F394635

General Info

Members Datasets Scaffolds Average Seq Length
299 191 287 240

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000515|Ga0055530_1000051531
Length 255
Sequence VRPWIPAFAGMTGPRPIIRDMIRVLLVDDDPELRSLVSDYLSRYRMQVTTVPDGAGLRHALANAGSPPAFDVLLLDLMLPDANGLDLCRVVRQTSSLPIVMLTAQGDPASRVVGLELGADDYLPKPFEPRELVARINAVLRRTGSAPAAASAEAPVRRFNGWTFDRVRRQLTSPDHVMLALSSAEFRLLSAFVDHPRRVLSRERLLELTRVPGVDSTDRAIDLAISRLRQKLADPSLIRTVRGEGYAFEIDPPAP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
9 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
10 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
122 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
123 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
124 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
125 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
126 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
127 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
130 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
131 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
179 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
180 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
190 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
191 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.44
Nodule 1.34
Rhizoplane 1.34
Rhizosphere 46.49
Stem 0
Stem Tuber 0
Unclassified 17.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000683 3300002773 Bacteria 17690
2 JGI25153J46596_10000448 3300003215 Bacteria 26516
3 rootH1_10028624 3300003316 Bacteria 1301
4 rootH1_10028624 3300003323 Bacteria 5060
5 rootH1_10094680 3300003323 Bacteria 5648
6 Ga0055526_1001528 3300003771 Bacteria 16371
7 Ga0055524_1000121 3300003775 Bacteria 91150
8 Ga0055524_1000183 3300003775 Bacteria 70460
9 Ga0055530_10000515 3300003791 Bacteria 33601
10 Ga0055540_1000001 3300003792 Bacteria 466834
11 Ga0065165_1001455 3300005262 Bacteria 25574
12 Ga0070676_10008197 3300005328 Bacteria 5623
13 Ga0070676_10262530 3300005328 Bacteria 1157
14 Ga0070690_100076842 3300005330 Bacteria 2179
15 Ga0070670_100051664 3300005331 Bacteria 3529
16 Ga0070670_100104517 3300005331 Bacteria 2440
17 Ga0068869_100030886 3300005334 Bacteria 3765
18 Ga0068868_100102899 3300005338 Bacteria 2313
19 Ga0068868_100147747 3300005338 Bacteria 1934
20 Ga0070669_100001399 3300005353 Bacteria 17423
21 Ga0070675_100125403 3300005354 Bacteria 2184
22 Ga0070675_100205420 3300005354 Bacteria 1711
23 Ga0070671_100087131 3300005355 Bacteria 2613
24 Ga0070673_100223917 3300005364 Bacteria 1629
25 Ga0070667_100007921 3300005367 Bacteria 8812
26 Ga0070711_100264491 3300005439 Bacteria 1355
27 Ga0070663_100093166 3300005455 Bacteria 2235
28 Ga0070662_100065908 3300005457 Bacteria 2656
29 Ga0068867_100000041 3300005459 Bacteria 78472
30 Ga0068867_100004166 3300005459 Bacteria 10173
31 Ga0070706_100013486 3300005467 Bacteria 7560
32 Ga0070699_100474980 3300005518 Bacteria 1134
33 Ga0070699_100720224 3300005518 Bacteria 912
34 Ga0068853_100208010 3300005539 Bacteria 1783
35 Ga0070672_100168400 3300005543 Bacteria 1821
36 Ga0070665_100678840 3300005548 Bacteria 1043
37 Ga0068857_100019445 3300005577 Bacteria 5964
38 Ga0068857_100079907 3300005577 Bacteria 2919
39 Ga0068857_100592150 3300005577 Bacteria 1048
40 Ga0068866_10125774 3300005718 Bacteria 1451
41 Ga0075368_10001225 3300006042 Bacteria 8111
42 Ga0075368_10014616 3300006042 Bacteria 2902
43 Ga0075368_10029754 3300006042 Bacteria 2112
44 Ga0075368_10081044 3300006042 Bacteria 1321
45 Ga0075363_100020312 3300006048 Bacteria 3330
46 Ga0075364_10023342 3300006051 Bacteria 3917
47 Ga0075364_10208924 3300006051 Bacteria 1324
48 Ga0075364_10251508 3300006051 Bacteria 1201
49 Ga0075362_10000336 3300006177 Bacteria 13409
50 Ga0075362_10020704 3300006177 Bacteria 2751
51 Ga0075362_10027479 3300006177 Bacteria 2437
52 Ga0075362_10108984 3300006177 Bacteria 1302
53 Ga0075367_10012713 3300006178 Bacteria 4502
54 Ga0075367_10016034 3300006178 Bacteria 4085
55 Ga0075367_10016664 3300006178 Bacteria 4016
56 Ga0075367_10043485 3300006178 Bacteria 2631
57 Ga0075369_10006987 3300006186 Bacteria 4285
58 Ga0075369_10017589 3300006186 Bacteria 2900
59 Ga0075366_10006587 3300006195 Bacteria 6374
60 Ga0075366_10052976 3300006195 Bacteria 2410
61 Ga0075366_10062895 3300006195 Bacteria 2206
62 Ga0075366_10067875 3300006195 Bacteria 2122
63 Ga0075366_10132443 3300006195 Bacteria 1505
64 Ga0075370_10001494 3300006353 Bacteria 10200
65 Ga0075370_10002042 3300006353 Bacteria 9165
66 Ga0075370_10006778 3300006353 Bacteria 5789
67 Ga0068871_100521247 3300006358 Bacteria 1073
68 Ga0068865_100114114 3300006881 Bacteria 1998
69 Ga0079104_1000001 3300006946 Bacteria 521847
70 Ga0079104_1000273 3300006946 Bacteria 67267
71 Ga0105240_10384797 3300009093 Bacteria 1583
72 Ga0105245_10389220 3300009098 Bacteria 1390
73 Ga0105243_10001818 3300009148 Bacteria 18256
74 Ga0105243_10749200 3300009148 Bacteria 957
75 Ga0105237_10031289 3300009545 Bacteria 5397
76 Ga0105239_10035743 3300010375 Bacteria 5455
77 Ga0163162_10007560 3300013306 Bacteria 10585
78 Ga0157375_10017007 3300013308 Bacteria 6551
79 Ga0157375_10095842 3300013308 Bacteria 3039
80 Ga0157377_10000020 3300014745 Bacteria 151620
81 Ga0157377_10115018 3300014745 Bacteria 1622
82 Ga0157379_10082637 3300014968 Bacteria 2878
83 Ga0157379_10530755 3300014968 Bacteria 1093
84 Ga0207425_1000619 3300025245 Bacteria 20305
85 Ga0209129_1000062 3300025258 Bacteria 240655
86 Ga0209565_1015322 3300025263 Bacteria 1732
87 Ga0209673_1016242 3300025273 Bacteria 2793
88 Ga0209675_1005977 3300025291 Bacteria 4981
89 Ga0209675_1007412 3300025291 Bacteria 4212
90 Ga0209564_1000176 3300025295 Bacteria 152363
91 Ga0209758_1000126 3300025297 Bacteria 189761
92 Ga0209758_1000129 3300025297 Bacteria 185022
93 Ga0209050_1000118 3300025298 Bacteria 202586
94 Ga0209050_1001522 3300025298 Bacteria 24440
95 Ga0209050_1013629 3300025298 Bacteria 3591
96 Ga0209050_1015703 3300025298 Bacteria 3158
97 Ga0209256_1000015 3300025299 Bacteria 622953
98 Ga0209256_1000024 3300025299 Bacteria 448909
99 Ga0209051_1000018 3300025303 Bacteria 527061
100 Ga0209051_1020149 3300025303 Bacteria 2884
101 Ga0209257_1000084 3300025304 Bacteria 291502
102 Ga0209257_1008423 3300025304 Bacteria 5867
103 Ga0209257_1026869 3300025304 Bacteria 1929
104 Ga0207645_10008045 3300025907 Bacteria 7397
105 Ga0207645_10233902 3300025907 Bacteria 1213
106 Ga0207684_10003915 3300025910 Bacteria 14258
107 Ga0207663_10333973 3300025916 Bacteria 1143
108 Ga0207681_10003705 3300025923 Bacteria 9497
109 Ga0207650_10028138 3300025925 Bacteria 4028
110 Ga0207659_10409768 3300025926 Bacteria 1135
111 Ga0207644_10216844 3300025931 Bacteria 1515
112 Ga0207709_10003945 3300025935 Bacteria 8661
113 Ga0207691_10162835 3300025940 Bacteria 1956
114 Ga0207689_10063053 3300025942 Bacteria 3049
115 Ga0207651_10201910 3300025960 Bacteria 1594
116 Ga0207651_10220053 3300025960 Bacteria 1534
117 Ga0207658_10001854 3300025986 Bacteria 15830
118 Ga0207678_10019577 3300026067 Bacteria 5949
119 Ga0207648_10000026 3300026089 Bacteria 131314
120 Ga0207648_10002295 3300026089 Bacteria 20666
121 Ga0207648_10585612 3300026089 Bacteria 1027
122 Ga0207674_10013266 3300026116 Bacteria 9152
123 Ga0207674_10013681 3300026116 Bacteria 8989
124 Ga0207674_10558029 3300026116 Bacteria 1106
125 Ga0207675_100424442 3300026118 Bacteria 1314
126 Ga0207698_10004876 3300026142 Bacteria 8225
127 Ga0209281_1000151 3300027111 Bacteria 167268
128 Ga0209281_1000416 3300027111 Bacteria 64290
129 Ga0209813_10015590 3300027866 Bacteria 2062
130 Ga0209813_10021601 3300027866 Bacteria 1811
131 Ga0307517_10000174 3300028786 Bacteria 105578
132 Ga0307517_10101508 3300028786 Bacteria 2264
133 Ga0307517_10157341 3300028786 Bacteria 1537
134 Ga0307515_10001235 3300028794 Bacteria 58313
135 Ga0307515_10002229 3300028794 Bacteria 42507
136 Ga0307515_10004451 3300028794 Bacteria 29009
137 Ga0307515_10026743 3300028794 Bacteria 9909
138 Ga0307515_10069756 3300028794 Bacteria 4796
139 Ga0307512_10077429 3300030522 Bacteria 2416
140 Ga0307513_10001087 3300031456 Bacteria 39457
141 Ga0307513_10021443 3300031456 Bacteria 7626
142 Ga0307513_10115644 3300031456 Bacteria 2664
143 Ga0307513_10140439 3300031456 Bacteria 2343
144 Ga0307513_10209287 3300031456 Bacteria 1783
145 Ga0307509_10000225 3300031507 Bacteria 90913
146 Ga0307509_10003816 3300031507 Bacteria 22337
147 Ga0307509_10053865 3300031507 Bacteria 4286
148 Ga0307509_10306762 3300031507 Bacteria 1332
149 Ga0307408_100249055 3300031548 Bacteria 1464
150 Ga0307508_10000185 3300031616 Bacteria 75407
151 Ga0307508_10002202 3300031616 Bacteria 20788
152 Ga0307508_10003035 3300031616 Bacteria 17286
153 Ga0307514_10027208 3300031649 Bacteria 4620
154 Ga0307514_10113350 3300031649 Bacteria 1914
155 Ga0307514_10127369 3300031649 Bacteria 1761
156 Ga0307514_10154486 3300031649 Bacteria 1533
157 Ga0316575_10000291 3300031665 Bacteria 13928
158 Ga0307516_10001572 3300031730 Bacteria 31438
159 Ga0307516_10112120 3300031730 Bacteria 2528
160 Ga0307516_10193180 3300031730 Bacteria 1760
161 Ga0307516_10235902 3300031730 Bacteria 1530
162 Ga0307518_10375791 3300031838 Bacteria 810
163 Ga0307507_10041125 3300033179 Bacteria 4632
164 Ga0307507_10062731 3300033179 Bacteria 3448
165 Ga0307510_10002036 3300033180 Bacteria 22846
166 Ga0307510_10027956 3300033180 Bacteria 6449
167 Ga0307510_10177002 3300033180 Bacteria 1702
168 Ga0373930_0031514 3300034816 Bacteria 1093
169 Ga0373948_0045973 3300034817 Bacteria 926
170 Ga0373950_0006341 3300034818 Bacteria 1800
171 Ga0373958_0025123 3300034819 Bacteria 1132
172 Ga0373940_0005399 3300035088 Bacteria 2767
173 Ga0373951_0035703 3300035091 Bacteria 1184
174 Ga0373939_0000051 3300035114 Bacteria 41440
175 Ga0373939_0039450 3300035114 Bacteria 1413
176 Ga0373960_0002130 3300035121 Bacteria 4460
177 Ga0373931_0000141 3300035691 Bacteria 32173
178 Ga0373931_0006490 3300035691 Bacteria 5467
179 Ga0316582_0281180 3300036647 Bacteria 1142
180 Ga0373925_0016935 3300037068 Bacteria 5276
181 Ga0395905_0029897 3300037471 Bacteria 5135
182 Ga0436365_0560401 3300039437 Bacteria 2220
183 Ga0451833_0960283 3300041491 Bacteria 1678
184 Ga0451839_1431364 3300041496 Bacteria 1332
185 Ga0439437_000279 3300042000 Bacteria 4693
186 Ga0450913_000306 3300042117 Bacteria 1877
187 Ga0450919_000225 3300042121 Bacteria 6300
188 Ga0450888_000426 3300042126 Bacteria 3974
189 Ga0450890_001153 3300042127 Bacteria 3822
190 Ga0450891_002011 3300042129 Bacteria 2081
191 Ga0450889_000410 3300042144 Bacteria 4783
192 Ga0439434_0011422 3300042435 Bacteria 2626
193 Ga0450916_001412 3300042530 Bacteria 2398
194 Ga0450918_000006 3300042531 Bacteria 48279
195 Ga0450893_0001363 3300042532 Bacteria 3714
196 Ga0453684_0000015 3300044712 Bacteria 969198
197 Ga0453684_0000020 3300044712 Bacteria 879938
198 Ga0451576_0118473 3300045051 Bacteria 2756
199 Ga0495592_0001312 3300046454 Bacteria 17260
200 Ga0495629_0392526 3300046459 Bacteria 944
201 Ga0495638_0119564 3300046460 Bacteria 1558
202 Ga0495580_0042841 3300046472 Bacteria 3223
203 Ga0495605_0036110 3300046474 Bacteria 2494
204 Ga0495594_0071807 3300046499 Bacteria 1925
205 Ga0495610_0009884 3300046512 Bacteria 5972
206 Ga0495610_0093629 3300046512 Bacteria 1357
207 Ga0495616_0114686 3300046513 Bacteria 1249
208 Ga0495620_0027490 3300046515 Bacteria 2661
209 Ga0495628_0269551 3300046516 Bacteria 1267
210 Ga0495632_0004601 3300046519 Bacteria 9343
211 Ga0495632_0011043 3300046519 Bacteria 5292
212 Ga0495632_0013871 3300046519 Bacteria 4580
213 Ga0495632_0123535 3300046519 Bacteria 1208
214 Ga0495643_0085495 3300046522 Bacteria 1635
215 Ga0495666_0019510 3300046526 Bacteria 3363
216 Ga0495666_0170670 3300046526 Bacteria 1006
217 Ga0495597_0033794 3300046542 Bacteria 2313
218 Ga0495597_0099703 3300046542 Bacteria 1226
219 Ga0495611_0215807 3300046648 Bacteria 893
220 Ga0495625_0016651 3300046660 Bacteria 5775
221 Ga0495625_0023849 3300046660 Bacteria 4668
222 Ga0495647_0115723 3300046681 Bacteria 1123
223 Ga0495658_0174282 3300046683 Bacteria 1332
224 Ga0495624_0112982 3300046690 Bacteria 1670
225 Ga0495649_0002120 3300046694 Bacteria 14224
226 Ga0495649_0176105 3300046694 Bacteria 1118
227 Ga0495660_0023911 3300046810 Bacteria 3482
228 Ga0495604_0142712 3300047317 Bacteria 1709
229 Ga0495676_0176071 3300047321 Bacteria 1502
230 Ga0495687_001305 3300047443 Bacteria 23391
231 Ga0495687_011528 3300047443 Bacteria 4744
232 Ga0495686_0034912 3300047472 Bacteria 3235
233 Ga0495686_0082711 3300047472 Bacteria 1959
234 Ga0495593_0065482 3300047673 Bacteria 1895
235 Ga0495626_0129575 3300048091 Bacteria 1078
236 Ga0496102_0031335 3300048905 Bacteria 4769
237 Ga0496104_0404186 3300048907 Bacteria 1278
238 Ga0496114_0004522 3300048917 Bacteria 10794
239 Ga0496114_0047713 3300048917 Bacteria 3562
240 Ga0496116_0000215 3300048919 Bacteria 109085
241 Ga0496116_0063405 3300048919 Bacteria 2381
242 Ga0496121_0000198 3300048924 Bacteria 134224
243 Ga0495682_0052849 3300049460 Bacteria 1476
244 nmdc:mga03683_101276_c1 3300050489 Bacteria 1266
245 nmdc:mga03683_71349_c1 3300050489 Bacteria 1485
246 nmdc:mga03n38_15292_c1 3300050490 Bacteria 2960
247 nmdc:mga03n38_2718_c1 3300050490 Bacteria 5534
248 nmdc:mga00v17_153027_c1 3300050491 Bacteria 1482
249 nmdc:mga00v17_61901_c1 3300050491 Bacteria 2301
250 nmdc:mga0yw44_97892_c1 3300050492 Bacteria 1864
251 nmdc:mga0k408_10190_c1 3300050493 Bacteria 5081
252 nmdc:mga0k408_216498_c1 3300050493 Bacteria 1144
253 nmdc:mga0k408_275877_c1 3300050493 Bacteria 1004
254 nmdc:mga0k408_301041_c1 3300050493 Bacteria 957
255 nmdc:mga0k408_30374_c1 3300050493 Bacteria 3081
256 nmdc:mga0k408_34223_c1 3300050493 Bacteria 2908
257 nmdc:mga0k408_4585_c1 3300050493 Bacteria 7332
258 nmdc:mga0k408_51176_c1 3300050493 Bacteria 2393
259 nmdc:mga0k408_7127_c1 3300050493 Bacteria 2602
260 nmdc:mga0k408_80622_c1 3300050493 Bacteria 1905
261 nmdc:mga0k408_93119_c1 3300050493 Bacteria 1772
262 nmdc:mga06z11_22404_c1 3300050494 Bacteria 2950
263 nmdc:mga07m45_1253_c1 3300050496 Bacteria 11546
264 nmdc:mga07m45_14379_c1 3300050496 Bacteria 4215
265 nmdc:mga07m45_144263_c1 3300050496 Bacteria 1380
266 nmdc:mga07m45_1902_c1 3300050496 Bacteria 9628
267 nmdc:mga07m45_32138_c1 3300050496 Bacteria 2911
268 nmdc:mga07m45_748_c1 3300050496 Bacteria 13891
269 nmdc:mga07m45_82020_c1 3300050496 Bacteria 1841
270 nmdc:mga0sz30_47240_c1 3300050516 Bacteria 1819
271 Ga0500578_0000079 3300053086 Bacteria 107137
272 Ga0500644_0092830 3300053088 Bacteria 1133
273 Ga0500651_0029691 3300053093 Bacteria 3439
274 Ga0500594_0000517 3300053118 Bacteria 8374
275 Ga0500607_119971 3300053121 Bacteria 1274
276 Ga0500623_065290 3300053127 Bacteria 1783
277 Ga0500652_000624 3300053131 Bacteria 12146
278 Ga0500655_002479 3300053133 Bacteria 3362
279 Ga0500658_0043805 3300053134 Bacteria 1803
280 Ga0500559_0000329 3300053136 Bacteria 35808
281 Ga0500564_131070 3300053138 Bacteria 1085
282 Ga0500568_0034126 3300053139 Bacteria 2083
283 Ga0500568_0049439 3300053139 Bacteria 1659
284 Ga0500622_0000053 3300053156 Bacteria 145070
285 Ga0500627_0231553 3300053158 Bacteria 822
286 Ga0500570_068147 3300053724 Bacteria 1677
287 Ga0500587_000776 3300053739 Bacteria 4138

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10333973 Ga0207663_103339732 191
2 3300050489 nmdc:mga03683_71349_c1 nmdc:mga03683_71349_c1_879_1475 195
3 3300048919 Ga0496116_0000215 Ga0496116_0000215_100861_101637 207
4 3300048924 Ga0496121_0000198 Ga0496121_0000198_33082_33858 207
5 3300046681 Ga0495647_0115723 Ga0495647_0115723_447_1106 208
6 3300053158 Ga0500627_0231553 Ga0500627_0231553_174_812 209
7 3300048907 Ga0496104_0404186 Ga0496104_0404186_11_673 212
8 3300044712 Ga0453684_0000020 Ga0453684_0000020_523127_523819 218
9 3300028794 Ga0307515_10026743 Ga0307515_100267433 219
10 3300044712 Ga0453684_0000015 Ga0453684_0000015_499485_500180 219
11 3300046542 Ga0495597_0033794 Ga0495597_0033794_254_1000 221
12 3300047443 Ga0495687_001305 Ga0495687_001305_19530_20276 221
13 3300048091 Ga0495626_0129575 Ga0495626_0129575_284_1030 221
14 3300048919 Ga0496116_0063405 Ga0496116_0063405_1077_1799 223
15 3300031665 Ga0316575_10000291 Ga0316575_1000029113 224
16 iso_pu_bacteria 2643221544 2643743355 224
17 3300005518 Ga0070699_100720224 Ga0070699_1007202242 225
18 3300036647 Ga0316582_0281180 Ga0316582_0281180_128_841 225
19 iso_pu_bacteria 2643221644 2644246504 225
20 iso_pu_bacteria 2643221585 2643932633 226
21 iso_pu_bacteria 2643221656 2644313883 226
22 iso_pu_bacteria 639633007 639788781 226
23 3300003775 Ga0055524_1000183 Ga0055524_100018318 227
24 3300005331 Ga0070670_100051664 Ga0070670_1000516643 227
25 3300005353 Ga0070669_100001399 Ga0070669_10000139910 227
26 3300005439 Ga0070711_100264491 Ga0070711_1002644912 227
27 3300005548 Ga0070665_100678840 Ga0070665_1006788401 227
28 3300006946 Ga0079104_1000273 Ga0079104_100027336 227
29 3300013306 Ga0163162_10007560 Ga0163162_1000756010 227
30 3300013308 Ga0157375_10017007 Ga0157375_100170079 227
31 3300025291 Ga0209675_1005977 Ga0209675_10059773 227
32 3300025298 Ga0209050_1013629 Ga0209050_10136292 227
33 3300025299 Ga0209256_1000024 Ga0209256_100002455 227
34 3300025923 Ga0207681_10003705 Ga0207681_100037052 227
35 3300027111 Ga0209281_1000416 Ga0209281_100041631 227
36 3300028786 Ga0307517_10157341 Ga0307517_101573412 227
37 3300031456 Ga0307513_10115644 Ga0307513_101156443 227
38 3300034817 Ga0373948_0045973 Ga0373948_0045973_103_807 227
39 3300034818 Ga0373950_0006341 Ga0373950_0006341_49_753 227
40 3300034819 Ga0373958_0025123 Ga0373958_0025123_122_826 227
41 3300035088 Ga0373940_0005399 Ga0373940_0005399_977_1681 227
42 3300035091 Ga0373951_0035703 Ga0373951_0035703_296_1000 227
43 3300035114 Ga0373939_0000051 Ga0373939_0000051_13320_14024 227
44 3300035121 Ga0373960_0002130 Ga0373960_0002130_1857_2561 227
45 3300035691 Ga0373931_0000141 Ga0373931_0000141_5479_6183 227
46 3300046472 Ga0495580_0042841 Ga0495580_0042841_639_1373 227
47 3300046499 Ga0495594_0071807 Ga0495594_0071807_512_1246 227
48 3300046526 Ga0495666_0019510 Ga0495666_0019510_2040_2774 227
49 3300047317 Ga0495604_0142712 Ga0495604_0142712_170_904 227
50 3300048917 Ga0496114_0004522 Ga0496114_0004522_2801_3523 227
51 3300050496 nmdc:mga07m45_82020_c1 nmdc:mga07m45_82020_c1_863_1600 227
52 3300003316 rootH1_10028624 rootH1_100286242 228
53 3300003323 rootH1_10094680 rootH1_100946804 228
54 3300005459 Ga0068867_100000041 Ga0068867_10000004129 228
55 3300009148 Ga0105243_10001818 Ga0105243_1000181813 228
56 3300014745 Ga0157377_10000020 Ga0157377_1000002066 228
57 3300025935 Ga0207709_10003945 Ga0207709_100039454 228
58 3300026089 Ga0207648_10000026 Ga0207648_1000002676 228
59 3300026142 Ga0207698_10004876 Ga0207698_100048763 228
60 3300031507 Ga0307509_10306762 Ga0307509_103067622 228
61 3300037471 Ga0395905_0029897 Ga0395905_0029897_1257_2003 228
62 3300042000 Ga0439437_000279 Ga0439437_000279_3517_4227 228
63 3300042117 Ga0450913_000306 Ga0450913_000306_486_1196 228
64 3300042126 Ga0450888_000426 Ga0450888_000426_1304_2014 228
65 3300042127 Ga0450890_001153 Ga0450890_001153_193_903 228
66 3300042129 Ga0450891_002011 Ga0450891_002011_467_1177 228
67 3300042144 Ga0450889_000410 Ga0450889_000410_3773_4483 228
68 3300042530 Ga0450916_001412 Ga0450916_001412_997_1707 228
69 3300042532 Ga0450893_0001363 Ga0450893_0001363_2853_3563 228
70 3300050493 nmdc:mga0k408_301041_c1 nmdc:mga0k408_301041_c1_157_864 228
71 3300005367 Ga0070667_100007921 Ga0070667_1000079214 229
72 3300006195 Ga0075366_10006587 Ga0075366_100065876 229
73 3300006358 Ga0068871_100521247 Ga0068871_1005212472 229
74 3300006881 Ga0068865_100114114 Ga0068865_1001141142 229
75 3300014968 Ga0157379_10082637 Ga0157379_100826374 229
76 3300025304 Ga0209257_1008423 Ga0209257_10084234 229
77 3300025986 Ga0207658_10001854 Ga0207658_1000185410 229
78 3300028786 Ga0307517_10101508 Ga0307517_101015083 229
79 3300028794 Ga0307515_10069756 Ga0307515_100697565 229
80 3300031456 Ga0307513_10001087 Ga0307513_1000108732 229
81 3300031456 Ga0307513_10209287 Ga0307513_102092873 229
82 3300031548 Ga0307408_100249055 Ga0307408_1002490552 229
83 3300037068 Ga0373925_0016935 Ga0373925_0016935_4126_4839 229
84 3300039437 Ga0436365_0560401 Ga0436365_0560401_125_850 229
85 3300042121 Ga0450919_000225 Ga0450919_000225_3026_3724 229
86 3300042435 Ga0439434_0011422 Ga0439434_0011422_1481_2179 229
87 3300042531 Ga0450918_000006 Ga0450918_000006_30604_31302 229
88 3300045051 Ga0451576_0118473 Ga0451576_0118473_1274_1987 229
89 3300046694 Ga0495649_0176105 Ga0495649_0176105_123_881 229
90 3300047472 Ga0495686_0034912 Ga0495686_0034912_33_758 229
91 3300050493 nmdc:mga0k408_7127_c1 nmdc:mga0k408_7127_c1_1590_2300 229
92 iso_pu_bacteria 2585428062 2587759977 229
93 iso_pu_bacteria 2808606373 2808903937 229
94 3300005718 Ga0068866_10125774 Ga0068866_101257742 230
95 3300025304 Ga0209257_1026869 Ga0209257_10268692 230
96 3300026118 Ga0207675_100424442 Ga0207675_1004244421 230
97 iso_pu_bacteria 2585428057 2587728137 230
98 iso_pu_bacteria 2585428058 2587731195 230
99 iso_pu_bacteria 2588253510 2588289948 230
100 iso_pu_bacteria 2643221592 2643972262 230
101 iso_pu_bacteria 2643221625 2644141627 230
102 iso_pu_bacteria 2643221648 2644275602 230
103 3300003791 Ga0055530_10000515 Ga0055530_1000051531 231
104 3300003792 Ga0055540_1000001 Ga0055540_1000001303 231
105 3300025298 Ga0209050_1001522 Ga0209050_10015224 231
106 3300025303 Ga0209051_1000018 Ga0209051_1000018150 231
107 3300025304 Ga0209257_1000084 Ga0209257_1000084222 231
108 3300003775 Ga0055524_1000121 Ga0055524_100012157 232
109 3300006946 Ga0079104_1000001 Ga0079104_1000001464 232
110 3300025291 Ga0209675_1007412 Ga0209675_10074124 232
111 3300025298 Ga0209050_1015703 Ga0209050_10157034 232
112 3300025299 Ga0209256_1000015 Ga0209256_1000015549 232
113 3300027111 Ga0209281_1000151 Ga0209281_1000151146 232
114 3300048917 Ga0496114_0047713 Ga0496114_0047713_2840_3550 232
115 3300005328 Ga0070676_10008197 Ga0070676_100081975 233
116 3300005330 Ga0070690_100076842 Ga0070690_1000768422 233
117 3300005331 Ga0070670_100104517 Ga0070670_1001045172 233
118 3300005334 Ga0068869_100030886 Ga0068869_1000308862 233
119 3300005338 Ga0068868_100147747 Ga0068868_1001477472 233
120 3300005354 Ga0070675_100205420 Ga0070675_1002054201 233
121 3300005355 Ga0070671_100087131 Ga0070671_1000871313 233
122 3300005457 Ga0070662_100065908 Ga0070662_1000659084 233
123 3300005459 Ga0068867_100004166 Ga0068867_1000041665 233
124 3300005543 Ga0070672_100168400 Ga0070672_1001684003 233
125 3300005577 Ga0068857_100079907 Ga0068857_1000799072 233
126 3300009098 Ga0105245_10389220 Ga0105245_103892202 233
127 3300013308 Ga0157375_10095842 Ga0157375_100958424 233
128 3300014745 Ga0157377_10115018 Ga0157377_101150182 233
129 3300014968 Ga0157379_10530755 Ga0157379_105307552 233
130 3300025907 Ga0207645_10008045 Ga0207645_100080455 233
131 3300025925 Ga0207650_10028138 Ga0207650_100281382 233
132 3300025926 Ga0207659_10409768 Ga0207659_104097682 233
133 3300025931 Ga0207644_10216844 Ga0207644_102168442 233
134 3300025940 Ga0207691_10162835 Ga0207691_101628353 233
135 3300025942 Ga0207689_10063053 Ga0207689_100630533 233
136 3300025960 Ga0207651_10220053 Ga0207651_102200532 233
137 3300026089 Ga0207648_10002295 Ga0207648_100022955 233
138 3300026116 Ga0207674_10013681 Ga0207674_100136819 233
139 3300028786 Ga0307517_10000174 Ga0307517_1000017419 233
140 3300028794 Ga0307515_10001235 Ga0307515_1000123517 233
141 3300028794 Ga0307515_10002229 Ga0307515_100022297 233
142 3300028794 Ga0307515_10004451 Ga0307515_1000445115 233
143 3300030522 Ga0307512_10077429 Ga0307512_100774293 233
144 3300031456 Ga0307513_10021443 Ga0307513_100214432 233
145 3300031507 Ga0307509_10000225 Ga0307509_1000022557 233
146 3300031507 Ga0307509_10003816 Ga0307509_1000381617 233
147 3300031507 Ga0307509_10053865 Ga0307509_100538652 233
148 3300031616 Ga0307508_10000185 Ga0307508_1000018545 233
149 3300031616 Ga0307508_10002202 Ga0307508_1000220213 233
150 3300031616 Ga0307508_10003035 Ga0307508_1000303515 233
151 3300031649 Ga0307514_10027208 Ga0307514_100272084 233
152 3300031649 Ga0307514_10113350 Ga0307514_101133501 233
153 3300031649 Ga0307514_10127369 Ga0307514_101273692 233
154 3300031649 Ga0307514_10154486 Ga0307514_101544862 233
155 3300031730 Ga0307516_10001572 Ga0307516_1000157217 233
156 3300031730 Ga0307516_10193180 Ga0307516_101931802 233
157 3300031730 Ga0307516_10235902 Ga0307516_102359022 233
158 3300031838 Ga0307518_10375791 Ga0307518_103757911 233
159 3300033179 Ga0307507_10041125 Ga0307507_100411252 233
160 3300033179 Ga0307507_10062731 Ga0307507_100627313 233
161 3300033180 Ga0307510_10002036 Ga0307510_1000203618 233
162 3300033180 Ga0307510_10027956 Ga0307510_100279567 233
163 3300033180 Ga0307510_10177002 Ga0307510_101770022 233
164 3300034816 Ga0373930_0031514 Ga0373930_0031514_42_782 233
165 3300035114 Ga0373939_0039450 Ga0373939_0039450_412_1152 233
166 3300035691 Ga0373931_0006490 Ga0373931_0006490_1201_1941 233
167 3300041491 Ga0451833_0960283 Ga0451833_0960283_403_1122 233
168 3300041496 Ga0451839_1431364 Ga0451839_1431364_303_1022 233
169 3300046454 Ga0495592_0001312 Ga0495592_0001312_8176_8910 233
170 3300046459 Ga0495629_0392526 Ga0495629_0392526_174_914 233
171 3300046512 Ga0495610_0009884 Ga0495610_0009884_1033_1755 233
172 3300046512 Ga0495610_0093629 Ga0495610_0093629_307_1044 233
173 3300046516 Ga0495628_0269551 Ga0495628_0269551_453_1193 233
174 3300046519 Ga0495632_0011043 Ga0495632_0011043_4034_4768 233
175 3300046519 Ga0495632_0123535 Ga0495632_0123535_18_740 233
176 3300046522 Ga0495643_0085495 Ga0495643_0085495_622_1344 233
177 3300046526 Ga0495666_0170670 Ga0495666_0170670_118_858 233
178 3300046648 Ga0495611_0215807 Ga0495611_0215807_101_835 233
179 3300046660 Ga0495625_0016651 Ga0495625_0016651_1172_1891 233
180 3300046660 Ga0495625_0023849 Ga0495625_0023849_2044_2778 233
181 3300046683 Ga0495658_0174282 Ga0495658_0174282_215_949 233
182 3300046690 Ga0495624_0112982 Ga0495624_0112982_265_1005 233
183 3300047321 Ga0495676_0176071 Ga0495676_0176071_201_941 233
184 3300047472 Ga0495686_0082711 Ga0495686_0082711_26_763 233
185 3300047673 Ga0495593_0065482 Ga0495593_0065482_1038_1778 233
186 3300048905 Ga0496102_0031335 Ga0496102_0031335_3899_4609 233
187 3300050493 nmdc:mga0k408_216498_c1 nmdc:mga0k408_216498_c1_284_1003 233
188 3300053118 Ga0500594_0000517 Ga0500594_0000517_987_1724 233
189 3300053121 Ga0500607_119971 Ga0500607_119971_148_885 233
190 3300053134 Ga0500658_0043805 Ga0500658_0043805_499_1221 233
191 3300053136 Ga0500559_0000329 Ga0500559_0000329_10401_11138 233
192 3300053138 Ga0500564_131070 Ga0500564_131070_203_937 233
193 3300053739 Ga0500587_000776 Ga0500587_000776_73_795 233
194 3300002773 JGI25152J39213_1000683 JGI25152J39213_100068315 234
195 3300003215 JGI25153J46596_10000448 JGI25153J46596_1000044817 234
196 3300003771 Ga0055526_1001528 Ga0055526_100152812 234
197 3300005262 Ga0065165_1001455 Ga0065165_100145511 234
198 3300005328 Ga0070676_10262530 Ga0070676_102625301 234
199 3300005338 Ga0068868_100102899 Ga0068868_1001028994 234
200 3300005354 Ga0070675_100125403 Ga0070675_1001254031 234
201 3300005364 Ga0070673_100223917 Ga0070673_1002239172 234
202 3300005455 Ga0070663_100093166 Ga0070663_1000931662 234
203 3300005467 Ga0070706_100013486 Ga0070706_1000134869 234
204 3300005518 Ga0070699_100474980 Ga0070699_1004749802 234
205 3300005539 Ga0068853_100208010 Ga0068853_1002080102 234
206 3300005577 Ga0068857_100019445 Ga0068857_1000194452 234
207 3300005577 Ga0068857_100592150 Ga0068857_1005921501 234
208 3300006042 Ga0075368_10001225 Ga0075368_100012252 234
209 3300006042 Ga0075368_10014616 Ga0075368_100146164 234
210 3300006042 Ga0075368_10029754 Ga0075368_100297544 234
211 3300006042 Ga0075368_10081044 Ga0075368_100810441 234
212 3300006048 Ga0075363_100020312 Ga0075363_1000203122 234
213 3300006051 Ga0075364_10023342 Ga0075364_100233422 234
214 3300006051 Ga0075364_10208924 Ga0075364_102089242 234
215 3300006051 Ga0075364_10251508 Ga0075364_102515082 234
216 3300006177 Ga0075362_10000336 Ga0075362_1000033613 234
217 3300006177 Ga0075362_10020704 Ga0075362_100207044 234
218 3300006177 Ga0075362_10027479 Ga0075362_100274794 234
219 3300006177 Ga0075362_10108984 Ga0075362_101089842 234
220 3300006178 Ga0075367_10012713 Ga0075367_100127134 234
221 3300006178 Ga0075367_10016034 Ga0075367_100160342 234
222 3300006178 Ga0075367_10016664 Ga0075367_100166644 234
223 3300006178 Ga0075367_10043485 Ga0075367_100434854 234
224 3300006186 Ga0075369_10006987 Ga0075369_100069872 234
225 3300006186 Ga0075369_10017589 Ga0075369_100175892 234
226 3300006195 Ga0075366_10052976 Ga0075366_100529763 234
227 3300006195 Ga0075366_10062895 Ga0075366_100628952 234
228 3300006195 Ga0075366_10067875 Ga0075366_100678751 234
229 3300006195 Ga0075366_10132443 Ga0075366_101324432 234
230 3300006353 Ga0075370_10001494 Ga0075370_1000149413 234
231 3300006353 Ga0075370_10002042 Ga0075370_1000204210 234
232 3300006353 Ga0075370_10006778 Ga0075370_100067788 234
233 3300009093 Ga0105240_10384797 Ga0105240_103847972 234
234 3300009148 Ga0105243_10749200 Ga0105243_107492001 234
235 3300009545 Ga0105237_10031289 Ga0105237_100312892 234
236 3300010375 Ga0105239_10035743 Ga0105239_100357437 234
237 3300025245 Ga0207425_1000619 Ga0207425_10006199 234
238 3300025258 Ga0209129_1000062 Ga0209129_100006282 234
239 3300025263 Ga0209565_1015322 Ga0209565_10153222 234
240 3300025273 Ga0209673_1016242 Ga0209673_10162422 234
241 3300025295 Ga0209564_1000176 Ga0209564_10001762 234
242 3300025297 Ga0209758_1000126 Ga0209758_1000126165 234
243 3300025297 Ga0209758_1000129 Ga0209758_100012987 234
244 3300025298 Ga0209050_1000118 Ga0209050_1000118129 234
245 3300025303 Ga0209051_1020149 Ga0209051_10201494 234
246 3300025907 Ga0207645_10233902 Ga0207645_102339022 234
247 3300025910 Ga0207684_10003915 Ga0207684_1000391513 234
248 3300025960 Ga0207651_10201910 Ga0207651_102019102 234
249 3300026067 Ga0207678_10019577 Ga0207678_100195772 234
250 3300026089 Ga0207648_10585612 Ga0207648_105856122 234
251 3300026116 Ga0207674_10013266 Ga0207674_100132662 234
252 3300026116 Ga0207674_10558029 Ga0207674_105580292 234
253 3300027866 Ga0209813_10015590 Ga0209813_100155902 234
254 3300027866 Ga0209813_10021601 Ga0209813_100216011 234
255 3300031456 Ga0307513_10140439 Ga0307513_101404393 234
256 3300031730 Ga0307516_10112120 Ga0307516_101121204 234
257 3300046460 Ga0495638_0119564 Ga0495638_0119564_238_951 234
258 3300046474 Ga0495605_0036110 Ga0495605_0036110_1699_2439 234
259 3300046513 Ga0495616_0114686 Ga0495616_0114686_419_1159 234
260 3300046515 Ga0495620_0027490 Ga0495620_0027490_1841_2581 234
261 3300046519 Ga0495632_0004601 Ga0495632_0004601_8042_8755 234
262 3300046519 Ga0495632_0013871 Ga0495632_0013871_1939_2679 234
263 3300046542 Ga0495597_0099703 Ga0495597_0099703_21_761 234
264 3300046694 Ga0495649_0002120 Ga0495649_0002120_3653_4393 234
265 3300046810 Ga0495660_0023911 Ga0495660_0023911_2119_2859 234
266 3300047443 Ga0495687_011528 Ga0495687_011528_2048_2788 234
267 3300049460 Ga0495682_0052849 Ga0495682_0052849_509_1249 234
268 3300050489 nmdc:mga03683_101276_c1 nmdc:mga03683_101276_c1_488_1228 234
269 3300050490 nmdc:mga03n38_15292_c1 nmdc:mga03n38_15292_c1_1474_2214 234
270 3300050490 nmdc:mga03n38_2718_c1 nmdc:mga03n38_2718_c1_271_1011 234
271 3300050491 nmdc:mga00v17_153027_c1 nmdc:mga00v17_153027_c1_305_1045 234
272 3300050491 nmdc:mga00v17_61901_c1 nmdc:mga00v17_61901_c1_208_948 234
273 3300050492 nmdc:mga0yw44_97892_c1 nmdc:mga0yw44_97892_c1_52_792 234
274 3300050493 nmdc:mga0k408_10190_c1 nmdc:mga0k408_10190_c1_2976_3689 234
275 3300050493 nmdc:mga0k408_275877_c1 nmdc:mga0k408_275877_c1_108_848 234
276 3300050493 nmdc:mga0k408_30374_c1 nmdc:mga0k408_30374_c1_872_1627 234
277 3300050493 nmdc:mga0k408_34223_c1 nmdc:mga0k408_34223_c1_477_1217 234
278 3300050493 nmdc:mga0k408_4585_c1 nmdc:mga0k408_4585_c1_2041_2781 234
279 3300050493 nmdc:mga0k408_51176_c1 nmdc:mga0k408_51176_c1_1296_2036 234
280 3300050493 nmdc:mga0k408_80622_c1 nmdc:mga0k408_80622_c1_245_985 234
281 3300050493 nmdc:mga0k408_93119_c1 nmdc:mga0k408_93119_c1_895_1638 234
282 3300050494 nmdc:mga06z11_22404_c1 nmdc:mga06z11_22404_c1_1344_2084 234
283 3300050496 nmdc:mga07m45_1253_c1 nmdc:mga07m45_1253_c1_8358_9113 234
284 3300050496 nmdc:mga07m45_14379_c1 nmdc:mga07m45_14379_c1_1682_2422 234
285 3300050496 nmdc:mga07m45_144263_c1 nmdc:mga07m45_144263_c1_333_1076 234
286 3300050496 nmdc:mga07m45_1902_c1 nmdc:mga07m45_1902_c1_917_1657 234
287 3300050496 nmdc:mga07m45_32138_c1 nmdc:mga07m45_32138_c1_1649_2389 234
288 3300050496 nmdc:mga07m45_748_c1 nmdc:mga07m45_748_c1_4033_4746 234
289 3300050516 nmdc:mga0sz30_47240_c1 nmdc:mga0sz30_47240_c1_387_1127 234
290 3300053086 Ga0500578_0000079 Ga0500578_0000079_4070_4774 234
291 3300053088 Ga0500644_0092830 Ga0500644_0092830_67_780 234
292 3300053093 Ga0500651_0029691 Ga0500651_0029691_312_1025 234
293 3300053127 Ga0500623_065290 Ga0500623_065290_353_1066 234
294 3300053131 Ga0500652_000624 Ga0500652_000624_7489_8202 234
295 3300053133 Ga0500655_002479 Ga0500655_002479_718_1431 234
296 3300053139 Ga0500568_0034126 Ga0500568_0034126_158_898 234
297 3300053139 Ga0500568_0049439 Ga0500568_0049439_26_739 234
298 3300053156 Ga0500622_0000053 Ga0500622_0000053_110370_111083 234
299 3300053724 Ga0500570_068147 Ga0500570_068147_144_857 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

137

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9503 1 123
3nhz-assembly2.cif.gz_B structure of n-terminal domain of mtra 0.9448 1 119
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.9393 1 120
7e90-assembly1.cif.gz_B crystal structure of the receiver domain (d51e) of the response regulator vbrr from vibrio parahaemolyticus 0.9386 1 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9384 3 123
ID Description Score Start End Superfamily
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9636 3 89 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9595 1 84 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.957 2 84 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9552 3 90 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9495 3 125 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6N2VE22-F1-model_v4 Stage 0 sporulation protein A homolog 0.9342 2 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3B1DD72-F1-model_v4 Response regulator 0.9296 2 126 GO:0000155
AF-A0A7C4J786-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9288 2 122 GO:0000155
GO:0005524
GO:0006355
AF-A0A3M1TH77-F1-model_v4 Diguanylate cyclase 0.9253 2 126 GO:0000160
GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A7C4MM60-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9236 3 125 GO:0000155
GO:0005524

Feature Viewer

pLDDT pTM Quality
83.29 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map