F394618

General Info

Members Datasets Scaffolds Average Seq Length
299 174 256 69

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1001201|JGI25162J39368_10012019
Length 70
Sequence MAVTLRALQNDTVDALCWRHYGRTAGVTEAVLEANPGLADHGPTLPQGLAVQMPEAQTTAPQRQMVNLWD

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
5 2547132181 Kosakonia sacchari SP1 Isolate Stem
6 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
7 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
8 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
9 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
10 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
11 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
12 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
13 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
14 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
15 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
16 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
17 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
18 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
19 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
20 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
21 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
22 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
23 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
24 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
25 2773857670 Pseudomonas sp. 478 Isolate Unclassified
26 2784132063 Pseudomonas sp. 424 Isolate Unclassified
27 2784132072 Pseudomonas sp. 460 Isolate Unclassified
28 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
29 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
30 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
31 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
32 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
33 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
34 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
35 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
36 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
37 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
38 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
39 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
40 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
41 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
42 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
43 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
44 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
45 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
46 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
47 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
48 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
49 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
88 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
91 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
92 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
93 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
94 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
95 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
96 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
97 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
98 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
99 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
100 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
101 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
102 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
103 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
174 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.62
Metatranscriptomes 0
Isolates 14.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 1.67
Rhizoplane 6.35
Rhizosphere 75.25
Stem 0.33
Stem Tuber 0.33
Unclassified 12.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C4634 2010549000 Bacteria 2510
2 MRS2a_Contig_15889 2124908027 Bacteria 1162
3 JGI25162J39368_1001201 3300002737 Bacteria 15116
4 JGI25163J39215_1000357 3300002771 Bacteria 15009
5 JGI25164J39214_1000618 3300002772 Bacteria 15116
6 JGI25165J46597_1001240 3300003214 Bacteria 15116
7 Ga0065714_10002247 3300005288 Bacteria 35975
8 Ga0065714_10003904 3300005288 Bacteria 6754
9 Ga0065714_10064966 3300005288 Bacteria 14782
10 Ga0065714_10099268 3300005288 Bacteria 1691
11 Ga0065714_10100050 3300005288 Bacteria 1671
12 Ga0065714_10211070 3300005288 Bacteria 865
13 Ga0065714_10240657 3300005288 Bacteria 795
14 Ga0065714_10263642 3300005288 Bacteria 731
15 Ga0070662_100360796 3300005457 Bacteria 1192
16 Ga0068854_100140403 3300005578 Bacteria 1853
17 Ga0075364_10021391 3300006051 Bacteria 4076
18 Ga0075432_10000029 3300006058 Bacteria 26660
19 Ga0075436_100381108 3300006914 Bacteria 1020
20 Ga0079104_1000213 3300006946 Bacteria 81349
21 Ga0079104_1006793 3300006946 Bacteria 4250
22 Ga0105251_10001348 3300009011 Bacteria 21197
23 Ga0105251_10007788 3300009011 Bacteria 6527
24 Ga0105251_10072439 3300009011 Bacteria 1602
25 Ga0105251_10076217 3300009011 Bacteria 1556
26 Ga0105251_10092192 3300009011 Bacteria 1391
27 Ga0105244_10000892 3300009036 Bacteria 25233
28 Ga0105244_10001086 3300009036 Bacteria 22649
29 Ga0105244_10005022 3300009036 Bacteria 8908
30 Ga0105244_10095041 3300009036 Bacteria 1463
31 Ga0105244_10113228 3300009036 Bacteria 1318
32 Ga0105250_10004369 3300009092 Bacteria 6509
33 Ga0105250_10023381 3300009092 Bacteria 2489
34 Ga0105250_10254843 3300009092 Bacteria 750
35 Ga0105243_10017163 3300009148 Bacteria 5475
36 Ga0105243_10071636 3300009148 Bacteria 2803
37 Ga0105243_10988566 3300009148 Bacteria 843
38 Ga0157373_10001071 3300013100 Bacteria 21026
39 Ga0157373_10001161 3300013100 Bacteria 20181
40 Ga0157373_10576971 3300013100 Bacteria 817
41 Ga0157373_11147755 3300013100 Bacteria 584
42 Ga0157371_10011434 3300013102 Bacteria 6838
43 Ga0157371_10113401 3300013102 Bacteria 1925
44 Ga0157371_10130075 3300013102 Bacteria 1791
45 Ga0157371_10342272 3300013102 Bacteria 1088
46 Ga0157371_10481318 3300013102 Bacteria 915
47 Ga0157371_11302535 3300013102 Bacteria 562
48 Ga0157371_11628933 3300013102 Bacteria 506
49 Ga0157370_10010886 3300013104 Bacteria 9553
50 Ga0157370_10017452 3300013104 Bacteria 7241
51 Ga0157369_10000624 3300013105 Bacteria 45989
52 Ga0157369_10001847 3300013105 Bacteria 25593
53 Ga0157369_10002090 3300013105 Bacteria 24149
54 Ga0157369_10893709 3300013105 Bacteria 911
55 Ga0157369_12266552 3300013105 Bacteria 550
56 Ga0157375_10687513 3300013308 Bacteria 1177
57 Ga0182008_10000691 3300014497 Bacteria 24308
58 Ga0182008_10001637 3300014497 Bacteria 14811
59 Ga0182008_10013385 3300014497 Bacteria 4314
60 Ga0182008_10121422 3300014497 Bacteria 1299
61 Ga0182008_10159681 3300014497 Bacteria 1134
62 Ga0182008_10548808 3300014497 Bacteria 642
63 Ga0182006_1000336 3300015261 Bacteria 40117
64 Ga0182006_1000494 3300015261 Bacteria 30731
65 Ga0182006_1013961 3300015261 Bacteria 3470
66 Ga0182006_1052901 3300015261 Bacteria 1559
67 Ga0182006_1069872 3300015261 Bacteria 1305
68 Ga0182006_1094050 3300015261 Bacteria 1073
69 Ga0182007_10000336 3300015262 Bacteria 29777
70 Ga0182007_10004117 3300015262 Bacteria 6674
71 Ga0182007_10054183 3300015262 Bacteria 1319
72 Ga0182005_1000414 3300015265 Bacteria 23137
73 Ga0182005_1000479 3300015265 Bacteria 20684
74 Ga0182005_1039186 3300015265 Bacteria 1289
75 Ga0182005_1071868 3300015265 Bacteria 950
76 Ga0182005_1116897 3300015265 Bacteria 757
77 Ga0163161_10000558 3300017792 Bacteria 29997
78 Ga0209760_100079 3300025207 Bacteria 77345
79 Ga0207427_100001 3300025231 Bacteria 1410763
80 Ga0209437_100003 3300025233 Bacteria 1517827
81 Ga0209233_1000007 3300025261 Bacteria 1411234
82 Ga0207696_1034652 3300025711 Bacteria 1506
83 Ga0207696_1180400 3300025711 Bacteria 558
84 Ga0207655_1000368 3300025728 Bacteria 63458
85 Ga0207655_1001240 3300025728 Bacteria 24409
86 Ga0207655_1018781 3300025728 Bacteria 3647
87 Ga0207655_1119452 3300025728 Bacteria 876
88 Ga0207713_1000448 3300025735 Bacteria 43290
89 Ga0207713_1040699 3300025735 Bacteria 1947
90 Ga0207713_1126264 3300025735 Bacteria 852
91 Ga0207709_10004911 3300025935 Bacteria 7655
92 Ga0207709_10078853 3300025935 Bacteria 2115
93 Ga0207709_11069905 3300025935 Bacteria 661
94 Ga0207709_11209143 3300025935 Bacteria 623
95 Ga0207640_10119954 3300025981 Bacteria 1882
96 Ga0209281_1000011 3300027111 Bacteria 695292
97 Ga0209281_1024822 3300027111 Bacteria 1122
98 Ga0207428_10000817 3300027907 Bacteria 35134
99 Ga0307408_100000399 3300031548 Bacteria 39153
100 Ga0307408_100022464 3300031548 Bacteria 4287
101 Ga0307408_100103731 3300031548 Bacteria 2171
102 Ga0307516_10592990 3300031730 Bacteria 762
103 Ga0307412_10000746 3300031911 Bacteria 18853
104 Ga0307412_10479666 3300031911 Bacteria 1031
105 Ga0307416_102612520 3300032002 Bacteria 602
106 Ga0395898_0000989 3300037466 Bacteria 44706
107 Ga0395901_0000631 3300038443 Bacteria 40942
108 Ga0439438_000046 3300041405 Bacteria 59521
109 Ga0439438_000119 3300041405 Bacteria 35892
110 Ga0439438_002783 3300041405 Bacteria 7322
111 Ga0439438_021907 3300041405 Bacteria 1778
112 Ga0439447_000027 3300041407 Bacteria 50469
113 Ga0439447_008356 3300041407 Bacteria 3210
114 Ga0439447_050879 3300041407 Bacteria 989
115 Ga0439466_0005457 3300041411 Bacteria 4856
116 Ga0439466_0013412 3300041411 Bacteria 3000
117 Ga0439466_0106952 3300041411 Bacteria 869
118 Ga0439431_0000010 3300041997 Bacteria 33799
119 Ga0439442_062576 3300042002 Bacteria 789
120 Ga0439432_000117 3300042006 Bacteria 25873
121 Ga0439432_008274 3300042006 Bacteria 3656
122 Ga0439432_021904 3300042006 Bacteria 2114
123 Ga0439432_254408 3300042006 Bacteria 503
124 Ga0439451_132854 3300042009 Bacteria 509
125 Ga0439452_000910 3300042010 Bacteria 13469
126 Ga0439452_001224 3300042010 Bacteria 10948
127 Ga0439452_001341 3300042010 Bacteria 10269
128 Ga0439452_016416 3300042010 Bacteria 2011
129 Ga0439456_000048 3300042013 Bacteria 43556
130 Ga0439456_000073 3300042013 Bacteria 35533
131 Ga0439456_000374 3300042013 Bacteria 10060
132 Ga0439456_009791 3300042013 Bacteria 1977
133 Ga0439456_046989 3300042013 Bacteria 941
134 Ga0439463_003070 3300042016 Bacteria 4242
135 Ga0439463_005466 3300042016 Bacteria 3155
136 Ga0450920_000040 3300042122 Bacteria 15762
137 Ga0450922_000036 3300042124 Bacteria 11720
138 Ga0450902_003089 3300042137 Bacteria 2407
139 Ga0450902_089085 3300042137 Bacteria 545
140 Ga0450905_106288 3300042142 Bacteria 507
141 Ga0450906_069633 3300042145 Bacteria 629
142 Ga0450907_000075 3300042146 Bacteria 37674
143 Ga0450910_000008 3300042147 Bacteria 39330
144 Ga0450908_000022 3300042184 Bacteria 37153
145 Ga0450908_021370 3300042184 Bacteria 1135
146 Ga0450909_002562 3300042185 Bacteria 2575
147 Ga0439464_0057049 3300042439 Bacteria 1138
148 Ga0439460_0046843 3300042461 Bacteria 1286
149 Ga0439440_0000536 3300042993 Bacteria 6409
150 Ga0466966_0000025 3300044684 Bacteria 107839
151 Ga0466959_0000350 3300045049 Bacteria 27331
152 Ga0466958_0016849 3300045836 Bacteria 4216
153 Ga0466958_0225863 3300045836 Viruses 1195
154 Ga0495617_007327 3300046452 Bacteria 3832
155 Ga0495617_067452 3300046452 Bacteria 1178
156 Ga0495627_000358 3300046453 Bacteria 42660
157 Ga0495629_0234548 3300046459 Bacteria 1264
158 Ga0495638_0040579 3300046460 Bacteria 2949
159 Ga0495638_0172927 3300046460 Bacteria 1238
160 Ga0495638_0291529 3300046460 Bacteria 882
161 Ga0495653_0001209 3300046463 Bacteria 19997
162 Ga0495653_0002454 3300046463 Bacteria 14733
163 Ga0495653_0041157 3300046463 Bacteria 3608
164 Ga0495650_0000294 3300046471 Bacteria 91542
165 Ga0495650_0018853 3300046471 Bacteria 3417
166 Ga0495650_0030771 3300046471 Bacteria 2425
167 Ga0495605_0000500 3300046474 Bacteria 33598
168 Ga0495585_0000357 3300046492 Bacteria 44293
169 Ga0495585_0000552 3300046492 Bacteria 35372
170 Ga0495596_0006720 3300046500 Bacteria 5263
171 Ga0495607_0000032 3300046501 Bacteria 153288
172 Ga0495607_0114262 3300046501 Bacteria 1427
173 Ga0495606_0000625 3300046507 Bacteria 55768
174 Ga0495606_0466311 3300046507 Bacteria 644
175 Ga0495610_0017585 3300046512 Bacteria 4071
176 Ga0495610_0053863 3300046512 Bacteria 1946
177 Ga0495616_0375194 3300046513 Bacteria 588
178 Ga0495630_0016872 3300046517 Bacteria 5343
179 Ga0495637_0000208 3300046520 Bacteria 46116
180 Ga0495643_0017213 3300046522 Bacteria 4230
181 Ga0495643_0497132 3300046522 Bacteria 525
182 Ga0495648_0000175 3300046524 Bacteria 74095
183 Ga0495648_0000260 3300046524 Bacteria 59856
184 Ga0495666_0000208 3300046526 Bacteria 24982
185 Ga0495666_0050273 3300046526 Bacteria 2004
186 Ga0495654_0006076 3300046530 Bacteria 6925
187 Ga0495654_0044525 3300046530 Bacteria 2195
188 Ga0495654_0054538 3300046530 Bacteria 1939
189 Ga0495587_0000256 3300046536 Bacteria 38302
190 Ga0495609_0104813 3300046538 Bacteria 1223
191 Ga0495622_0009007 3300046557 Bacteria 4622
192 Ga0495622_0171648 3300046557 Bacteria 975
193 Ga0495611_0000140 3300046648 Bacteria 50961
194 Ga0495659_0134294 3300046664 Bacteria 983
195 Ga0495623_0006174 3300046679 Bacteria 7791
196 Ga0495646_0000121 3300046680 Bacteria 38979
197 Ga0495669_0049188 3300046684 Bacteria 1887
198 Ga0495624_0000344 3300046690 Bacteria 36909
199 Ga0495670_0009707 3300046691 Bacteria 4729
200 Ga0495670_0129777 3300046691 Bacteria 1313
201 Ga0495671_0000114 3300046692 Bacteria 72267
202 Ga0495671_0012828 3300046692 Bacteria 4561
203 Ga0495649_0000371 3300046694 Bacteria 38885
204 Ga0495649_0000381 3300046694 Bacteria 38573
205 Ga0495649_0197573 3300046694 Bacteria 1045
206 Ga0495660_0002529 3300046810 Bacteria 11661
207 Ga0495604_0000461 3300047317 Bacteria 36131
208 Ga0495672_0000616 3300047320 Bacteria 39736
209 Ga0495672_0023372 3300047320 Bacteria 4001
210 Ga0495672_0296441 3300047320 Viruses 767
211 Ga0495672_0361896 3300047320 Bacteria 671
212 Ga0495680_0000619 3300047322 Bacteria 40007
213 Ga0495683_0001848 3300047323 Bacteria 13295
214 Ga0495675_0091929 3300047444 Bacteria 1904
215 Ga0495679_071516 3300047446 Bacteria 998
216 Ga0495673_0000198 3300047469 Bacteria 93985
217 Ga0495681_0040720 3300047470 Bacteria 2260
218 Ga0495686_0000731 3300047472 Bacteria 43974
219 Ga0495626_0000229 3300048091 Bacteria 65975
220 Ga0495626_0000515 3300048091 Bacteria 38738
221 Ga0496107_0105545 3300048910 Bacteria 2068
222 Ga0496110_0325842 3300048913 Bacteria 1399
223 Ga0496115_0501461 3300048918 Bacteria 975
224 Ga0496116_0483411 3300048919 Bacteria 520
225 Ga0496117_0000681 3300048920 Bacteria 54266
226 Ga0496117_0000849 3300048920 Bacteria 47293
227 Ga0496117_0001076 3300048920 Bacteria 41369
228 Ga0496118_0000293 3300048921 Bacteria 86751
229 Ga0496118_0001122 3300048921 Bacteria 41463
230 Ga0496119_0000739 3300048922 Bacteria 44001
231 Ga0496119_0000866 3300048922 Bacteria 39894
232 Ga0496119_0004057 3300048922 Bacteria 14777
233 Ga0496120_0000504 3300048923 Bacteria 60989
234 Ga0496120_0000831 3300048923 Bacteria 44084
235 Ga0496121_0000299 3300048924 Bacteria 103000
236 Ga0496121_0001353 3300048924 Bacteria 41915
237 Ga0496121_0012081 3300048924 Bacteria 9488
238 Ga0496122_0001259 3300048925 Bacteria 42394
239 Ga0496122_0001755 3300048925 Bacteria 33330
240 Ga0496123_0001022 3300048926 Bacteria 42679
241 Ga0496123_0001432 3300048926 Bacteria 33330
242 Ga0496124_0000021 3300048927 Bacteria 432123
243 Ga0496124_0000270 3300048927 Bacteria 99711
244 Ga0496124_0003290 3300048927 Bacteria 19923
245 Ga0496124_0492812 3300048927 Bacteria 824
246 Ga0496125_0038127 3300048928 Bacteria 4166
247 Ga0496126_0008304 3300048929 Bacteria 11213
248 Ga0496126_0021925 3300048929 Bacteria 6229
249 Ga0496126_0528408 3300048929 Bacteria 939
250 Ga0495678_143404 3300049459 Bacteria 779
251 Ga0495682_0015943 3300049460 Bacteria 2845
252 Ga0501042_0272970 3300049578 Bacteria 1221
253 nmdc:mga00v17_21010_c1 3300050491 Bacteria 3748
254 nmdc:mga08x19_1034492_c1 3300050514 Bacteria 583
255 nmdc:mga08x19_318406_c1 3300050514 Bacteria 1082
256 Ga0500572_110967 3300053111 Bacteria 882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2547132181 2547694684 62
2 iso_pu_bacteria 2554235234 2555260300 62
3 iso_pu_bacteria 2854601825 2854603160 62
4 iso_pu_bacteria 2904434214 2904437957 62
5 iso_pu_bacteria 2919108558 2919112058 62
6 iso_pu_bacteria 2971820967 2971824188 62
7 iso_pu_bacteria 3007315729 3007318688 62
8 iso_pu_bacteria 2547132103 2547373892 63
9 iso_pu_bacteria 2843690924 2843694376 63
10 iso_pu_bacteria 2511231006 2511264116 64
11 iso_pu_bacteria 2554235341 2555669006 64
12 iso_pu_bacteria 2599185289 2599889429 64
13 iso_pu_bacteria 2599185291 2599900827 64
14 iso_pu_bacteria 2599185306 2599966479 64
15 iso_pu_bacteria 2599185308 2599977616 64
16 iso_pu_bacteria 2599185314 2600011785 64
17 iso_pu_bacteria 2599185315 2600019397 64
18 iso_pu_bacteria 2599185319 2600039661 64
19 iso_pu_bacteria 2599185320 2600049490 64
20 iso_pu_bacteria 2599185321 2600053907 64
21 iso_pu_bacteria 2599185323 2600064497 64
22 iso_pu_bacteria 2599185324 2600070836 64
23 iso_pu_bacteria 2600255318 2601798868 64
24 iso_pu_bacteria 2603880185 2606077763 64
25 iso_pu_bacteria 2603880199 2606130062 64
26 iso_pu_bacteria 2643221650 2644286322 64
27 iso_pu_bacteria 2667528170 2671093616 64
28 iso_pu_bacteria 2667528176 2671127833 64
29 iso_pu_bacteria 2773857670 2774120517 64
30 iso_pu_bacteria 2784132063 2784263589 64
31 iso_pu_bacteria 2784132072 2784312990 64
32 iso_pu_bacteria 2808606376 2808925726 64
33 iso_pu_bacteria 2808606378 2808934454 64
34 iso_pu_bacteria 2808606380 2808947827 64
35 iso_pu_bacteria 2816332298 2817489646 64
36 iso_pu_bacteria 2842843487 2842848947 64
37 iso_pu_bacteria 2852657418 2852658334 64
38 iso_pu_bacteria 2917070673 2917072801 64
39 iso_pu_bacteria 2919481497 2919482086 64
40 iso_pu_bacteria 2923586266 2923587049 64
41 iso_pu_bacteria 2974289157 2974291918 64
42 iso_pu_bacteria 2998139840 2998143765 64
43 iso_pu_bacteria 8019769354 8019775486 64
44 3300006914 Ga0075436_100381108 Ga0075436_1003811083 65
45 3300013100 Ga0157373_10576971 Ga0157373_105769712 65
46 3300013102 Ga0157371_10130075 Ga0157371_101300754 65
47 3300013104 Ga0157370_10010886 Ga0157370_100108864 65
48 3300013105 Ga0157369_10001847 Ga0157369_1000184719 65
49 3300013105 Ga0157369_12266552 Ga0157369_122665522 65
50 3300015265 Ga0182005_1071868 Ga0182005_10718682 65
51 3300041405 Ga0439438_021907 Ga0439438_021907_572_781 65
52 3300042439 Ga0439464_0057049 Ga0439464_0057049_251_457 65
53 3300046530 Ga0495654_0006076 Ga0495654_0006076_2867_3076 65
54 3300046530 Ga0495654_0044525 Ga0495654_0044525_1861_2070 65
55 3300047323 Ga0495683_0001848 Ga0495683_0001848_10873_11082 65
56 3300048927 Ga0496124_0492812 Ga0496124_0492812_422_631 65
57 3300050514 nmdc:mga08x19_318406_c1 nmdc:mga08x19_318406_c1_634_843 65
58 2010549000 RicEn_C4634 RicEn_82560 66
59 2124908027 MRS2a_Contig_15889 MRS2a_00732660 66
60 3300002737 JGI25162J39368_1001201 JGI25162J39368_10012019 66
61 3300002771 JGI25163J39215_1000357 JGI25163J39215_100035714 66
62 3300002772 JGI25164J39214_1000618 JGI25164J39214_100061814 66
63 3300003214 JGI25165J46597_1001240 JGI25165J46597_100124014 66
64 3300005288 Ga0065714_10002247 Ga0065714_1000224739 66
65 3300005288 Ga0065714_10003904 Ga0065714_1000390410 66
66 3300005288 Ga0065714_10064966 Ga0065714_1006496616 66
67 3300005288 Ga0065714_10099268 Ga0065714_100992683 66
68 3300005288 Ga0065714_10100050 Ga0065714_101000502 66
69 3300005288 Ga0065714_10211070 Ga0065714_102110701 66
70 3300005288 Ga0065714_10240657 Ga0065714_102406572 66
71 3300005288 Ga0065714_10263642 Ga0065714_102636422 66
72 3300005457 Ga0070662_100360796 Ga0070662_1003607962 66
73 3300005578 Ga0068854_100140403 Ga0068854_1001404034 66
74 3300006051 Ga0075364_10021391 Ga0075364_100213914 66
75 3300006058 Ga0075432_10000029 Ga0075432_100000294 66
76 3300006946 Ga0079104_1000213 Ga0079104_100021348 66
77 3300006946 Ga0079104_1006793 Ga0079104_10067932 66
78 3300009011 Ga0105251_10001348 Ga0105251_1000134813 66
79 3300009011 Ga0105251_10007788 Ga0105251_100077883 66
80 3300009011 Ga0105251_10072439 Ga0105251_100724392 66
81 3300009011 Ga0105251_10076217 Ga0105251_100762173 66
82 3300009011 Ga0105251_10092192 Ga0105251_100921923 66
83 3300009036 Ga0105244_10000892 Ga0105244_1000089210 66
84 3300009036 Ga0105244_10001086 Ga0105244_1000108625 66
85 3300009036 Ga0105244_10005022 Ga0105244_1000502211 66
86 3300009036 Ga0105244_10095041 Ga0105244_100950413 66
87 3300009036 Ga0105244_10113228 Ga0105244_101132282 66
88 3300009092 Ga0105250_10004369 Ga0105250_100043696 66
89 3300009092 Ga0105250_10023381 Ga0105250_100233812 66
90 3300009092 Ga0105250_10254843 Ga0105250_102548432 66
91 3300009148 Ga0105243_10017163 Ga0105243_100171634 66
92 3300009148 Ga0105243_10071636 Ga0105243_100716362 66
93 3300009148 Ga0105243_10988566 Ga0105243_109885662 66
94 3300013100 Ga0157373_10001071 Ga0157373_1000107111 66
95 3300013100 Ga0157373_10001161 Ga0157373_1000116118 66
96 3300013100 Ga0157373_11147755 Ga0157373_111477552 66
97 3300013102 Ga0157371_10011434 Ga0157371_1001143411 66
98 3300013102 Ga0157371_10113401 Ga0157371_101134014 66
99 3300013102 Ga0157371_10342272 Ga0157371_103422722 66
100 3300013102 Ga0157371_10481318 Ga0157371_104813182 66
101 3300013102 Ga0157371_11302535 Ga0157371_113025352 66
102 3300013102 Ga0157371_11628933 Ga0157371_116289331 66
103 3300013104 Ga0157370_10017452 Ga0157370_1001745212 66
104 3300013105 Ga0157369_10000624 Ga0157369_100006245 66
105 3300013105 Ga0157369_10002090 Ga0157369_1000209020 66
106 3300013105 Ga0157369_10893709 Ga0157369_108937093 66
107 3300013308 Ga0157375_10687513 Ga0157375_106875132 66
108 3300014497 Ga0182008_10000691 Ga0182008_1000069114 66
109 3300014497 Ga0182008_10001637 Ga0182008_100016372 66
110 3300014497 Ga0182008_10013385 Ga0182008_100133852 66
111 3300014497 Ga0182008_10121422 Ga0182008_101214222 66
112 3300014497 Ga0182008_10159681 Ga0182008_101596812 66
113 3300014497 Ga0182008_10548808 Ga0182008_105488082 66
114 3300015261 Ga0182006_1000336 Ga0182006_100033632 66
115 3300015261 Ga0182006_1000494 Ga0182006_10004945 66
116 3300015261 Ga0182006_1013961 Ga0182006_10139612 66
117 3300015261 Ga0182006_1052901 Ga0182006_10529012 66
118 3300015261 Ga0182006_1069872 Ga0182006_10698722 66
119 3300015261 Ga0182006_1094050 Ga0182006_10940502 66
120 3300015262 Ga0182007_10000336 Ga0182007_1000033638 66
121 3300015262 Ga0182007_10004117 Ga0182007_1000411712 66
122 3300015262 Ga0182007_10054183 Ga0182007_100541832 66
123 3300015265 Ga0182005_1000414 Ga0182005_100041420 66
124 3300015265 Ga0182005_1000479 Ga0182005_100047925 66
125 3300015265 Ga0182005_1039186 Ga0182005_10391862 66
126 3300015265 Ga0182005_1116897 Ga0182005_11168972 66
127 3300017792 Ga0163161_10000558 Ga0163161_1000055811 66
128 3300025207 Ga0209760_100079 Ga0209760_10007969 66
129 3300025231 Ga0207427_100001 Ga0207427_1000011272 66
130 3300025233 Ga0209437_100003 Ga0209437_100003100 66
131 3300025261 Ga0209233_1000007 Ga0209233_10000071272 66
132 3300025711 Ga0207696_1034652 Ga0207696_10346523 66
133 3300025711 Ga0207696_1180400 Ga0207696_11804002 66
134 3300025728 Ga0207655_1000368 Ga0207655_100036864 66
135 3300025728 Ga0207655_1001240 Ga0207655_100124019 66
136 3300025728 Ga0207655_1018781 Ga0207655_10187815 66
137 3300025728 Ga0207655_1119452 Ga0207655_11194522 66
138 3300025735 Ga0207713_1000448 Ga0207713_100044841 66
139 3300025735 Ga0207713_1040699 Ga0207713_10406993 66
140 3300025735 Ga0207713_1126264 Ga0207713_11262643 66
141 3300025935 Ga0207709_10004911 Ga0207709_100049113 66
142 3300025935 Ga0207709_10078853 Ga0207709_100788532 66
143 3300025935 Ga0207709_11069905 Ga0207709_110699053 66
144 3300025935 Ga0207709_11209143 Ga0207709_112091432 66
145 3300025981 Ga0207640_10119954 Ga0207640_101199542 66
146 3300027111 Ga0209281_1000011 Ga0209281_1000011143 66
147 3300027111 Ga0209281_1024822 Ga0209281_10248222 66
148 3300027907 Ga0207428_10000817 Ga0207428_1000081711 66
149 3300031548 Ga0307408_100000399 Ga0307408_10000039910 66
150 3300031548 Ga0307408_100022464 Ga0307408_1000224646 66
151 3300031548 Ga0307408_100103731 Ga0307408_1001037314 66
152 3300031730 Ga0307516_10592990 Ga0307516_105929902 66
153 3300031911 Ga0307412_10000746 Ga0307412_1000074621 66
154 3300031911 Ga0307412_10479666 Ga0307412_104796662 66
155 3300032002 Ga0307416_102612520 Ga0307416_1026125202 66
156 3300037466 Ga0395898_0000989 Ga0395898_0000989_26889_27095 66
157 3300038443 Ga0395901_0000631 Ga0395901_0000631_11078_11284 66
158 3300041405 Ga0439438_000046 Ga0439438_000046_19917_20129 66
159 3300041405 Ga0439438_000119 Ga0439438_000119_7646_7855 66
160 3300041405 Ga0439438_002783 Ga0439438_002783_6638_6850 66
161 3300041407 Ga0439447_000027 Ga0439447_000027_32596_32808 66
162 3300041407 Ga0439447_008356 Ga0439447_008356_1525_1737 66
163 3300041407 Ga0439447_050879 Ga0439447_050879_402_614 66
164 3300041411 Ga0439466_0005457 Ga0439466_0005457_1837_2049 66
165 3300041411 Ga0439466_0013412 Ga0439466_0013412_1215_1427 66
166 3300041411 Ga0439466_0106952 Ga0439466_0106952_11_223 66
167 3300041997 Ga0439431_0000010 Ga0439431_0000010_25682_25894 66
168 3300042002 Ga0439442_062576 Ga0439442_062576_292_504 66
169 3300042006 Ga0439432_000117 Ga0439432_000117_9961_10173 66
170 3300042006 Ga0439432_008274 Ga0439432_008274_3063_3275 66
171 3300042006 Ga0439432_021904 Ga0439432_021904_454_666 66
172 3300042006 Ga0439432_254408 Ga0439432_254408_28_240 66
173 3300042009 Ga0439451_132854 Ga0439451_132854_270_482 66
174 3300042010 Ga0439452_000910 Ga0439452_000910_10681_10893 66
175 3300042010 Ga0439452_001224 Ga0439452_001224_3295_3507 66
176 3300042010 Ga0439452_001341 Ga0439452_001341_6772_6984 66
177 3300042010 Ga0439452_016416 Ga0439452_016416_955_1167 66
178 3300042013 Ga0439456_000048 Ga0439456_000048_32442_32654 66
179 3300042013 Ga0439456_000073 Ga0439456_000073_27544_27756 66
180 3300042013 Ga0439456_000374 Ga0439456_000374_4874_5086 66
181 3300042013 Ga0439456_009791 Ga0439456_009791_1219_1431 66
182 3300042013 Ga0439456_046989 Ga0439456_046989_203_415 66
183 3300042016 Ga0439463_003070 Ga0439463_003070_2610_2822 66
184 3300042016 Ga0439463_005466 Ga0439463_005466_1844_2056 66
185 3300042122 Ga0450920_000040 Ga0450920_000040_11905_12117 66
186 3300042124 Ga0450922_000036 Ga0450922_000036_4046_4258 66
187 3300042137 Ga0450902_003089 Ga0450902_003089_1944_2156 66
188 3300042137 Ga0450902_089085 Ga0450902_089085_210_425 66
189 3300042142 Ga0450905_106288 Ga0450905_106288_125_337 66
190 3300042145 Ga0450906_069633 Ga0450906_069633_295_507 66
191 3300042146 Ga0450907_000075 Ga0450907_000075_26552_26764 66
192 3300042147 Ga0450910_000008 Ga0450910_000008_27310_27522 66
193 3300042184 Ga0450908_000022 Ga0450908_000022_28752_28964 66
194 3300042184 Ga0450908_021370 Ga0450908_021370_627_839 66
195 3300042185 Ga0450909_002562 Ga0450909_002562_1550_1762 66
196 3300042461 Ga0439460_0046843 Ga0439460_0046843_217_429 66
197 3300042993 Ga0439440_0000536 Ga0439440_0000536_2488_2700 66
198 3300044684 Ga0466966_0000025 Ga0466966_0000025_30014_30220 66
199 3300045049 Ga0466959_0000350 Ga0466959_0000350_11873_12079 66
200 3300045836 Ga0466958_0016849 Ga0466958_0016849_3636_3842 66
201 3300045836 Ga0466958_0225863 Ga0466958_0225863_52_258 66
202 3300046452 Ga0495617_007327 Ga0495617_007327_1605_1817 66
203 3300046452 Ga0495617_067452 Ga0495617_067452_558_770 66
204 3300046453 Ga0495627_000358 Ga0495627_000358_30333_30545 66
205 3300046459 Ga0495629_0234548 Ga0495629_0234548_671_883 66
206 3300046460 Ga0495638_0040579 Ga0495638_0040579_1937_2149 66
207 3300046460 Ga0495638_0172927 Ga0495638_0172927_713_925 66
208 3300046460 Ga0495638_0291529 Ga0495638_0291529_257_469 66
209 3300046463 Ga0495653_0001209 Ga0495653_0001209_14600_14812 66
210 3300046463 Ga0495653_0002454 Ga0495653_0002454_6009_6221 66
211 3300046463 Ga0495653_0041157 Ga0495653_0041157_1194_1406 66
212 3300046471 Ga0495650_0000294 Ga0495650_0000294_41055_41267 66
213 3300046471 Ga0495650_0018853 Ga0495650_0018853_1510_1722 66
214 3300046471 Ga0495650_0030771 Ga0495650_0030771_1746_1955 66
215 3300046474 Ga0495605_0000500 Ga0495605_0000500_14705_14908 66
216 3300046492 Ga0495585_0000357 Ga0495585_0000357_31826_32035 66
217 3300046492 Ga0495585_0000552 Ga0495585_0000552_9176_9388 66
218 3300046500 Ga0495596_0006720 Ga0495596_0006720_3211_3423 66
219 3300046501 Ga0495607_0000032 Ga0495607_0000032_32058_32267 66
220 3300046501 Ga0495607_0114262 Ga0495607_0114262_232_444 66
221 3300046507 Ga0495606_0000625 Ga0495606_0000625_24553_24765 66
222 3300046507 Ga0495606_0466311 Ga0495606_0466311_13_225 66
223 3300046512 Ga0495610_0017585 Ga0495610_0017585_797_1006 66
224 3300046512 Ga0495610_0053863 Ga0495610_0053863_60_269 66
225 3300046513 Ga0495616_0375194 Ga0495616_0375194_318_530 66
226 3300046517 Ga0495630_0016872 Ga0495630_0016872_2226_2438 66
227 3300046520 Ga0495637_0000208 Ga0495637_0000208_27785_27997 66
228 3300046522 Ga0495643_0017213 Ga0495643_0017213_2306_2518 66
229 3300046522 Ga0495643_0497132 Ga0495643_0497132_15_227 66
230 3300046524 Ga0495648_0000175 Ga0495648_0000175_21954_22166 66
231 3300046524 Ga0495648_0000260 Ga0495648_0000260_30388_30600 66
232 3300046526 Ga0495666_0000208 Ga0495666_0000208_8498_8710 66
233 3300046526 Ga0495666_0050273 Ga0495666_0050273_1548_1760 66
234 3300046530 Ga0495654_0054538 Ga0495654_0054538_204_413 66
235 3300046536 Ga0495587_0000256 Ga0495587_0000256_29578_29790 66
236 3300046538 Ga0495609_0104813 Ga0495609_0104813_399_611 66
237 3300046557 Ga0495622_0009007 Ga0495622_0009007_1755_1967 66
238 3300046557 Ga0495622_0171648 Ga0495622_0171648_482_694 66
239 3300046648 Ga0495611_0000140 Ga0495611_0000140_12454_12666 66
240 3300046664 Ga0495659_0134294 Ga0495659_0134294_413_625 66
241 3300046679 Ga0495623_0006174 Ga0495623_0006174_1549_1761 66
242 3300046680 Ga0495646_0000121 Ga0495646_0000121_30255_30467 66
243 3300046684 Ga0495669_0049188 Ga0495669_0049188_308_520 66
244 3300046690 Ga0495624_0000344 Ga0495624_0000344_8704_8916 66
245 3300046691 Ga0495670_0009707 Ga0495670_0009707_2382_2591 66
246 3300046691 Ga0495670_0129777 Ga0495670_0129777_1082_1294 66
247 3300046692 Ga0495671_0000114 Ga0495671_0000114_45284_45496 66
248 3300046692 Ga0495671_0012828 Ga0495671_0012828_3826_4035 66
249 3300046694 Ga0495649_0000371 Ga0495649_0000371_26625_26837 66
250 3300046694 Ga0495649_0000381 Ga0495649_0000381_14037_14249 66
251 3300046694 Ga0495649_0197573 Ga0495649_0197573_281_493 66
252 3300046810 Ga0495660_0002529 Ga0495660_0002529_7878_8090 66
253 3300047317 Ga0495604_0000461 Ga0495604_0000461_8513_8725 66
254 3300047320 Ga0495672_0000616 Ga0495672_0000616_29745_29957 66
255 3300047320 Ga0495672_0023372 Ga0495672_0023372_3569_3778 66
256 3300047320 Ga0495672_0296441 Ga0495672_0296441_358_567 66
257 3300047320 Ga0495672_0361896 Ga0495672_0361896_29_241 66
258 3300047322 Ga0495680_0000619 Ga0495680_0000619_10223_10435 66
259 3300047444 Ga0495675_0091929 Ga0495675_0091929_1446_1658 66
260 3300047446 Ga0495679_071516 Ga0495679_071516_228_428 66
261 3300047469 Ga0495673_0000198 Ga0495673_0000198_54163_54375 66
262 3300047470 Ga0495681_0040720 Ga0495681_0040720_409_621 66
263 3300047472 Ga0495686_0000731 Ga0495686_0000731_11916_12128 66
264 3300048091 Ga0495626_0000229 Ga0495626_0000229_39736_39948 66
265 3300048091 Ga0495626_0000515 Ga0495626_0000515_29017_29229 66
266 3300048910 Ga0496107_0105545 Ga0496107_0105545_75_281 66
267 3300048913 Ga0496110_0325842 Ga0496110_0325842_1078_1290 66
268 3300048918 Ga0496115_0501461 Ga0496115_0501461_115_327 66
269 3300048919 Ga0496116_0483411 Ga0496116_0483411_54_266 66
270 3300048920 Ga0496117_0000681 Ga0496117_0000681_41947_42159 66
271 3300048920 Ga0496117_0000849 Ga0496117_0000849_18992_19204 66
272 3300048920 Ga0496117_0001076 Ga0496117_0001076_9941_10153 66
273 3300048921 Ga0496118_0000293 Ga0496118_0000293_58442_58654 66
274 3300048921 Ga0496118_0001122 Ga0496118_0001122_9963_10175 66
275 3300048922 Ga0496119_0000739 Ga0496119_0000739_25016_25219 66
276 3300048922 Ga0496119_0000866 Ga0496119_0000866_29011_29223 66
277 3300048922 Ga0496119_0004057 Ga0496119_0004057_8306_8506 66
278 3300048923 Ga0496120_0000504 Ga0496120_0000504_25927_26130 66
279 3300048923 Ga0496120_0000831 Ga0496120_0000831_29688_29900 66
280 3300048924 Ga0496121_0000299 Ga0496121_0000299_39376_39588 66
281 3300048924 Ga0496121_0001353 Ga0496121_0001353_31798_32010 66
282 3300048924 Ga0496121_0012081 Ga0496121_0012081_14_217 66
283 3300048925 Ga0496122_0001259 Ga0496122_0001259_14399_14611 66
284 3300048925 Ga0496122_0001755 Ga0496122_0001755_17319_17519 66
285 3300048926 Ga0496123_0001022 Ga0496123_0001022_14711_14923 66
286 3300048926 Ga0496123_0001432 Ga0496123_0001432_15812_16012 66
287 3300048927 Ga0496124_0000021 Ga0496124_0000021_223259_223462 66
288 3300048927 Ga0496124_0000270 Ga0496124_0000270_96108_96311 66
289 3300048927 Ga0496124_0003290 Ga0496124_0003290_10135_10347 66
290 3300048928 Ga0496125_0038127 Ga0496125_0038127_3805_4005 66
291 3300048929 Ga0496126_0008304 Ga0496126_0008304_5730_5930 66
292 3300048929 Ga0496126_0021925 Ga0496126_0021925_510_710 66
293 3300048929 Ga0496126_0528408 Ga0496126_0528408_538_750 66
294 3300049459 Ga0495678_143404 Ga0495678_143404_247_459 66
295 3300049460 Ga0495682_0015943 Ga0495682_0015943_1235_1447 66
296 3300049578 Ga0501042_0272970 Ga0501042_0272970_711_920 66
297 3300050491 nmdc:mga00v17_21010_c1 nmdc:mga00v17_21010_c1_2220_2432 66
298 3300050514 nmdc:mga08x19_1034492_c1 nmdc:mga08x19_1034492_c1_332_541 66
299 3300053111 Ga0500572_110967 Ga0500572_110967_226_438 66

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05489

Phage_tail_X

Phage Tail Protein X

3

61

0.96

Feature Viewer

pLDDT pTM Quality
73 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map