F394635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 191 | 287 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300003791|Ga0055530_10000515|Ga0055530_1000051531 |
| Length | 255 |
| Sequence | VRPWIPAFAGMTGPRPIIRDMIRVLLVDDDPELRSLVSDYLSRYRMQVTTVPDGAGLRHALANAGSPPAFDVLLLDLMLPDANGLDLCRVVRQTSSLPIVMLTAQGDPASRVVGLELGADDYLPKPFEPRELVARINAVLRRTGSAPAAASAEAPVRRFNGWTFDRVRRQLTSPDHVMLALSSAEFRLLSAFVDHPRRVLSRERLLELTRVPGVDSTDRAIDLAISRLRQKLADPSLIRTVRGEGYAFEIDPPAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 8 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 9 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 10 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 11 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 12 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 44 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 54 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 96 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 97 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 100 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 101 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 104 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 105 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 106 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 107 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 108 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 109 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 113 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 119 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 120 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 121 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 122 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 123 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 124 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 125 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 126 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 127 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 128 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 129 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 130 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 131 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 132 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 164 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 168 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 169 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 170 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 171 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 172 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 173 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 175 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 176 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 178 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 179 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 180 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 181 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 182 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 183 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 185 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 187 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 188 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 190 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 191 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.65 |
| Metatranscriptomes | 0 |
| Isolates | 4.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 33.44 |
| Nodule | 1.34 |
| Rhizoplane | 1.34 |
| Rhizosphere | 46.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000683 | 3300002773 | Bacteria | 17690 |
| 2 | JGI25153J46596_10000448 | 3300003215 | Bacteria | 26516 |
| 3 | rootH1_10028624 | 3300003316 | Bacteria | 1301 |
| 4 | rootH1_10028624 | 3300003323 | Bacteria | 5060 |
| 5 | rootH1_10094680 | 3300003323 | Bacteria | 5648 |
| 6 | Ga0055526_1001528 | 3300003771 | Bacteria | 16371 |
| 7 | Ga0055524_1000121 | 3300003775 | Bacteria | 91150 |
| 8 | Ga0055524_1000183 | 3300003775 | Bacteria | 70460 |
| 9 | Ga0055530_10000515 | 3300003791 | Bacteria | 33601 |
| 10 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 11 | Ga0065165_1001455 | 3300005262 | Bacteria | 25574 |
| 12 | Ga0070676_10008197 | 3300005328 | Bacteria | 5623 |
| 13 | Ga0070676_10262530 | 3300005328 | Bacteria | 1157 |
| 14 | Ga0070690_100076842 | 3300005330 | Bacteria | 2179 |
| 15 | Ga0070670_100051664 | 3300005331 | Bacteria | 3529 |
| 16 | Ga0070670_100104517 | 3300005331 | Bacteria | 2440 |
| 17 | Ga0068869_100030886 | 3300005334 | Bacteria | 3765 |
| 18 | Ga0068868_100102899 | 3300005338 | Bacteria | 2313 |
| 19 | Ga0068868_100147747 | 3300005338 | Bacteria | 1934 |
| 20 | Ga0070669_100001399 | 3300005353 | Bacteria | 17423 |
| 21 | Ga0070675_100125403 | 3300005354 | Bacteria | 2184 |
| 22 | Ga0070675_100205420 | 3300005354 | Bacteria | 1711 |
| 23 | Ga0070671_100087131 | 3300005355 | Bacteria | 2613 |
| 24 | Ga0070673_100223917 | 3300005364 | Bacteria | 1629 |
| 25 | Ga0070667_100007921 | 3300005367 | Bacteria | 8812 |
| 26 | Ga0070711_100264491 | 3300005439 | Bacteria | 1355 |
| 27 | Ga0070663_100093166 | 3300005455 | Bacteria | 2235 |
| 28 | Ga0070662_100065908 | 3300005457 | Bacteria | 2656 |
| 29 | Ga0068867_100000041 | 3300005459 | Bacteria | 78472 |
| 30 | Ga0068867_100004166 | 3300005459 | Bacteria | 10173 |
| 31 | Ga0070706_100013486 | 3300005467 | Bacteria | 7560 |
| 32 | Ga0070699_100474980 | 3300005518 | Bacteria | 1134 |
| 33 | Ga0070699_100720224 | 3300005518 | Bacteria | 912 |
| 34 | Ga0068853_100208010 | 3300005539 | Bacteria | 1783 |
| 35 | Ga0070672_100168400 | 3300005543 | Bacteria | 1821 |
| 36 | Ga0070665_100678840 | 3300005548 | Bacteria | 1043 |
| 37 | Ga0068857_100019445 | 3300005577 | Bacteria | 5964 |
| 38 | Ga0068857_100079907 | 3300005577 | Bacteria | 2919 |
| 39 | Ga0068857_100592150 | 3300005577 | Bacteria | 1048 |
| 40 | Ga0068866_10125774 | 3300005718 | Bacteria | 1451 |
| 41 | Ga0075368_10001225 | 3300006042 | Bacteria | 8111 |
| 42 | Ga0075368_10014616 | 3300006042 | Bacteria | 2902 |
| 43 | Ga0075368_10029754 | 3300006042 | Bacteria | 2112 |
| 44 | Ga0075368_10081044 | 3300006042 | Bacteria | 1321 |
| 45 | Ga0075363_100020312 | 3300006048 | Bacteria | 3330 |
| 46 | Ga0075364_10023342 | 3300006051 | Bacteria | 3917 |
| 47 | Ga0075364_10208924 | 3300006051 | Bacteria | 1324 |
| 48 | Ga0075364_10251508 | 3300006051 | Bacteria | 1201 |
| 49 | Ga0075362_10000336 | 3300006177 | Bacteria | 13409 |
| 50 | Ga0075362_10020704 | 3300006177 | Bacteria | 2751 |
| 51 | Ga0075362_10027479 | 3300006177 | Bacteria | 2437 |
| 52 | Ga0075362_10108984 | 3300006177 | Bacteria | 1302 |
| 53 | Ga0075367_10012713 | 3300006178 | Bacteria | 4502 |
| 54 | Ga0075367_10016034 | 3300006178 | Bacteria | 4085 |
| 55 | Ga0075367_10016664 | 3300006178 | Bacteria | 4016 |
| 56 | Ga0075367_10043485 | 3300006178 | Bacteria | 2631 |
| 57 | Ga0075369_10006987 | 3300006186 | Bacteria | 4285 |
| 58 | Ga0075369_10017589 | 3300006186 | Bacteria | 2900 |
| 59 | Ga0075366_10006587 | 3300006195 | Bacteria | 6374 |
| 60 | Ga0075366_10052976 | 3300006195 | Bacteria | 2410 |
| 61 | Ga0075366_10062895 | 3300006195 | Bacteria | 2206 |
| 62 | Ga0075366_10067875 | 3300006195 | Bacteria | 2122 |
| 63 | Ga0075366_10132443 | 3300006195 | Bacteria | 1505 |
| 64 | Ga0075370_10001494 | 3300006353 | Bacteria | 10200 |
| 65 | Ga0075370_10002042 | 3300006353 | Bacteria | 9165 |
| 66 | Ga0075370_10006778 | 3300006353 | Bacteria | 5789 |
| 67 | Ga0068871_100521247 | 3300006358 | Bacteria | 1073 |
| 68 | Ga0068865_100114114 | 3300006881 | Bacteria | 1998 |
| 69 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 70 | Ga0079104_1000273 | 3300006946 | Bacteria | 67267 |
| 71 | Ga0105240_10384797 | 3300009093 | Bacteria | 1583 |
| 72 | Ga0105245_10389220 | 3300009098 | Bacteria | 1390 |
| 73 | Ga0105243_10001818 | 3300009148 | Bacteria | 18256 |
| 74 | Ga0105243_10749200 | 3300009148 | Bacteria | 957 |
| 75 | Ga0105237_10031289 | 3300009545 | Bacteria | 5397 |
| 76 | Ga0105239_10035743 | 3300010375 | Bacteria | 5455 |
| 77 | Ga0163162_10007560 | 3300013306 | Bacteria | 10585 |
| 78 | Ga0157375_10017007 | 3300013308 | Bacteria | 6551 |
| 79 | Ga0157375_10095842 | 3300013308 | Bacteria | 3039 |
| 80 | Ga0157377_10000020 | 3300014745 | Bacteria | 151620 |
| 81 | Ga0157377_10115018 | 3300014745 | Bacteria | 1622 |
| 82 | Ga0157379_10082637 | 3300014968 | Bacteria | 2878 |
| 83 | Ga0157379_10530755 | 3300014968 | Bacteria | 1093 |
| 84 | Ga0207425_1000619 | 3300025245 | Bacteria | 20305 |
| 85 | Ga0209129_1000062 | 3300025258 | Bacteria | 240655 |
| 86 | Ga0209565_1015322 | 3300025263 | Bacteria | 1732 |
| 87 | Ga0209673_1016242 | 3300025273 | Bacteria | 2793 |
| 88 | Ga0209675_1005977 | 3300025291 | Bacteria | 4981 |
| 89 | Ga0209675_1007412 | 3300025291 | Bacteria | 4212 |
| 90 | Ga0209564_1000176 | 3300025295 | Bacteria | 152363 |
| 91 | Ga0209758_1000126 | 3300025297 | Bacteria | 189761 |
| 92 | Ga0209758_1000129 | 3300025297 | Bacteria | 185022 |
| 93 | Ga0209050_1000118 | 3300025298 | Bacteria | 202586 |
| 94 | Ga0209050_1001522 | 3300025298 | Bacteria | 24440 |
| 95 | Ga0209050_1013629 | 3300025298 | Bacteria | 3591 |
| 96 | Ga0209050_1015703 | 3300025298 | Bacteria | 3158 |
| 97 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 98 | Ga0209256_1000024 | 3300025299 | Bacteria | 448909 |
| 99 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 100 | Ga0209051_1020149 | 3300025303 | Bacteria | 2884 |
| 101 | Ga0209257_1000084 | 3300025304 | Bacteria | 291502 |
| 102 | Ga0209257_1008423 | 3300025304 | Bacteria | 5867 |
| 103 | Ga0209257_1026869 | 3300025304 | Bacteria | 1929 |
| 104 | Ga0207645_10008045 | 3300025907 | Bacteria | 7397 |
| 105 | Ga0207645_10233902 | 3300025907 | Bacteria | 1213 |
| 106 | Ga0207684_10003915 | 3300025910 | Bacteria | 14258 |
| 107 | Ga0207663_10333973 | 3300025916 | Bacteria | 1143 |
| 108 | Ga0207681_10003705 | 3300025923 | Bacteria | 9497 |
| 109 | Ga0207650_10028138 | 3300025925 | Bacteria | 4028 |
| 110 | Ga0207659_10409768 | 3300025926 | Bacteria | 1135 |
| 111 | Ga0207644_10216844 | 3300025931 | Bacteria | 1515 |
| 112 | Ga0207709_10003945 | 3300025935 | Bacteria | 8661 |
| 113 | Ga0207691_10162835 | 3300025940 | Bacteria | 1956 |
| 114 | Ga0207689_10063053 | 3300025942 | Bacteria | 3049 |
| 115 | Ga0207651_10201910 | 3300025960 | Bacteria | 1594 |
| 116 | Ga0207651_10220053 | 3300025960 | Bacteria | 1534 |
| 117 | Ga0207658_10001854 | 3300025986 | Bacteria | 15830 |
| 118 | Ga0207678_10019577 | 3300026067 | Bacteria | 5949 |
| 119 | Ga0207648_10000026 | 3300026089 | Bacteria | 131314 |
| 120 | Ga0207648_10002295 | 3300026089 | Bacteria | 20666 |
| 121 | Ga0207648_10585612 | 3300026089 | Bacteria | 1027 |
| 122 | Ga0207674_10013266 | 3300026116 | Bacteria | 9152 |
| 123 | Ga0207674_10013681 | 3300026116 | Bacteria | 8989 |
| 124 | Ga0207674_10558029 | 3300026116 | Bacteria | 1106 |
| 125 | Ga0207675_100424442 | 3300026118 | Bacteria | 1314 |
| 126 | Ga0207698_10004876 | 3300026142 | Bacteria | 8225 |
| 127 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 128 | Ga0209281_1000416 | 3300027111 | Bacteria | 64290 |
| 129 | Ga0209813_10015590 | 3300027866 | Bacteria | 2062 |
| 130 | Ga0209813_10021601 | 3300027866 | Bacteria | 1811 |
| 131 | Ga0307517_10000174 | 3300028786 | Bacteria | 105578 |
| 132 | Ga0307517_10101508 | 3300028786 | Bacteria | 2264 |
| 133 | Ga0307517_10157341 | 3300028786 | Bacteria | 1537 |
| 134 | Ga0307515_10001235 | 3300028794 | Bacteria | 58313 |
| 135 | Ga0307515_10002229 | 3300028794 | Bacteria | 42507 |
| 136 | Ga0307515_10004451 | 3300028794 | Bacteria | 29009 |
| 137 | Ga0307515_10026743 | 3300028794 | Bacteria | 9909 |
| 138 | Ga0307515_10069756 | 3300028794 | Bacteria | 4796 |
| 139 | Ga0307512_10077429 | 3300030522 | Bacteria | 2416 |
| 140 | Ga0307513_10001087 | 3300031456 | Bacteria | 39457 |
| 141 | Ga0307513_10021443 | 3300031456 | Bacteria | 7626 |
| 142 | Ga0307513_10115644 | 3300031456 | Bacteria | 2664 |
| 143 | Ga0307513_10140439 | 3300031456 | Bacteria | 2343 |
| 144 | Ga0307513_10209287 | 3300031456 | Bacteria | 1783 |
| 145 | Ga0307509_10000225 | 3300031507 | Bacteria | 90913 |
| 146 | Ga0307509_10003816 | 3300031507 | Bacteria | 22337 |
| 147 | Ga0307509_10053865 | 3300031507 | Bacteria | 4286 |
| 148 | Ga0307509_10306762 | 3300031507 | Bacteria | 1332 |
| 149 | Ga0307408_100249055 | 3300031548 | Bacteria | 1464 |
| 150 | Ga0307508_10000185 | 3300031616 | Bacteria | 75407 |
| 151 | Ga0307508_10002202 | 3300031616 | Bacteria | 20788 |
| 152 | Ga0307508_10003035 | 3300031616 | Bacteria | 17286 |
| 153 | Ga0307514_10027208 | 3300031649 | Bacteria | 4620 |
| 154 | Ga0307514_10113350 | 3300031649 | Bacteria | 1914 |
| 155 | Ga0307514_10127369 | 3300031649 | Bacteria | 1761 |
| 156 | Ga0307514_10154486 | 3300031649 | Bacteria | 1533 |
| 157 | Ga0316575_10000291 | 3300031665 | Bacteria | 13928 |
| 158 | Ga0307516_10001572 | 3300031730 | Bacteria | 31438 |
| 159 | Ga0307516_10112120 | 3300031730 | Bacteria | 2528 |
| 160 | Ga0307516_10193180 | 3300031730 | Bacteria | 1760 |
| 161 | Ga0307516_10235902 | 3300031730 | Bacteria | 1530 |
| 162 | Ga0307518_10375791 | 3300031838 | Bacteria | 810 |
| 163 | Ga0307507_10041125 | 3300033179 | Bacteria | 4632 |
| 164 | Ga0307507_10062731 | 3300033179 | Bacteria | 3448 |
| 165 | Ga0307510_10002036 | 3300033180 | Bacteria | 22846 |
| 166 | Ga0307510_10027956 | 3300033180 | Bacteria | 6449 |
| 167 | Ga0307510_10177002 | 3300033180 | Bacteria | 1702 |
| 168 | Ga0373930_0031514 | 3300034816 | Bacteria | 1093 |
| 169 | Ga0373948_0045973 | 3300034817 | Bacteria | 926 |
| 170 | Ga0373950_0006341 | 3300034818 | Bacteria | 1800 |
| 171 | Ga0373958_0025123 | 3300034819 | Bacteria | 1132 |
| 172 | Ga0373940_0005399 | 3300035088 | Bacteria | 2767 |
| 173 | Ga0373951_0035703 | 3300035091 | Bacteria | 1184 |
| 174 | Ga0373939_0000051 | 3300035114 | Bacteria | 41440 |
| 175 | Ga0373939_0039450 | 3300035114 | Bacteria | 1413 |
| 176 | Ga0373960_0002130 | 3300035121 | Bacteria | 4460 |
| 177 | Ga0373931_0000141 | 3300035691 | Bacteria | 32173 |
| 178 | Ga0373931_0006490 | 3300035691 | Bacteria | 5467 |
| 179 | Ga0316582_0281180 | 3300036647 | Bacteria | 1142 |
| 180 | Ga0373925_0016935 | 3300037068 | Bacteria | 5276 |
| 181 | Ga0395905_0029897 | 3300037471 | Bacteria | 5135 |
| 182 | Ga0436365_0560401 | 3300039437 | Bacteria | 2220 |
| 183 | Ga0451833_0960283 | 3300041491 | Bacteria | 1678 |
| 184 | Ga0451839_1431364 | 3300041496 | Bacteria | 1332 |
| 185 | Ga0439437_000279 | 3300042000 | Bacteria | 4693 |
| 186 | Ga0450913_000306 | 3300042117 | Bacteria | 1877 |
| 187 | Ga0450919_000225 | 3300042121 | Bacteria | 6300 |
| 188 | Ga0450888_000426 | 3300042126 | Bacteria | 3974 |
| 189 | Ga0450890_001153 | 3300042127 | Bacteria | 3822 |
| 190 | Ga0450891_002011 | 3300042129 | Bacteria | 2081 |
| 191 | Ga0450889_000410 | 3300042144 | Bacteria | 4783 |
| 192 | Ga0439434_0011422 | 3300042435 | Bacteria | 2626 |
| 193 | Ga0450916_001412 | 3300042530 | Bacteria | 2398 |
| 194 | Ga0450918_000006 | 3300042531 | Bacteria | 48279 |
| 195 | Ga0450893_0001363 | 3300042532 | Bacteria | 3714 |
| 196 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 197 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 198 | Ga0451576_0118473 | 3300045051 | Bacteria | 2756 |
| 199 | Ga0495592_0001312 | 3300046454 | Bacteria | 17260 |
| 200 | Ga0495629_0392526 | 3300046459 | Bacteria | 944 |
| 201 | Ga0495638_0119564 | 3300046460 | Bacteria | 1558 |
| 202 | Ga0495580_0042841 | 3300046472 | Bacteria | 3223 |
| 203 | Ga0495605_0036110 | 3300046474 | Bacteria | 2494 |
| 204 | Ga0495594_0071807 | 3300046499 | Bacteria | 1925 |
| 205 | Ga0495610_0009884 | 3300046512 | Bacteria | 5972 |
| 206 | Ga0495610_0093629 | 3300046512 | Bacteria | 1357 |
| 207 | Ga0495616_0114686 | 3300046513 | Bacteria | 1249 |
| 208 | Ga0495620_0027490 | 3300046515 | Bacteria | 2661 |
| 209 | Ga0495628_0269551 | 3300046516 | Bacteria | 1267 |
| 210 | Ga0495632_0004601 | 3300046519 | Bacteria | 9343 |
| 211 | Ga0495632_0011043 | 3300046519 | Bacteria | 5292 |
| 212 | Ga0495632_0013871 | 3300046519 | Bacteria | 4580 |
| 213 | Ga0495632_0123535 | 3300046519 | Bacteria | 1208 |
| 214 | Ga0495643_0085495 | 3300046522 | Bacteria | 1635 |
| 215 | Ga0495666_0019510 | 3300046526 | Bacteria | 3363 |
| 216 | Ga0495666_0170670 | 3300046526 | Bacteria | 1006 |
| 217 | Ga0495597_0033794 | 3300046542 | Bacteria | 2313 |
| 218 | Ga0495597_0099703 | 3300046542 | Bacteria | 1226 |
| 219 | Ga0495611_0215807 | 3300046648 | Bacteria | 893 |
| 220 | Ga0495625_0016651 | 3300046660 | Bacteria | 5775 |
| 221 | Ga0495625_0023849 | 3300046660 | Bacteria | 4668 |
| 222 | Ga0495647_0115723 | 3300046681 | Bacteria | 1123 |
| 223 | Ga0495658_0174282 | 3300046683 | Bacteria | 1332 |
| 224 | Ga0495624_0112982 | 3300046690 | Bacteria | 1670 |
| 225 | Ga0495649_0002120 | 3300046694 | Bacteria | 14224 |
| 226 | Ga0495649_0176105 | 3300046694 | Bacteria | 1118 |
| 227 | Ga0495660_0023911 | 3300046810 | Bacteria | 3482 |
| 228 | Ga0495604_0142712 | 3300047317 | Bacteria | 1709 |
| 229 | Ga0495676_0176071 | 3300047321 | Bacteria | 1502 |
| 230 | Ga0495687_001305 | 3300047443 | Bacteria | 23391 |
| 231 | Ga0495687_011528 | 3300047443 | Bacteria | 4744 |
| 232 | Ga0495686_0034912 | 3300047472 | Bacteria | 3235 |
| 233 | Ga0495686_0082711 | 3300047472 | Bacteria | 1959 |
| 234 | Ga0495593_0065482 | 3300047673 | Bacteria | 1895 |
| 235 | Ga0495626_0129575 | 3300048091 | Bacteria | 1078 |
| 236 | Ga0496102_0031335 | 3300048905 | Bacteria | 4769 |
| 237 | Ga0496104_0404186 | 3300048907 | Bacteria | 1278 |
| 238 | Ga0496114_0004522 | 3300048917 | Bacteria | 10794 |
| 239 | Ga0496114_0047713 | 3300048917 | Bacteria | 3562 |
| 240 | Ga0496116_0000215 | 3300048919 | Bacteria | 109085 |
| 241 | Ga0496116_0063405 | 3300048919 | Bacteria | 2381 |
| 242 | Ga0496121_0000198 | 3300048924 | Bacteria | 134224 |
| 243 | Ga0495682_0052849 | 3300049460 | Bacteria | 1476 |
| 244 | nmdc:mga03683_101276_c1 | 3300050489 | Bacteria | 1266 |
| 245 | nmdc:mga03683_71349_c1 | 3300050489 | Bacteria | 1485 |
| 246 | nmdc:mga03n38_15292_c1 | 3300050490 | Bacteria | 2960 |
| 247 | nmdc:mga03n38_2718_c1 | 3300050490 | Bacteria | 5534 |
| 248 | nmdc:mga00v17_153027_c1 | 3300050491 | Bacteria | 1482 |
| 249 | nmdc:mga00v17_61901_c1 | 3300050491 | Bacteria | 2301 |
| 250 | nmdc:mga0yw44_97892_c1 | 3300050492 | Bacteria | 1864 |
| 251 | nmdc:mga0k408_10190_c1 | 3300050493 | Bacteria | 5081 |
| 252 | nmdc:mga0k408_216498_c1 | 3300050493 | Bacteria | 1144 |
| 253 | nmdc:mga0k408_275877_c1 | 3300050493 | Bacteria | 1004 |
| 254 | nmdc:mga0k408_301041_c1 | 3300050493 | Bacteria | 957 |
| 255 | nmdc:mga0k408_30374_c1 | 3300050493 | Bacteria | 3081 |
| 256 | nmdc:mga0k408_34223_c1 | 3300050493 | Bacteria | 2908 |
| 257 | nmdc:mga0k408_4585_c1 | 3300050493 | Bacteria | 7332 |
| 258 | nmdc:mga0k408_51176_c1 | 3300050493 | Bacteria | 2393 |
| 259 | nmdc:mga0k408_7127_c1 | 3300050493 | Bacteria | 2602 |
| 260 | nmdc:mga0k408_80622_c1 | 3300050493 | Bacteria | 1905 |
| 261 | nmdc:mga0k408_93119_c1 | 3300050493 | Bacteria | 1772 |
| 262 | nmdc:mga06z11_22404_c1 | 3300050494 | Bacteria | 2950 |
| 263 | nmdc:mga07m45_1253_c1 | 3300050496 | Bacteria | 11546 |
| 264 | nmdc:mga07m45_14379_c1 | 3300050496 | Bacteria | 4215 |
| 265 | nmdc:mga07m45_144263_c1 | 3300050496 | Bacteria | 1380 |
| 266 | nmdc:mga07m45_1902_c1 | 3300050496 | Bacteria | 9628 |
| 267 | nmdc:mga07m45_32138_c1 | 3300050496 | Bacteria | 2911 |
| 268 | nmdc:mga07m45_748_c1 | 3300050496 | Bacteria | 13891 |
| 269 | nmdc:mga07m45_82020_c1 | 3300050496 | Bacteria | 1841 |
| 270 | nmdc:mga0sz30_47240_c1 | 3300050516 | Bacteria | 1819 |
| 271 | Ga0500578_0000079 | 3300053086 | Bacteria | 107137 |
| 272 | Ga0500644_0092830 | 3300053088 | Bacteria | 1133 |
| 273 | Ga0500651_0029691 | 3300053093 | Bacteria | 3439 |
| 274 | Ga0500594_0000517 | 3300053118 | Bacteria | 8374 |
| 275 | Ga0500607_119971 | 3300053121 | Bacteria | 1274 |
| 276 | Ga0500623_065290 | 3300053127 | Bacteria | 1783 |
| 277 | Ga0500652_000624 | 3300053131 | Bacteria | 12146 |
| 278 | Ga0500655_002479 | 3300053133 | Bacteria | 3362 |
| 279 | Ga0500658_0043805 | 3300053134 | Bacteria | 1803 |
| 280 | Ga0500559_0000329 | 3300053136 | Bacteria | 35808 |
| 281 | Ga0500564_131070 | 3300053138 | Bacteria | 1085 |
| 282 | Ga0500568_0034126 | 3300053139 | Bacteria | 2083 |
| 283 | Ga0500568_0049439 | 3300053139 | Bacteria | 1659 |
| 284 | Ga0500622_0000053 | 3300053156 | Bacteria | 145070 |
| 285 | Ga0500627_0231553 | 3300053158 | Bacteria | 822 |
| 286 | Ga0500570_068147 | 3300053724 | Bacteria | 1677 |
| 287 | Ga0500587_000776 | 3300053739 | Bacteria | 4138 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025916 | Ga0207663_10333973 | Ga0207663_103339732 | 191 |
| 2 | 3300050489 | nmdc:mga03683_71349_c1 | nmdc:mga03683_71349_c1_879_1475 | 195 |
| 3 | 3300048919 | Ga0496116_0000215 | Ga0496116_0000215_100861_101637 | 207 |
| 4 | 3300048924 | Ga0496121_0000198 | Ga0496121_0000198_33082_33858 | 207 |
| 5 | 3300046681 | Ga0495647_0115723 | Ga0495647_0115723_447_1106 | 208 |
| 6 | 3300053158 | Ga0500627_0231553 | Ga0500627_0231553_174_812 | 209 |
| 7 | 3300048907 | Ga0496104_0404186 | Ga0496104_0404186_11_673 | 212 |
| 8 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_523127_523819 | 218 |
| 9 | 3300028794 | Ga0307515_10026743 | Ga0307515_100267433 | 219 |
| 10 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_499485_500180 | 219 |
| 11 | 3300046542 | Ga0495597_0033794 | Ga0495597_0033794_254_1000 | 221 |
| 12 | 3300047443 | Ga0495687_001305 | Ga0495687_001305_19530_20276 | 221 |
| 13 | 3300048091 | Ga0495626_0129575 | Ga0495626_0129575_284_1030 | 221 |
| 14 | 3300048919 | Ga0496116_0063405 | Ga0496116_0063405_1077_1799 | 223 |
| 15 | 3300031665 | Ga0316575_10000291 | Ga0316575_1000029113 | 224 |
| 16 | iso_pu_bacteria | 2643221544 | 2643743355 | 224 |
| 17 | 3300005518 | Ga0070699_100720224 | Ga0070699_1007202242 | 225 |
| 18 | 3300036647 | Ga0316582_0281180 | Ga0316582_0281180_128_841 | 225 |
| 19 | iso_pu_bacteria | 2643221644 | 2644246504 | 225 |
| 20 | iso_pu_bacteria | 2643221585 | 2643932633 | 226 |
| 21 | iso_pu_bacteria | 2643221656 | 2644313883 | 226 |
| 22 | iso_pu_bacteria | 639633007 | 639788781 | 226 |
| 23 | 3300003775 | Ga0055524_1000183 | Ga0055524_100018318 | 227 |
| 24 | 3300005331 | Ga0070670_100051664 | Ga0070670_1000516643 | 227 |
| 25 | 3300005353 | Ga0070669_100001399 | Ga0070669_10000139910 | 227 |
| 26 | 3300005439 | Ga0070711_100264491 | Ga0070711_1002644912 | 227 |
| 27 | 3300005548 | Ga0070665_100678840 | Ga0070665_1006788401 | 227 |
| 28 | 3300006946 | Ga0079104_1000273 | Ga0079104_100027336 | 227 |
| 29 | 3300013306 | Ga0163162_10007560 | Ga0163162_1000756010 | 227 |
| 30 | 3300013308 | Ga0157375_10017007 | Ga0157375_100170079 | 227 |
| 31 | 3300025291 | Ga0209675_1005977 | Ga0209675_10059773 | 227 |
| 32 | 3300025298 | Ga0209050_1013629 | Ga0209050_10136292 | 227 |
| 33 | 3300025299 | Ga0209256_1000024 | Ga0209256_100002455 | 227 |
| 34 | 3300025923 | Ga0207681_10003705 | Ga0207681_100037052 | 227 |
| 35 | 3300027111 | Ga0209281_1000416 | Ga0209281_100041631 | 227 |
| 36 | 3300028786 | Ga0307517_10157341 | Ga0307517_101573412 | 227 |
| 37 | 3300031456 | Ga0307513_10115644 | Ga0307513_101156443 | 227 |
| 38 | 3300034817 | Ga0373948_0045973 | Ga0373948_0045973_103_807 | 227 |
| 39 | 3300034818 | Ga0373950_0006341 | Ga0373950_0006341_49_753 | 227 |
| 40 | 3300034819 | Ga0373958_0025123 | Ga0373958_0025123_122_826 | 227 |
| 41 | 3300035088 | Ga0373940_0005399 | Ga0373940_0005399_977_1681 | 227 |
| 42 | 3300035091 | Ga0373951_0035703 | Ga0373951_0035703_296_1000 | 227 |
| 43 | 3300035114 | Ga0373939_0000051 | Ga0373939_0000051_13320_14024 | 227 |
| 44 | 3300035121 | Ga0373960_0002130 | Ga0373960_0002130_1857_2561 | 227 |
| 45 | 3300035691 | Ga0373931_0000141 | Ga0373931_0000141_5479_6183 | 227 |
| 46 | 3300046472 | Ga0495580_0042841 | Ga0495580_0042841_639_1373 | 227 |
| 47 | 3300046499 | Ga0495594_0071807 | Ga0495594_0071807_512_1246 | 227 |
| 48 | 3300046526 | Ga0495666_0019510 | Ga0495666_0019510_2040_2774 | 227 |
| 49 | 3300047317 | Ga0495604_0142712 | Ga0495604_0142712_170_904 | 227 |
| 50 | 3300048917 | Ga0496114_0004522 | Ga0496114_0004522_2801_3523 | 227 |
| 51 | 3300050496 | nmdc:mga07m45_82020_c1 | nmdc:mga07m45_82020_c1_863_1600 | 227 |
| 52 | 3300003316 | rootH1_10028624 | rootH1_100286242 | 228 |
| 53 | 3300003323 | rootH1_10094680 | rootH1_100946804 | 228 |
| 54 | 3300005459 | Ga0068867_100000041 | Ga0068867_10000004129 | 228 |
| 55 | 3300009148 | Ga0105243_10001818 | Ga0105243_1000181813 | 228 |
| 56 | 3300014745 | Ga0157377_10000020 | Ga0157377_1000002066 | 228 |
| 57 | 3300025935 | Ga0207709_10003945 | Ga0207709_100039454 | 228 |
| 58 | 3300026089 | Ga0207648_10000026 | Ga0207648_1000002676 | 228 |
| 59 | 3300026142 | Ga0207698_10004876 | Ga0207698_100048763 | 228 |
| 60 | 3300031507 | Ga0307509_10306762 | Ga0307509_103067622 | 228 |
| 61 | 3300037471 | Ga0395905_0029897 | Ga0395905_0029897_1257_2003 | 228 |
| 62 | 3300042000 | Ga0439437_000279 | Ga0439437_000279_3517_4227 | 228 |
| 63 | 3300042117 | Ga0450913_000306 | Ga0450913_000306_486_1196 | 228 |
| 64 | 3300042126 | Ga0450888_000426 | Ga0450888_000426_1304_2014 | 228 |
| 65 | 3300042127 | Ga0450890_001153 | Ga0450890_001153_193_903 | 228 |
| 66 | 3300042129 | Ga0450891_002011 | Ga0450891_002011_467_1177 | 228 |
| 67 | 3300042144 | Ga0450889_000410 | Ga0450889_000410_3773_4483 | 228 |
| 68 | 3300042530 | Ga0450916_001412 | Ga0450916_001412_997_1707 | 228 |
| 69 | 3300042532 | Ga0450893_0001363 | Ga0450893_0001363_2853_3563 | 228 |
| 70 | 3300050493 | nmdc:mga0k408_301041_c1 | nmdc:mga0k408_301041_c1_157_864 | 228 |
| 71 | 3300005367 | Ga0070667_100007921 | Ga0070667_1000079214 | 229 |
| 72 | 3300006195 | Ga0075366_10006587 | Ga0075366_100065876 | 229 |
| 73 | 3300006358 | Ga0068871_100521247 | Ga0068871_1005212472 | 229 |
| 74 | 3300006881 | Ga0068865_100114114 | Ga0068865_1001141142 | 229 |
| 75 | 3300014968 | Ga0157379_10082637 | Ga0157379_100826374 | 229 |
| 76 | 3300025304 | Ga0209257_1008423 | Ga0209257_10084234 | 229 |
| 77 | 3300025986 | Ga0207658_10001854 | Ga0207658_1000185410 | 229 |
| 78 | 3300028786 | Ga0307517_10101508 | Ga0307517_101015083 | 229 |
| 79 | 3300028794 | Ga0307515_10069756 | Ga0307515_100697565 | 229 |
| 80 | 3300031456 | Ga0307513_10001087 | Ga0307513_1000108732 | 229 |
| 81 | 3300031456 | Ga0307513_10209287 | Ga0307513_102092873 | 229 |
| 82 | 3300031548 | Ga0307408_100249055 | Ga0307408_1002490552 | 229 |
| 83 | 3300037068 | Ga0373925_0016935 | Ga0373925_0016935_4126_4839 | 229 |
| 84 | 3300039437 | Ga0436365_0560401 | Ga0436365_0560401_125_850 | 229 |
| 85 | 3300042121 | Ga0450919_000225 | Ga0450919_000225_3026_3724 | 229 |
| 86 | 3300042435 | Ga0439434_0011422 | Ga0439434_0011422_1481_2179 | 229 |
| 87 | 3300042531 | Ga0450918_000006 | Ga0450918_000006_30604_31302 | 229 |
| 88 | 3300045051 | Ga0451576_0118473 | Ga0451576_0118473_1274_1987 | 229 |
| 89 | 3300046694 | Ga0495649_0176105 | Ga0495649_0176105_123_881 | 229 |
| 90 | 3300047472 | Ga0495686_0034912 | Ga0495686_0034912_33_758 | 229 |
| 91 | 3300050493 | nmdc:mga0k408_7127_c1 | nmdc:mga0k408_7127_c1_1590_2300 | 229 |
| 92 | iso_pu_bacteria | 2585428062 | 2587759977 | 229 |
| 93 | iso_pu_bacteria | 2808606373 | 2808903937 | 229 |
| 94 | 3300005718 | Ga0068866_10125774 | Ga0068866_101257742 | 230 |
| 95 | 3300025304 | Ga0209257_1026869 | Ga0209257_10268692 | 230 |
| 96 | 3300026118 | Ga0207675_100424442 | Ga0207675_1004244421 | 230 |
| 97 | iso_pu_bacteria | 2585428057 | 2587728137 | 230 |
| 98 | iso_pu_bacteria | 2585428058 | 2587731195 | 230 |
| 99 | iso_pu_bacteria | 2588253510 | 2588289948 | 230 |
| 100 | iso_pu_bacteria | 2643221592 | 2643972262 | 230 |
| 101 | iso_pu_bacteria | 2643221625 | 2644141627 | 230 |
| 102 | iso_pu_bacteria | 2643221648 | 2644275602 | 230 |
| 103 | 3300003791 | Ga0055530_10000515 | Ga0055530_1000051531 | 231 |
| 104 | 3300003792 | Ga0055540_1000001 | Ga0055540_1000001303 | 231 |
| 105 | 3300025298 | Ga0209050_1001522 | Ga0209050_10015224 | 231 |
| 106 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018150 | 231 |
| 107 | 3300025304 | Ga0209257_1000084 | Ga0209257_1000084222 | 231 |
| 108 | 3300003775 | Ga0055524_1000121 | Ga0055524_100012157 | 232 |
| 109 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001464 | 232 |
| 110 | 3300025291 | Ga0209675_1007412 | Ga0209675_10074124 | 232 |
| 111 | 3300025298 | Ga0209050_1015703 | Ga0209050_10157034 | 232 |
| 112 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015549 | 232 |
| 113 | 3300027111 | Ga0209281_1000151 | Ga0209281_1000151146 | 232 |
| 114 | 3300048917 | Ga0496114_0047713 | Ga0496114_0047713_2840_3550 | 232 |
| 115 | 3300005328 | Ga0070676_10008197 | Ga0070676_100081975 | 233 |
| 116 | 3300005330 | Ga0070690_100076842 | Ga0070690_1000768422 | 233 |
| 117 | 3300005331 | Ga0070670_100104517 | Ga0070670_1001045172 | 233 |
| 118 | 3300005334 | Ga0068869_100030886 | Ga0068869_1000308862 | 233 |
| 119 | 3300005338 | Ga0068868_100147747 | Ga0068868_1001477472 | 233 |
| 120 | 3300005354 | Ga0070675_100205420 | Ga0070675_1002054201 | 233 |
| 121 | 3300005355 | Ga0070671_100087131 | Ga0070671_1000871313 | 233 |
| 122 | 3300005457 | Ga0070662_100065908 | Ga0070662_1000659084 | 233 |
| 123 | 3300005459 | Ga0068867_100004166 | Ga0068867_1000041665 | 233 |
| 124 | 3300005543 | Ga0070672_100168400 | Ga0070672_1001684003 | 233 |
| 125 | 3300005577 | Ga0068857_100079907 | Ga0068857_1000799072 | 233 |
| 126 | 3300009098 | Ga0105245_10389220 | Ga0105245_103892202 | 233 |
| 127 | 3300013308 | Ga0157375_10095842 | Ga0157375_100958424 | 233 |
| 128 | 3300014745 | Ga0157377_10115018 | Ga0157377_101150182 | 233 |
| 129 | 3300014968 | Ga0157379_10530755 | Ga0157379_105307552 | 233 |
| 130 | 3300025907 | Ga0207645_10008045 | Ga0207645_100080455 | 233 |
| 131 | 3300025925 | Ga0207650_10028138 | Ga0207650_100281382 | 233 |
| 132 | 3300025926 | Ga0207659_10409768 | Ga0207659_104097682 | 233 |
| 133 | 3300025931 | Ga0207644_10216844 | Ga0207644_102168442 | 233 |
| 134 | 3300025940 | Ga0207691_10162835 | Ga0207691_101628353 | 233 |
| 135 | 3300025942 | Ga0207689_10063053 | Ga0207689_100630533 | 233 |
| 136 | 3300025960 | Ga0207651_10220053 | Ga0207651_102200532 | 233 |
| 137 | 3300026089 | Ga0207648_10002295 | Ga0207648_100022955 | 233 |
| 138 | 3300026116 | Ga0207674_10013681 | Ga0207674_100136819 | 233 |
| 139 | 3300028786 | Ga0307517_10000174 | Ga0307517_1000017419 | 233 |
| 140 | 3300028794 | Ga0307515_10001235 | Ga0307515_1000123517 | 233 |
| 141 | 3300028794 | Ga0307515_10002229 | Ga0307515_100022297 | 233 |
| 142 | 3300028794 | Ga0307515_10004451 | Ga0307515_1000445115 | 233 |
| 143 | 3300030522 | Ga0307512_10077429 | Ga0307512_100774293 | 233 |
| 144 | 3300031456 | Ga0307513_10021443 | Ga0307513_100214432 | 233 |
| 145 | 3300031507 | Ga0307509_10000225 | Ga0307509_1000022557 | 233 |
| 146 | 3300031507 | Ga0307509_10003816 | Ga0307509_1000381617 | 233 |
| 147 | 3300031507 | Ga0307509_10053865 | Ga0307509_100538652 | 233 |
| 148 | 3300031616 | Ga0307508_10000185 | Ga0307508_1000018545 | 233 |
| 149 | 3300031616 | Ga0307508_10002202 | Ga0307508_1000220213 | 233 |
| 150 | 3300031616 | Ga0307508_10003035 | Ga0307508_1000303515 | 233 |
| 151 | 3300031649 | Ga0307514_10027208 | Ga0307514_100272084 | 233 |
| 152 | 3300031649 | Ga0307514_10113350 | Ga0307514_101133501 | 233 |
| 153 | 3300031649 | Ga0307514_10127369 | Ga0307514_101273692 | 233 |
| 154 | 3300031649 | Ga0307514_10154486 | Ga0307514_101544862 | 233 |
| 155 | 3300031730 | Ga0307516_10001572 | Ga0307516_1000157217 | 233 |
| 156 | 3300031730 | Ga0307516_10193180 | Ga0307516_101931802 | 233 |
| 157 | 3300031730 | Ga0307516_10235902 | Ga0307516_102359022 | 233 |
| 158 | 3300031838 | Ga0307518_10375791 | Ga0307518_103757911 | 233 |
| 159 | 3300033179 | Ga0307507_10041125 | Ga0307507_100411252 | 233 |
| 160 | 3300033179 | Ga0307507_10062731 | Ga0307507_100627313 | 233 |
| 161 | 3300033180 | Ga0307510_10002036 | Ga0307510_1000203618 | 233 |
| 162 | 3300033180 | Ga0307510_10027956 | Ga0307510_100279567 | 233 |
| 163 | 3300033180 | Ga0307510_10177002 | Ga0307510_101770022 | 233 |
| 164 | 3300034816 | Ga0373930_0031514 | Ga0373930_0031514_42_782 | 233 |
| 165 | 3300035114 | Ga0373939_0039450 | Ga0373939_0039450_412_1152 | 233 |
| 166 | 3300035691 | Ga0373931_0006490 | Ga0373931_0006490_1201_1941 | 233 |
| 167 | 3300041491 | Ga0451833_0960283 | Ga0451833_0960283_403_1122 | 233 |
| 168 | 3300041496 | Ga0451839_1431364 | Ga0451839_1431364_303_1022 | 233 |
| 169 | 3300046454 | Ga0495592_0001312 | Ga0495592_0001312_8176_8910 | 233 |
| 170 | 3300046459 | Ga0495629_0392526 | Ga0495629_0392526_174_914 | 233 |
| 171 | 3300046512 | Ga0495610_0009884 | Ga0495610_0009884_1033_1755 | 233 |
| 172 | 3300046512 | Ga0495610_0093629 | Ga0495610_0093629_307_1044 | 233 |
| 173 | 3300046516 | Ga0495628_0269551 | Ga0495628_0269551_453_1193 | 233 |
| 174 | 3300046519 | Ga0495632_0011043 | Ga0495632_0011043_4034_4768 | 233 |
| 175 | 3300046519 | Ga0495632_0123535 | Ga0495632_0123535_18_740 | 233 |
| 176 | 3300046522 | Ga0495643_0085495 | Ga0495643_0085495_622_1344 | 233 |
| 177 | 3300046526 | Ga0495666_0170670 | Ga0495666_0170670_118_858 | 233 |
| 178 | 3300046648 | Ga0495611_0215807 | Ga0495611_0215807_101_835 | 233 |
| 179 | 3300046660 | Ga0495625_0016651 | Ga0495625_0016651_1172_1891 | 233 |
| 180 | 3300046660 | Ga0495625_0023849 | Ga0495625_0023849_2044_2778 | 233 |
| 181 | 3300046683 | Ga0495658_0174282 | Ga0495658_0174282_215_949 | 233 |
| 182 | 3300046690 | Ga0495624_0112982 | Ga0495624_0112982_265_1005 | 233 |
| 183 | 3300047321 | Ga0495676_0176071 | Ga0495676_0176071_201_941 | 233 |
| 184 | 3300047472 | Ga0495686_0082711 | Ga0495686_0082711_26_763 | 233 |
| 185 | 3300047673 | Ga0495593_0065482 | Ga0495593_0065482_1038_1778 | 233 |
| 186 | 3300048905 | Ga0496102_0031335 | Ga0496102_0031335_3899_4609 | 233 |
| 187 | 3300050493 | nmdc:mga0k408_216498_c1 | nmdc:mga0k408_216498_c1_284_1003 | 233 |
| 188 | 3300053118 | Ga0500594_0000517 | Ga0500594_0000517_987_1724 | 233 |
| 189 | 3300053121 | Ga0500607_119971 | Ga0500607_119971_148_885 | 233 |
| 190 | 3300053134 | Ga0500658_0043805 | Ga0500658_0043805_499_1221 | 233 |
| 191 | 3300053136 | Ga0500559_0000329 | Ga0500559_0000329_10401_11138 | 233 |
| 192 | 3300053138 | Ga0500564_131070 | Ga0500564_131070_203_937 | 233 |
| 193 | 3300053739 | Ga0500587_000776 | Ga0500587_000776_73_795 | 233 |
| 194 | 3300002773 | JGI25152J39213_1000683 | JGI25152J39213_100068315 | 234 |
| 195 | 3300003215 | JGI25153J46596_10000448 | JGI25153J46596_1000044817 | 234 |
| 196 | 3300003771 | Ga0055526_1001528 | Ga0055526_100152812 | 234 |
| 197 | 3300005262 | Ga0065165_1001455 | Ga0065165_100145511 | 234 |
| 198 | 3300005328 | Ga0070676_10262530 | Ga0070676_102625301 | 234 |
| 199 | 3300005338 | Ga0068868_100102899 | Ga0068868_1001028994 | 234 |
| 200 | 3300005354 | Ga0070675_100125403 | Ga0070675_1001254031 | 234 |
| 201 | 3300005364 | Ga0070673_100223917 | Ga0070673_1002239172 | 234 |
| 202 | 3300005455 | Ga0070663_100093166 | Ga0070663_1000931662 | 234 |
| 203 | 3300005467 | Ga0070706_100013486 | Ga0070706_1000134869 | 234 |
| 204 | 3300005518 | Ga0070699_100474980 | Ga0070699_1004749802 | 234 |
| 205 | 3300005539 | Ga0068853_100208010 | Ga0068853_1002080102 | 234 |
| 206 | 3300005577 | Ga0068857_100019445 | Ga0068857_1000194452 | 234 |
| 207 | 3300005577 | Ga0068857_100592150 | Ga0068857_1005921501 | 234 |
| 208 | 3300006042 | Ga0075368_10001225 | Ga0075368_100012252 | 234 |
| 209 | 3300006042 | Ga0075368_10014616 | Ga0075368_100146164 | 234 |
| 210 | 3300006042 | Ga0075368_10029754 | Ga0075368_100297544 | 234 |
| 211 | 3300006042 | Ga0075368_10081044 | Ga0075368_100810441 | 234 |
| 212 | 3300006048 | Ga0075363_100020312 | Ga0075363_1000203122 | 234 |
| 213 | 3300006051 | Ga0075364_10023342 | Ga0075364_100233422 | 234 |
| 214 | 3300006051 | Ga0075364_10208924 | Ga0075364_102089242 | 234 |
| 215 | 3300006051 | Ga0075364_10251508 | Ga0075364_102515082 | 234 |
| 216 | 3300006177 | Ga0075362_10000336 | Ga0075362_1000033613 | 234 |
| 217 | 3300006177 | Ga0075362_10020704 | Ga0075362_100207044 | 234 |
| 218 | 3300006177 | Ga0075362_10027479 | Ga0075362_100274794 | 234 |
| 219 | 3300006177 | Ga0075362_10108984 | Ga0075362_101089842 | 234 |
| 220 | 3300006178 | Ga0075367_10012713 | Ga0075367_100127134 | 234 |
| 221 | 3300006178 | Ga0075367_10016034 | Ga0075367_100160342 | 234 |
| 222 | 3300006178 | Ga0075367_10016664 | Ga0075367_100166644 | 234 |
| 223 | 3300006178 | Ga0075367_10043485 | Ga0075367_100434854 | 234 |
| 224 | 3300006186 | Ga0075369_10006987 | Ga0075369_100069872 | 234 |
| 225 | 3300006186 | Ga0075369_10017589 | Ga0075369_100175892 | 234 |
| 226 | 3300006195 | Ga0075366_10052976 | Ga0075366_100529763 | 234 |
| 227 | 3300006195 | Ga0075366_10062895 | Ga0075366_100628952 | 234 |
| 228 | 3300006195 | Ga0075366_10067875 | Ga0075366_100678751 | 234 |
| 229 | 3300006195 | Ga0075366_10132443 | Ga0075366_101324432 | 234 |
| 230 | 3300006353 | Ga0075370_10001494 | Ga0075370_1000149413 | 234 |
| 231 | 3300006353 | Ga0075370_10002042 | Ga0075370_1000204210 | 234 |
| 232 | 3300006353 | Ga0075370_10006778 | Ga0075370_100067788 | 234 |
| 233 | 3300009093 | Ga0105240_10384797 | Ga0105240_103847972 | 234 |
| 234 | 3300009148 | Ga0105243_10749200 | Ga0105243_107492001 | 234 |
| 235 | 3300009545 | Ga0105237_10031289 | Ga0105237_100312892 | 234 |
| 236 | 3300010375 | Ga0105239_10035743 | Ga0105239_100357437 | 234 |
| 237 | 3300025245 | Ga0207425_1000619 | Ga0207425_10006199 | 234 |
| 238 | 3300025258 | Ga0209129_1000062 | Ga0209129_100006282 | 234 |
| 239 | 3300025263 | Ga0209565_1015322 | Ga0209565_10153222 | 234 |
| 240 | 3300025273 | Ga0209673_1016242 | Ga0209673_10162422 | 234 |
| 241 | 3300025295 | Ga0209564_1000176 | Ga0209564_10001762 | 234 |
| 242 | 3300025297 | Ga0209758_1000126 | Ga0209758_1000126165 | 234 |
| 243 | 3300025297 | Ga0209758_1000129 | Ga0209758_100012987 | 234 |
| 244 | 3300025298 | Ga0209050_1000118 | Ga0209050_1000118129 | 234 |
| 245 | 3300025303 | Ga0209051_1020149 | Ga0209051_10201494 | 234 |
| 246 | 3300025907 | Ga0207645_10233902 | Ga0207645_102339022 | 234 |
| 247 | 3300025910 | Ga0207684_10003915 | Ga0207684_1000391513 | 234 |
| 248 | 3300025960 | Ga0207651_10201910 | Ga0207651_102019102 | 234 |
| 249 | 3300026067 | Ga0207678_10019577 | Ga0207678_100195772 | 234 |
| 250 | 3300026089 | Ga0207648_10585612 | Ga0207648_105856122 | 234 |
| 251 | 3300026116 | Ga0207674_10013266 | Ga0207674_100132662 | 234 |
| 252 | 3300026116 | Ga0207674_10558029 | Ga0207674_105580292 | 234 |
| 253 | 3300027866 | Ga0209813_10015590 | Ga0209813_100155902 | 234 |
| 254 | 3300027866 | Ga0209813_10021601 | Ga0209813_100216011 | 234 |
| 255 | 3300031456 | Ga0307513_10140439 | Ga0307513_101404393 | 234 |
| 256 | 3300031730 | Ga0307516_10112120 | Ga0307516_101121204 | 234 |
| 257 | 3300046460 | Ga0495638_0119564 | Ga0495638_0119564_238_951 | 234 |
| 258 | 3300046474 | Ga0495605_0036110 | Ga0495605_0036110_1699_2439 | 234 |
| 259 | 3300046513 | Ga0495616_0114686 | Ga0495616_0114686_419_1159 | 234 |
| 260 | 3300046515 | Ga0495620_0027490 | Ga0495620_0027490_1841_2581 | 234 |
| 261 | 3300046519 | Ga0495632_0004601 | Ga0495632_0004601_8042_8755 | 234 |
| 262 | 3300046519 | Ga0495632_0013871 | Ga0495632_0013871_1939_2679 | 234 |
| 263 | 3300046542 | Ga0495597_0099703 | Ga0495597_0099703_21_761 | 234 |
| 264 | 3300046694 | Ga0495649_0002120 | Ga0495649_0002120_3653_4393 | 234 |
| 265 | 3300046810 | Ga0495660_0023911 | Ga0495660_0023911_2119_2859 | 234 |
| 266 | 3300047443 | Ga0495687_011528 | Ga0495687_011528_2048_2788 | 234 |
| 267 | 3300049460 | Ga0495682_0052849 | Ga0495682_0052849_509_1249 | 234 |
| 268 | 3300050489 | nmdc:mga03683_101276_c1 | nmdc:mga03683_101276_c1_488_1228 | 234 |
| 269 | 3300050490 | nmdc:mga03n38_15292_c1 | nmdc:mga03n38_15292_c1_1474_2214 | 234 |
| 270 | 3300050490 | nmdc:mga03n38_2718_c1 | nmdc:mga03n38_2718_c1_271_1011 | 234 |
| 271 | 3300050491 | nmdc:mga00v17_153027_c1 | nmdc:mga00v17_153027_c1_305_1045 | 234 |
| 272 | 3300050491 | nmdc:mga00v17_61901_c1 | nmdc:mga00v17_61901_c1_208_948 | 234 |
| 273 | 3300050492 | nmdc:mga0yw44_97892_c1 | nmdc:mga0yw44_97892_c1_52_792 | 234 |
| 274 | 3300050493 | nmdc:mga0k408_10190_c1 | nmdc:mga0k408_10190_c1_2976_3689 | 234 |
| 275 | 3300050493 | nmdc:mga0k408_275877_c1 | nmdc:mga0k408_275877_c1_108_848 | 234 |
| 276 | 3300050493 | nmdc:mga0k408_30374_c1 | nmdc:mga0k408_30374_c1_872_1627 | 234 |
| 277 | 3300050493 | nmdc:mga0k408_34223_c1 | nmdc:mga0k408_34223_c1_477_1217 | 234 |
| 278 | 3300050493 | nmdc:mga0k408_4585_c1 | nmdc:mga0k408_4585_c1_2041_2781 | 234 |
| 279 | 3300050493 | nmdc:mga0k408_51176_c1 | nmdc:mga0k408_51176_c1_1296_2036 | 234 |
| 280 | 3300050493 | nmdc:mga0k408_80622_c1 | nmdc:mga0k408_80622_c1_245_985 | 234 |
| 281 | 3300050493 | nmdc:mga0k408_93119_c1 | nmdc:mga0k408_93119_c1_895_1638 | 234 |
| 282 | 3300050494 | nmdc:mga06z11_22404_c1 | nmdc:mga06z11_22404_c1_1344_2084 | 234 |
| 283 | 3300050496 | nmdc:mga07m45_1253_c1 | nmdc:mga07m45_1253_c1_8358_9113 | 234 |
| 284 | 3300050496 | nmdc:mga07m45_14379_c1 | nmdc:mga07m45_14379_c1_1682_2422 | 234 |
| 285 | 3300050496 | nmdc:mga07m45_144263_c1 | nmdc:mga07m45_144263_c1_333_1076 | 234 |
| 286 | 3300050496 | nmdc:mga07m45_1902_c1 | nmdc:mga07m45_1902_c1_917_1657 | 234 |
| 287 | 3300050496 | nmdc:mga07m45_32138_c1 | nmdc:mga07m45_32138_c1_1649_2389 | 234 |
| 288 | 3300050496 | nmdc:mga07m45_748_c1 | nmdc:mga07m45_748_c1_4033_4746 | 234 |
| 289 | 3300050516 | nmdc:mga0sz30_47240_c1 | nmdc:mga0sz30_47240_c1_387_1127 | 234 |
| 290 | 3300053086 | Ga0500578_0000079 | Ga0500578_0000079_4070_4774 | 234 |
| 291 | 3300053088 | Ga0500644_0092830 | Ga0500644_0092830_67_780 | 234 |
| 292 | 3300053093 | Ga0500651_0029691 | Ga0500651_0029691_312_1025 | 234 |
| 293 | 3300053127 | Ga0500623_065290 | Ga0500623_065290_353_1066 | 234 |
| 294 | 3300053131 | Ga0500652_000624 | Ga0500652_000624_7489_8202 | 234 |
| 295 | 3300053133 | Ga0500655_002479 | Ga0500655_002479_718_1431 | 234 |
| 296 | 3300053139 | Ga0500568_0034126 | Ga0500568_0034126_158_898 | 234 |
| 297 | 3300053139 | Ga0500568_0049439 | Ga0500568_0049439_26_739 | 234 |
| 298 | 3300053156 | Ga0500622_0000053 | Ga0500622_0000053_110370_111083 | 234 |
| 299 | 3300053724 | Ga0500570_068147 | Ga0500570_068147_144_857 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9503 | 1 | 123 |
| 3nhz-assembly2.cif.gz_B | structure of n-terminal domain of mtra | 0.9448 | 1 | 119 |
| 2ftk-assembly2.cif.gz_H | berylloflouride spo0f complex with spo0b | 0.9393 | 1 | 120 |
| 7e90-assembly1.cif.gz_B | crystal structure of the receiver domain (d51e) of the response regulator vbrr from vibrio parahaemolyticus | 0.9386 | 1 | 122 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9384 | 3 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2U6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9636 | 3 | 89 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9595 | 1 | 84 | 3.40.50.2300 |
| af_P9WGM7_2_84_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.957 | 2 | 84 | 3.40.50.2300 |
| af_P0A9Q1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9552 | 3 | 90 | 3.40.50.2300 |
| 3dzdB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9495 | 3 | 125 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N2VE22-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.9342 | 2 | 126 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3B1DD72-F1-model_v4 | Response regulator | 0.9296 | 2 | 126 |
GO:0000155
|
| AF-A0A7C4J786-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9288 | 2 | 122 |
GO:0000155
GO:0005524 GO:0006355 |
| AF-A0A3M1TH77-F1-model_v4 | Diguanylate cyclase | 0.9253 | 2 | 126 |
GO:0000160
GO:0005886 GO:0043709 GO:0052621 GO:1902201 |
| AF-A0A7C4MM60-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9236 | 3 | 125 |
GO:0000155
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar