10074163 3300031824 Bacteria 2154
233 Ga0307407_10081387 3300031903 Bacteria 1960
234 Ga0307416_100115833 3300032002 Bacteria 2374
235 Ga0373941_0003470 3300035115 Bacteria 3573
236 Ga0373925_0658973 3300037068 Unclassified 863
237 Ga0451847_0172560 3300041503 Bacteria 802
238 Ga0439431_0017467 3300041997 Unclassified 1688
239 Ga0495638_0000026 3300046460 Bacteria 347061
240 Ga0495651_0052344 3300046462 Bacteria 3145
241 Ga0495650_0000132 3300046471 Bacteria 174226
242 Ga0495606_0000100 3300046507 Bacteria 147592
243 Ga0495608_0113697 3300046511 Bacteria 1739
244 Ga0495610_0002138 3300046512 Bacteria 16818
245 Ga0495610_0117828 3300046512 Bacteria 1168
246 Ga0495616_0023549 3300046513 Bacteria 3311
247 Ga0495631_0007869 3300046518 Bacteria 5400
248 Ga0495652_0070284 3300046529 Bacteria 2927
249 Ga0495609_0065756 3300046538 Bacteria 1598
250 Ga0495633_0000263 3300046558 Bacteria 62381
251 Ga0495633_0000583 3300046558 Bacteria 35346
252 Ga0495625_0000036 3300046660 Bacteria 221680
253 Ga0495625_0020137 3300046660 Bacteria 5155
254 Ga0495625_0023180 3300046660 Bacteria 4744
255 Ga0495625_0032397 3300046660 Bacteria 3874
256 Ga0495659_0082645 3300046664 Bacteria 1222
257 Ga0495661_0004241 3300046665 Bacteria 10421
258 Ga0495661_0047622 3300046665 Bacteria 2609
259 Ga0495588_0038794 3300046674 Bacteria 2424
260 Ga0495649_0000017 3300046694 Bacteria 221685
261 Ga0495636_0000086 3300047318 Bacteria 39542
262 Ga0495672_0101849 3300047320 Bacteria 1556
263 Ga0495687_000422 3300047443 Bacteria 52393
264 Ga0495679_051708 3300047446 Bacteria 1231
265 Ga0495673_0040617 3300047469 Bacteria 2100
266 Ga0495686_0002954 3300047472 Bacteria 15197
267 Ga0495686_0032338 3300047472 Bacteria 3386
268 Ga0495686_0036937 3300047472 Bacteria 3133
269 Ga0496104_1669589 3300048907 Unclassified 540
270 Ga0496107_0598012 3300048910 Bacteria 815
271 Ga0496108_0260142 3300048911 Bacteria 1510
272 Ga0496109_0079969 3300048912 Unclassified 3012
273 Ga0496109_0227885 3300048912 Unclassified 1753
274 Ga0496114_0020045 3300048917 Bacteria 5425
275 Ga0495678_021541 3300049459 Bacteria 2836
276 Ga0501067_0004754 3300049583 Bacteria 7519
277 Ga0501068_0003802 3300049584 Bacteria 8183
278 Ga0501075_0031955 3300049591 Bacteria 3910
279 Ga0501077_0004925 3300049593 Bacteria 8108
280 Ga0501202_036809 3300049652 Bacteria 1043
281 Ga0501217_138878 3300049661 Unclassified 718
282 Ga0501256_039675 3300049685 Unclassified 556
283 Ga0501225_0028503 3300049705 Unclassified 1535
284 Ga0501080_0015384 3300049742 Bacteria 7052
285 Ga0501268_150276 3300049765 Unclassified 537
286 nmdc:mga0k408_959_c1 3300050493 Bacteria 15846
287 Ga0500608_004047 3300053122 Bacteria 5614
288 Ga0500628_047797 3300053129 Bacteria 1004
289 Ga0500652_218802 3300053131 Bacteria 766
290 Ga0500559_0565479 3300053136 Unclassified 518
291 Ga0500577_0000325 3300053142 Bacteria 12392
292 Ga0500616_0000004 3300053153 Bacteria 1002714
293 Ga0500622_0009608 3300053156 Bacteria 5346
294 Ga0501082_0000228 3300060353 Bacteria 49003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0565479 Ga0500559_0565479_96_506 136
2 3300049583 Ga0501067_0004754 Ga0501067_0004754_5513_5953 146
3 3300049584 Ga0501068_0003802 Ga0501068_0003802_222_662 146
4 3300049591 Ga0501075_0031955 Ga0501075_0031955_417_857 146
5 3300049593 Ga0501077_0004925 Ga0501077_0004925_5534_5974 146
6 3300049742 Ga0501080_0015384 Ga0501080_0015384_4449_4889 146
7 3300060353 Ga0501082_0000228 Ga0501082_0000228_46417_46857 146
8 3300041997 Ga0439431_0017467 Ga0439431_0017467_665_1135 149
9 iso_pu_bacteria 2738541278 2738729164 149
10 3300005543 Ga0070672_100738395 Ga0070672_1007383952 150
11 3300013308 Ga0157375_10428783 Ga0157375_104287833 150
12 3300031251 Ga0265327_10476032 Ga0265327_104760321 150
13 iso_pu_bacteria 2599185184 2599477090 150
14 iso_pu_bacteria 2928078545 2928079002 150
15 iso_pu_bacteria 2928147474 2928148627 150
16 iso_pu_bacteria 2932082852 2932085652 150
17 3300005445 Ga0070708_100268236 Ga0070708_1002682362 151
18 3300005617 Ga0068859_100001552 Ga0068859_1000015527 151
19 3300006931 Ga0097620_100001552 Ga0097620_1000015527 151
20 3300014968 Ga0157379_11799030 Ga0157379_117990301 151
21 3300046660 Ga0495625_0032397 Ga0495625_0032397_2305_2760 151
22 3300005288 Ga0065714_10016816 Ga0065714_100168162 152
23 3300005327 Ga0070658_10024945 Ga0070658_100249455 152
24 3300005328 Ga0070676_10000193 Ga0070676_100001934 152
25 3300005330 Ga0070690_100314397 Ga0070690_1003143972 152
26 3300005335 Ga0070666_10010136 Ga0070666_100101364 152
27 3300005338 Ga0068868_100000428 Ga0068868_1000004286 152
28 3300005347 Ga0070668_100009543 Ga0070668_1000095434 152
29 3300005354 Ga0070675_100100963 Ga0070675_1001009632 152
30 3300005356 Ga0070674_100189444 Ga0070674_1001894442 152
31 3300005364 Ga0070673_100000498 Ga0070673_1000004984 152
32 3300005367 Ga0070667_100000376 Ga0070667_10000037642 152
33 3300005457 Ga0070662_100007733 Ga0070662_1000077335 152
34 3300005459 Ga0068867_100018840 Ga0068867_1000188404 152
35 3300005543 Ga0070672_100000053 Ga0070672_10000005314 152
36 3300005544 Ga0070686_100129965 Ga0070686_1001299653 152
37 3300005548 Ga0070665_100023188 Ga0070665_1000231884 152
38 3300005563 Ga0068855_100077176 Ga0068855_1000771762 152
39 3300005616 Ga0068852_100016956 Ga0068852_1000169563 152
40 3300005617 Ga0068859_100081555 Ga0068859_1000815552 152
41 3300005618 Ga0068864_100001685 Ga0068864_1000016854 152
42 3300005834 Ga0068851_10010820 Ga0068851_100108204 152
43 3300005841 Ga0068863_100050996 Ga0068863_1000509964 152
44 3300005842 Ga0068858_100020680 Ga0068858_1000206804 152
45 3300005843 Ga0068860_100160584 Ga0068860_1001605843 152
46 3300006237 Ga0097621_100047636 Ga0097621_1000476364 152
47 3300006358 Ga0068871_100089281 Ga0068871_1000892813 152
48 3300006881 Ga0068865_100007029 Ga0068865_1000070294 152
49 3300006931 Ga0097620_100081555 Ga0097620_1000815552 152
50 3300009093 Ga0105240_10027258 Ga0105240_100272584 152
51 3300009098 Ga0105245_10043754 Ga0105245_100437543 152
52 3300009098 Ga0105245_10978608 Ga0105245_109786082 152
53 3300009101 Ga0105247_10031790 Ga0105247_100317904 152
54 3300009176 Ga0105242_10013628 Ga0105242_100136288 152
55 3300009177 Ga0105248_10050833 Ga0105248_100508336 152
56 3300009551 Ga0105238_10097463 Ga0105238_100974633 152
57 3300009553 Ga0105249_10015028 Ga0105249_100150284 152
58 3300010375 Ga0105239_10027099 Ga0105239_100270995 152
59 3300013296 Ga0157374_10019983 Ga0157374_100199834 152
60 3300013297 Ga0157378_10061885 Ga0157378_100618855 152
61 3300013306 Ga0163162_10021340 Ga0163162_100213404 152
62 3300013307 Ga0157372_10037755 Ga0157372_100377554 152
63 3300014325 Ga0163163_10018483 Ga0163163_100184834 152
64 3300014968 Ga0157379_10021550 Ga0157379_100215504 152
65 3300017792 Ga0163161_10011110 Ga0163161_100111103 152
66 3300025250 Ga0209026_1030838 Ga0209026_10308382 152
67 3300025315 Ga0207697_10011890 Ga0207697_100118902 152
68 3300025321 Ga0207656_10003871 Ga0207656_100038713 152
69 3300025903 Ga0207680_10000593 Ga0207680_100005934 152
70 3300025907 Ga0207645_10000863 Ga0207645_1000086313 152
71 3300025909 Ga0207705_10022807 Ga0207705_100228073 152
72 3300025926 Ga0207659_10457319 Ga0207659_104573192 152
73 3300025933 Ga0207706_10001034 Ga0207706_1000103418 152
74 3300025934 Ga0207686_10387238 Ga0207686_103872382 152
75 3300025936 Ga0207670_10533987 Ga0207670_105339871 152
76 3300025937 Ga0207669_10346963 Ga0207669_103469632 152
77 3300025938 Ga0207704_10003694 Ga0207704_100036946 152
78 3300025940 Ga0207691_10000012 Ga0207691_10000012125 152
79 3300025941 Ga0207711_10106350 Ga0207711_101063503 152
80 3300025949 Ga0207667_10123365 Ga0207667_101233652 152
81 3300025960 Ga0207651_10000580 Ga0207651_1000058014 152
82 3300025960 Ga0207651_10208384 Ga0207651_102083841 152
83 3300025961 Ga0207712_10010639 Ga0207712_100106393 152
84 3300025972 Ga0207668_10014181 Ga0207668_100141814 152
85 3300025986 Ga0207658_10000954 Ga0207658_100009544 152
86 3300026023 Ga0207677_10006126 Ga0207677_100061264 152
87 3300026035 Ga0207703_10035909 Ga0207703_100359092 152
88 3300026088 Ga0207641_10007808 Ga0207641_100078085 152
89 3300026089 Ga0207648_10001236 Ga0207648_100012363 152
90 3300026095 Ga0207676_10019666 Ga0207676_100196664 152
91 3300026142 Ga0207698_10604382 Ga0207698_106043822 152
92 3300028379 Ga0268266_10001883 Ga0268266_100018836 152
93 3300028381 Ga0268264_10010880 Ga0268264_100108803 152
94 3300028794 Ga0307515_10001436 Ga0307515_1000143620 152
95 3300031507 Ga0307509_10064148 Ga0307509_100641485 152
96 3300046518 Ga0495631_0007869 Ga0495631_0007869_1833_2291 152
97 3300046558 Ga0495633_0000263 Ga0495633_0000263_56186_56644 152
98 3300046664 Ga0495659_0082645 Ga0495659_0082645_123_590 152
99 3300046674 Ga0495588_0038794 Ga0495588_0038794_663_1130 152
100 3300047472 Ga0495686_0002954 Ga0495686_0002954_3621_4079 152
101 3300047472 Ga0495686_0036937 Ga0495686_0036937_609_1067 152
102 3300048910 Ga0496107_0598012 Ga0496107_0598012_347_805 152
103 3300048911 Ga0496108_0260142 Ga0496108_0260142_896_1354 152
104 3300048912 Ga0496109_0079969 Ga0496109_0079969_2391_2849 152
105 3300048912 Ga0496109_0227885 Ga0496109_0227885_177_659 152
106 3300053122 Ga0500608_004047 Ga0500608_004047_1015_1473 152
107 3300053131 Ga0500652_218802 Ga0500652_218802_244_702 152
108 3300053142 Ga0500577_0000325 Ga0500577_0000325_9598_10065 152
109 3300003316 rootH1_10139342 rootH1_101393427 153
110 3300003323 rootH1_10238662 rootH1_102386622 153
111 3300003763 Ga0055529_1006788 Ga0055529_10067882 153
112 3300005331 Ga0070670_100030433 Ga0070670_1000304335 153
113 3300005353 Ga0070669_100344692 Ga0070669_1003446921 153
114 3300005367 Ga0070667_100112851 Ga0070667_1001128513 153
115 3300005367 Ga0070667_101971457 Ga0070667_1019714571 153
116 3300005563 Ga0068855_100122469 Ga0068855_1001224694 153
117 3300005577 Ga0068857_100171586 Ga0068857_1001715863 153
118 3300006237 Ga0097621_100008458 Ga0097621_1000084589 153
119 3300006358 Ga0068871_100009934 Ga0068871_1000099349 153
120 3300006881 Ga0068865_100017595 Ga0068865_1000175953 153
121 3300009093 Ga0105240_10047666 Ga0105240_100476664 153
122 3300009174 Ga0105241_10043008 Ga0105241_100430083 153
123 3300010375 Ga0105239_10004970 Ga0105239_1000497011 153
124 3300013102 Ga0157371_10425948 Ga0157371_104259482 153
125 3300013104 Ga0157370_10186302 Ga0157370_101863025 153
126 3300013297 Ga0157378_10505696 Ga0157378_105056962 153
127 3300014969 Ga0157376_10076615 Ga0157376_100766153 153
128 3300014969 Ga0157376_10129715 Ga0157376_101297152 153
129 3300015265 Ga0182005_1151527 Ga0182005_11515272 153
130 3300025250 Ga0209026_1028687 Ga0209026_10286872 153
131 3300025272 Ga0209455_1007318 Ga0209455_10073183 153
132 3300025914 Ga0207671_10197974 Ga0207671_101979742 153
133 3300025923 Ga0207681_10668087 Ga0207681_106680872 153
134 3300025925 Ga0207650_10372982 Ga0207650_103729822 153
135 3300025938 Ga0207704_10035978 Ga0207704_100359783 153
136 3300025986 Ga0207658_10098105 Ga0207658_100981053 153
137 3300026116 Ga0207674_10168572 Ga0207674_101685723 153
138 3300031507 Ga0307509_10463339 Ga0307509_104633392 153
139 3300031548 Ga0307408_100232156 Ga0307408_1002321562 153
140 3300031731 Ga0307405_10405107 Ga0307405_104051071 153
141 3300031824 Ga0307413_10074163 Ga0307413_100741632 153
142 3300031903 Ga0307407_10081387 Ga0307407_100813872 153
143 3300032002 Ga0307416_100115833 Ga0307416_1001158331 153
144 3300046462 Ga0495651_0052344 Ga0495651_0052344_1507_1968 153
145 3300046511 Ga0495608_0113697 Ga0495608_0113697_55_516 153
146 3300046529 Ga0495652_0070284 Ga0495652_0070284_2042_2503 153
147 3300046660 Ga0495625_0023180 Ga0495625_0023180_2825_3304 153
148 3300049652 Ga0501202_036809 Ga0501202_036809_292_759 153
149 3300049661 Ga0501217_138878 Ga0501217_138878_201_668 153
150 3300049685 Ga0501256_039675 Ga0501256_039675_15_485 153
151 3300049705 Ga0501225_0028503 Ga0501225_0028503_62_529 153
152 3300049765 Ga0501268_150276 Ga0501268_150276_55_525 153
153 3300001979 JGI24740J21852_10025489 JGI24740J21852_100254892 154
154 3300001990 JGI24737J22298_10002536 JGI24737J22298_100025366 154
155 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006282 154
156 3300003316 rootH1_10016978 rootH1_100169789 154
157 3300003323 rootH1_10022278 rootH1_100222785 154
158 3300003323 rootH1_10063468 rootH1_100634683 154
159 3300003323 rootH1_10228994 rootH1_102289942 154
160 3300005288 Ga0065714_10071629 Ga0065714_100716294 154
161 3300005289 Ga0065704_10113901 Ga0065704_101139012 154
162 3300005295 Ga0065707_10182253 Ga0065707_101822533 154
163 3300005330 Ga0070690_100592500 Ga0070690_1005925002 154
164 3300005333 Ga0070677_10001275 Ga0070677_100012756 154
165 3300005334 Ga0068869_100240589 Ga0068869_1002405892 154
166 3300005335 Ga0070666_10020724 Ga0070666_100207242 154
167 3300005335 Ga0070666_10075775 Ga0070666_100757753 154
168 3300005336 Ga0070680_100177489 Ga0070680_1001774893 154
169 3300005338 Ga0068868_100398237 Ga0068868_1003982372 154
170 3300005340 Ga0070689_100131623 Ga0070689_1001316232 154
171 3300005343 Ga0070687_100371152 Ga0070687_1003711522 154
172 3300005347 Ga0070668_100472967 Ga0070668_1004729672 154
173 3300005354 Ga0070675_100008568 Ga0070675_1000085683 154
174 3300005354 Ga0070675_100242499 Ga0070675_1002424993 154
175 3300005356 Ga0070674_100176923 Ga0070674_1001769232 154
176 3300005356 Ga0070674_101456189 Ga0070674_1014561892 154
177 3300005364 Ga0070673_100141058 Ga0070673_1001410583 154
178 3300005365 Ga0070688_100945222 Ga0070688_1009452221 154
179 3300005367 Ga0070667_100028993 Ga0070667_1000289934 154
180 3300005459 Ga0068867_100054455 Ga0068867_1000544553 154
181 3300005530 Ga0070679_100161869 Ga0070679_1001618693 154
182 3300005539 Ga0068853_100787891 Ga0068853_1007878912 154
183 3300005543 Ga0070672_100387325 Ga0070672_1003873252 154
184 3300005543 Ga0070672_100439175 Ga0070672_1004391752 154
185 3300005544 Ga0070686_100005833 Ga0070686_1000058337 154
186 3300005563 Ga0068855_100017500 Ga0068855_1000175006 154
187 3300005564 Ga0070664_100277522 Ga0070664_1002775222 154
188 3300005614 Ga0068856_100033652 Ga0068856_1000336526 154
189 3300005615 Ga0070702_100106968 Ga0070702_1001069683 154
190 3300005617 Ga0068859_100219556 Ga0068859_1002195564 154
191 3300005618 Ga0068864_100169911 Ga0068864_1001699114 154
192 3300005618 Ga0068864_101395499 Ga0068864_1013954992 154
193 3300005718 Ga0068866_10127097 Ga0068866_101270971 154
194 3300005718 Ga0068866_10807496 Ga0068866_108074961 154
195 3300005719 Ga0068861_100450067 Ga0068861_1004500672 154
196 3300005841 Ga0068863_100240476 Ga0068863_1002404762 154
197 3300005841 Ga0068863_101003403 Ga0068863_1010034032 154
198 3300005842 Ga0068858_100083183 Ga0068858_1000831836 154
199 3300005843 Ga0068860_100000052 Ga0068860_10000005216 154
200 3300005843 Ga0068860_100026233 Ga0068860_1000262332 154
201 3300005844 Ga0068862_100153314 Ga0068862_1001533143 154
202 3300005844 Ga0068862_100193918 Ga0068862_1001939183 154
203 3300006195 Ga0075366_10010302 Ga0075366_100103027 154
204 3300006237 Ga0097621_100065084 Ga0097621_1000650844 154
205 3300006358 Ga0068871_100106903 Ga0068871_1001069032 154
206 3300006844 Ga0075428_100075437 Ga0075428_1000754371 154
207 3300006847 Ga0075431_101686769 Ga0075431_1016867692 154
208 3300006931 Ga0097620_100219554 Ga0097620_1002195544 154
209 3300009092 Ga0105250_10357418 Ga0105250_103574182 154
210 3300009093 Ga0105240_10596115 Ga0105240_105961152 154
211 3300009101 Ga0105247_10124711 Ga0105247_101247113 154
212 3300009147 Ga0114129_11850880 Ga0114129_118508802 154
213 3300009176 Ga0105242_10723792 Ga0105242_107237922 154
214 3300009553 Ga0105249_10468184 Ga0105249_104681841 154
215 3300010375 Ga0105239_10021564 Ga0105239_100215647 154
216 3300010375 Ga0105239_10166309 Ga0105239_101663094 154
217 3300013102 Ga0157371_10015276 Ga0157371_100152765 154
218 3300013104 Ga0157370_10251191 Ga0157370_102511912 154
219 3300013105 Ga0157369_10202925 Ga0157369_102029254 154
220 3300013297 Ga0157378_10021350 Ga0157378_100213506 154
221 3300013297 Ga0157378_11688261 Ga0157378_116882612 154
222 3300013306 Ga0163162_10000428 Ga0163162_1000042813 154
223 3300013306 Ga0163162_10087172 Ga0163162_100871724 154
224 3300013306 Ga0163162_11496585 Ga0163162_114965851 154
225 3300013307 Ga0157372_10002755 Ga0157372_100027556 154
226 3300013308 Ga0157375_10157829 Ga0157375_101578292 154
227 3300014325 Ga0163163_10125336 Ga0163163_101253362 154
228 3300014326 Ga0157380_10126999 Ga0157380_101269992 154
229 3300014745 Ga0157377_10407024 Ga0157377_104070242 154
230 3300014968 Ga0157379_10401793 Ga0157379_104017932 154
231 3300014969 Ga0157376_10751730 Ga0157376_107517302 154
232 3300017792 Ga0163161_10125275 Ga0163161_101252752 154
233 3300017792 Ga0163161_10215281 Ga0163161_102152813 154
234 3300025893 Ga0207682_10090490 Ga0207682_100904901 154
235 3300025899 Ga0207642_10101223 Ga0207642_101012233 154
236 3300025900 Ga0207710_10012068 Ga0207710_100120682 154
237 3300025903 Ga0207680_10027560 Ga0207680_100275602 154
238 3300025903 Ga0207680_10079837 Ga0207680_100798371 154
239 3300025904 Ga0207647_10067610 Ga0207647_100676103 154
240 3300025905 Ga0207685_10442939 Ga0207685_104429391 154
241 3300025908 Ga0207643_10520510 Ga0207643_105205102 154
242 3300025913 Ga0207695_10641062 Ga0207695_106410622 154
243 3300025917 Ga0207660_10869188 Ga0207660_108691881 154
244 3300025921 Ga0207652_10153554 Ga0207652_101535542 154
245 3300025926 Ga0207659_10048928 Ga0207659_100489282 154
246 3300025926 Ga0207659_10160080 Ga0207659_101600802 154
247 3300025931 Ga0207644_10083784 Ga0207644_100837842 154
248 3300025934 Ga0207686_10561783 Ga0207686_105617832 154
249 3300025936 Ga0207670_10146851 Ga0207670_101468512 154
250 3300025938 Ga0207704_10915036 Ga0207704_109150361 154
251 3300025940 Ga0207691_10001692 Ga0207691_1000169213 154
252 3300025940 Ga0207691_11419016 Ga0207691_114190162 154
253 3300025942 Ga0207689_10254676 Ga0207689_102546761 154
254 3300025942 Ga0207689_10255926 Ga0207689_102559262 154
255 3300025972 Ga0207668_10367075 Ga0207668_103670752 154
256 3300025981 Ga0207640_11261574 Ga0207640_112615741 154
257 3300025986 Ga0207658_10115532 Ga0207658_101155322 154
258 3300026023 Ga0207677_10400790 Ga0207677_104007902 154
259 3300026035 Ga0207703_10034672 Ga0207703_100346722 154
260 3300026041 Ga0207639_10322405 Ga0207639_103224051 154
261 3300026078 Ga0207702_10191832 Ga0207702_101918322 154
262 3300026088 Ga0207641_10207976 Ga0207641_102079763 154
263 3300026088 Ga0207641_10220741 Ga0207641_102207412 154
264 3300026089 Ga0207648_10026621 Ga0207648_100266215 154
265 3300026142 Ga0207698_10292452 Ga0207698_102924523 154
266 3300028380 Ga0268265_10530715 Ga0268265_105307152 154
267 3300028381 Ga0268264_10000831 Ga0268264_1000083111 154
268 3300028381 Ga0268264_10494977 Ga0268264_104949772 154
269 3300031456 Ga0307513_10379340 Ga0307513_103793402 154
270 3300031711 Ga0265314_10147196 Ga0265314_101471962 154
271 3300035115 Ga0373941_0003470 Ga0373941_0003470_985_1452 154
272 3300037068 Ga0373925_0658973 Ga0373925_0658973_163_627 154
273 3300041503 Ga0451847_0172560 Ga0451847_0172560_149_616 154
274 3300046460 Ga0495638_0000026 Ga0495638_0000026_71191_71664 154
275 3300046471 Ga0495650_0000132 Ga0495650_0000132_24487_24951 154
276 3300046507 Ga0495606_0000100 Ga0495606_0000100_19109_19579 154
277 3300046512 Ga0495610_0002138 Ga0495610_0002138_14459_14932 154
278 3300046512 Ga0495610_0117828 Ga0495610_0117828_315_779 154
279 3300046513 Ga0495616_0023549 Ga0495616_0023549_2692_3165 154
280 3300046538 Ga0495609_0065756 Ga0495609_0065756_789_1253 154
281 3300046558 Ga0495633_0000583 Ga0495633_0000583_13739_14212 154
282 3300046660 Ga0495625_0000036 Ga0495625_0000036_143442_143915 154
283 3300046660 Ga0495625_0020137 Ga0495625_0020137_1989_2453 154
284 3300046665 Ga0495661_0004241 Ga0495661_0004241_3370_3843 154
285 3300046665 Ga0495661_0047622 Ga0495661_0047622_1852_2325 154
286 3300046694 Ga0495649_0000017 Ga0495649_0000017_77801_78274 154
287 3300047318 Ga0495636_0000086 Ga0495636_0000086_2486_2959 154
288 3300047320 Ga0495672_0101849 Ga0495672_0101849_945_1409 154
289 3300047443 Ga0495687_000422 Ga0495687_000422_20983_21450 154
290 3300047446 Ga0495679_051708 Ga0495679_051708_654_1127 154
291 3300047469 Ga0495673_0040617 Ga0495673_0040617_1520_1993 154
292 3300047472 Ga0495686_0032338 Ga0495686_0032338_709_1173 154
293 3300048907 Ga0496104_1669589 Ga0496104_1669589_17_502 154
294 3300048917 Ga0496114_0020045 Ga0496114_0020045_4127_4612 154
295 3300049459 Ga0495678_021541 Ga0495678_021541_535_1008 154
296 3300050493 nmdc:mga0k408_959_c1 nmdc:mga0k408_959_c1_4908_5381 154
297 3300053129 Ga0500628_047797 Ga0500628_047797_61_531 154
298 3300053153 Ga0500616_0000004 Ga0500616_0000004_163644_164117 154
299 3300053156 Ga0500622_0009608 Ga0500622_0009608_2951_3418 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

29

158

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9094 12 146
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9058 5 150
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9009 5 153
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8972 9 154
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.8966 11 146
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9074 12 146 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9058 5 150 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.901 11 148 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8809 5 152 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8774 5 151 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7D4PX47-F1-model_v4 SRPBCC domain-containing protein 0.9882 5 150
AF-A0A329N0P9-F1-model_v4 Polyketide cyclase 0.9823 10 153
AF-A0A2V6QP18-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9815 9 154
AF-A0A1H0XCZ7-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9805 5 150
AF-A0A2V6QNA5-F1-model_v4 ATPase 0.9766 8 154

Feature Viewer

pLDDT pTM Quality
91.11 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map